diff --git a/go.mod b/go.mod index 54a696df..780b1f3b 100644 --- a/go.mod +++ b/go.mod @@ -5,6 +5,7 @@ go 1.24.0 require ( github.com/NVIDIA/go-nvlib v0.7.4 github.com/NVIDIA/go-nvml v0.12.9-0 + github.com/go-playground/validator/v10 v10.27.0 github.com/sirupsen/logrus v1.9.3 github.com/stretchr/testify v1.10.0 github.com/urfave/cli/v2 v2.27.7 @@ -20,16 +21,20 @@ require ( github.com/davecgh/go-spew v1.1.2-0.20180830191138-d8f796af33cc // indirect github.com/emicklei/go-restful/v3 v3.11.0 // indirect github.com/fxamacker/cbor/v2 v2.7.0 // indirect + github.com/gabriel-vasile/mimetype v1.4.8 // indirect github.com/go-logr/logr v1.4.2 // indirect github.com/go-openapi/jsonpointer v0.21.0 // indirect github.com/go-openapi/jsonreference v0.20.2 // indirect github.com/go-openapi/swag v0.23.0 // indirect + github.com/go-playground/locales v0.14.1 // indirect + github.com/go-playground/universal-translator v0.18.1 // indirect github.com/gogo/protobuf v1.3.2 // indirect github.com/google/gnostic-models v0.6.9 // indirect github.com/google/go-cmp v0.7.0 // indirect github.com/google/uuid v1.6.0 // indirect github.com/josharian/intern v1.0.0 // indirect github.com/json-iterator/go v1.1.12 // indirect + github.com/leodido/go-urn v1.4.0 // indirect github.com/mailru/easyjson v0.7.7 // indirect github.com/modern-go/concurrent v0.0.0-20180306012644-bacd9c7ef1dd // indirect github.com/modern-go/reflect2 v1.0.2 // indirect @@ -40,6 +45,7 @@ require ( github.com/spf13/pflag v1.0.5 // indirect github.com/x448/float16 v0.8.4 // indirect github.com/xrash/smetrics v0.0.0-20240521201337-686a1a2994c1 // indirect + golang.org/x/crypto v0.36.0 // indirect golang.org/x/net v0.38.0 // indirect golang.org/x/oauth2 v0.27.0 // indirect golang.org/x/sys v0.31.0 // indirect diff --git a/go.sum b/go.sum index bddc3689..2d4783ae 100644 --- a/go.sum +++ b/go.sum @@ -13,6 +13,8 @@ github.com/emicklei/go-restful/v3 v3.11.0 h1:rAQeMHw1c7zTmncogyy8VvRZwtkmkZ4FxER github.com/emicklei/go-restful/v3 v3.11.0/go.mod h1:6n3XBCmQQb25CM2LCACGz8ukIrRry+4bhvbpWn3mrbc= github.com/fxamacker/cbor/v2 v2.7.0 h1:iM5WgngdRBanHcxugY4JySA0nk1wZorNOpTgCMedv5E= github.com/fxamacker/cbor/v2 v2.7.0/go.mod h1:pxXPTn3joSm21Gbwsv0w9OSA2y1HFR9qXEeXQVeNoDQ= +github.com/gabriel-vasile/mimetype v1.4.8 h1:FfZ3gj38NjllZIeJAmMhr+qKL8Wu+nOoI3GqacKw1NM= +github.com/gabriel-vasile/mimetype v1.4.8/go.mod h1:ByKUIKGjh1ODkGM1asKUbQZOLGrPjydw3hYPU2YU9t8= github.com/go-logr/logr v1.4.2 h1:6pFjapn8bFcIbiKo3XT4j/BhANplGihG6tvd+8rYgrY= github.com/go-logr/logr v1.4.2/go.mod h1:9T104GzyrTigFIr8wt5mBrctHMim0Nb2HLGrmQ40KvY= github.com/go-openapi/jsonpointer v0.19.6/go.mod h1:osyAmYz/mB/C3I+WsTTSgw1ONzaLJoLCyoi6/zppojs= @@ -23,6 +25,14 @@ github.com/go-openapi/jsonreference v0.20.2/go.mod h1:Bl1zwGIM8/wsvqjsOQLJ/SH+En github.com/go-openapi/swag v0.22.3/go.mod h1:UzaqsxGiab7freDnrUUra0MwWfN/q7tE4j+VcZ0yl14= github.com/go-openapi/swag v0.23.0 h1:vsEVJDUo2hPJ2tu0/Xc+4noaxyEffXNIs3cOULZ+GrE= github.com/go-openapi/swag v0.23.0/go.mod h1:esZ8ITTYEsH1V2trKHjAN8Ai7xHb8RV+YSZ577vPjgQ= +github.com/go-playground/assert/v2 v2.2.0 h1:JvknZsQTYeFEAhQwI4qEt9cyV5ONwRHC+lYKSsYSR8s= +github.com/go-playground/assert/v2 v2.2.0/go.mod h1:VDjEfimB/XKnb+ZQfWdccd7VUvScMdVu0Titje2rxJ4= +github.com/go-playground/locales v0.14.1 h1:EWaQ/wswjilfKLTECiXz7Rh+3BjFhfDFKv/oXslEjJA= +github.com/go-playground/locales v0.14.1/go.mod h1:hxrqLVvrK65+Rwrd5Fc6F2O76J/NuW9t0sjnWqG1slY= +github.com/go-playground/universal-translator v0.18.1 h1:Bcnm0ZwsGyWbCzImXv+pAJnYK9S473LQFuzCbDbfSFY= +github.com/go-playground/universal-translator v0.18.1/go.mod h1:xekY+UJKNuX9WP91TpwSH2VMlDf28Uj24BCp08ZFTUY= +github.com/go-playground/validator/v10 v10.27.0 h1:w8+XrWVMhGkxOaaowyKH35gFydVHOvC0/uWoy2Fzwn4= +github.com/go-playground/validator/v10 v10.27.0/go.mod h1:I5QpIEbmr8On7W0TktmJAumgzX4CA1XNl4ZmDuVHKKo= github.com/go-task/slim-sprig/v3 v3.0.0 h1:sUs3vkvUymDpBKi3qH1YSqBQk9+9D/8M2mN1vB6EwHI= github.com/go-task/slim-sprig/v3 v3.0.0/go.mod h1:W848ghGpv3Qj3dhTPRyJypKRiqCdHZiAzKg9hl15HA8= github.com/gogo/protobuf v1.3.2 h1:Ov1cvc58UF3b5XjBnZv7+opcTcQFZebYjWzi34vdm4Q= @@ -50,6 +60,8 @@ github.com/kr/pty v1.1.1/go.mod h1:pFQYn66WHrOpPYNljwOMqo10TkYh1fy3cYio2l3bCsQ= github.com/kr/text v0.1.0/go.mod h1:4Jbv+DJW3UT/LiOwJeYQe1efqtUx/iVham/4vfdArNI= github.com/kr/text v0.2.0 h1:5Nx0Ya0ZqY2ygV366QzturHI13Jq95ApcVaJBhpS+AY= github.com/kr/text v0.2.0/go.mod h1:eLer722TekiGuMkidMxC/pM04lWEeraHUUmBw8l2grE= +github.com/leodido/go-urn v1.4.0 h1:WT9HwE9SGECu3lg4d/dIA+jxlljEa1/ffXKmRjqdmIQ= +github.com/leodido/go-urn v1.4.0/go.mod h1:bvxc+MVxLKB4z00jd1z+Dvzr47oO32F/QSNjSBOlFxI= github.com/mailru/easyjson v0.7.7 h1:UGYAvKxe3sBsEDzO8ZeWOSlIQfWFlxbzLZe7hwFURr0= github.com/mailru/easyjson v0.7.7/go.mod h1:xzfreul335JAWq5oZzymOObrkdz5UnU4kGfJJLY9Nlc= github.com/modern-go/concurrent v0.0.0-20180228061459-e0a39a4cb421/go.mod h1:6dJC0mAP4ikYIbvyc7fijjWJddQyLn8Ig3JB5CqoB9Q= @@ -101,6 +113,8 @@ go.uber.org/goleak v1.3.0/go.mod h1:CoHD4mav9JJNrW/WLlf7HGZPjdw8EucARQHekz1X6bE= golang.org/x/crypto v0.0.0-20190308221718-c2843e01d9a2/go.mod h1:djNgcEr1/C05ACkg1iLfiJU5Ep61QUkGW8qpdssI0+w= golang.org/x/crypto v0.0.0-20191011191535-87dc89f01550/go.mod h1:yigFU9vqHzYiE8UmvKecakEJjdnWj3jj499lnFckfCI= golang.org/x/crypto v0.0.0-20200622213623-75b288015ac9/go.mod h1:LzIPMQfyMNhhGPhUkYOs5KpL4U8rLKemX1yGLhDgUto= +golang.org/x/crypto v0.36.0 h1:AnAEvhDddvBdpY+uR+MyHmuZzzNqXSe/GvuDeob5L34= +golang.org/x/crypto v0.36.0/go.mod h1:Y4J0ReaxCR1IMaabaSMugxJES1EpwhBHhv2bDHklZvc= golang.org/x/mod v0.2.0/go.mod h1:s0Qsj1ACt9ePp/hMypM3fl4fZqREWJwdYDEqhRiZZUA= golang.org/x/mod v0.3.0/go.mod h1:s0Qsj1ACt9ePp/hMypM3fl4fZqREWJwdYDEqhRiZZUA= golang.org/x/net v0.0.0-20190404232315-eb5bcb51f2a3/go.mod h1:t9HGtf8HONx5eT2rtn7q6eTqICYqUVnKs3thJo3Qplg= diff --git a/pkg/mig/reconfigure/api.go b/pkg/mig/reconfigure/api.go new file mode 100644 index 00000000..86b34245 --- /dev/null +++ b/pkg/mig/reconfigure/api.go @@ -0,0 +1,40 @@ +package reconfigure + +import "os/exec" + +const ( + MIGConfigStateLabel = "nvidia.com/mig.config.state" + VGPUConfigStateLabel = "nvidia.com/vgpu.config.state" +) + +// A Reconfigurer applies a specified MIG configuration. +type Reconfigurer interface { + Reconfigure() error +} + +// A commandRunner is used to run a constructed command. +// This interface allows us to inject a runner for testing. +// +//go:generate moq -rm -fmt=goimports -out command-runner_mock.go . commandRunner +type commandRunner interface { + Run(*exec.Cmd) error +} + +// migParted defines an interface for interacting with mig-parted. +// +//go:generate moq -rm -fmt=goimports -out mig-parted_mock.go . migParted +type migParted interface { + assertValidMIGConfig() error + assertMIGConfig() error + assertMIGModeOnly() error + applyMIGModeOnly() error + applyMIGConfig() error +} + +// nodeLabeller defines an interface for interacting with node labels. +// +//go:generate moq -rm -fmt=goimports -out node-labeller_mock.go . nodeLabeller +type nodeLabeller interface { + getNodeLabelValue(string) (string, error) + setNodeLabelValue(string, string) error +} diff --git a/pkg/mig/reconfigure/command-runner_mock.go b/pkg/mig/reconfigure/command-runner_mock.go new file mode 100644 index 00000000..53e61859 --- /dev/null +++ b/pkg/mig/reconfigure/command-runner_mock.go @@ -0,0 +1,75 @@ +// Code generated by moq; DO NOT EDIT. +// github.com/matryer/moq + +package reconfigure + +import ( + "os/exec" + "sync" +) + +// Ensure, that commandRunnerMock does implement commandRunner. +// If this is not the case, regenerate this file with moq. +var _ commandRunner = &commandRunnerMock{} + +// commandRunnerMock is a mock implementation of commandRunner. +// +// func TestSomethingThatUsescommandRunner(t *testing.T) { +// +// // make and configure a mocked commandRunner +// mockedcommandRunner := &commandRunnerMock{ +// RunFunc: func(cmd *exec.Cmd) error { +// panic("mock out the Run method") +// }, +// } +// +// // use mockedcommandRunner in code that requires commandRunner +// // and then make assertions. +// +// } +type commandRunnerMock struct { + // RunFunc mocks the Run method. + RunFunc func(cmd *exec.Cmd) error + + // calls tracks calls to the methods. + calls struct { + // Run holds details about calls to the Run method. + Run []struct { + // Cmd is the cmd argument value. + Cmd *exec.Cmd + } + } + lockRun sync.RWMutex +} + +// Run calls RunFunc. +func (mock *commandRunnerMock) Run(cmd *exec.Cmd) error { + if mock.RunFunc == nil { + panic("commandRunnerMock.RunFunc: method is nil but commandRunner.Run was just called") + } + callInfo := struct { + Cmd *exec.Cmd + }{ + Cmd: cmd, + } + mock.lockRun.Lock() + mock.calls.Run = append(mock.calls.Run, callInfo) + mock.lockRun.Unlock() + return mock.RunFunc(cmd) +} + +// RunCalls gets all the calls that were made to Run. +// Check the length with: +// +// len(mockedcommandRunner.RunCalls()) +func (mock *commandRunnerMock) RunCalls() []struct { + Cmd *exec.Cmd +} { + var calls []struct { + Cmd *exec.Cmd + } + mock.lockRun.RLock() + calls = mock.calls.Run + mock.lockRun.RUnlock() + return calls +} diff --git a/pkg/mig/reconfigure/mig-parted_mock.go b/pkg/mig/reconfigure/mig-parted_mock.go new file mode 100644 index 00000000..b3996137 --- /dev/null +++ b/pkg/mig/reconfigure/mig-parted_mock.go @@ -0,0 +1,215 @@ +// Code generated by moq; DO NOT EDIT. +// github.com/matryer/moq + +package reconfigure + +import ( + "sync" +) + +// Ensure, that migPartedMock does implement migParted. +// If this is not the case, regenerate this file with moq. +var _ migParted = &migPartedMock{} + +// migPartedMock is a mock implementation of migParted. +// +// func TestSomethingThatUsesmigParted(t *testing.T) { +// +// // make and configure a mocked migParted +// mockedmigParted := &migPartedMock{ +// applyMIGConfigFunc: func() error { +// panic("mock out the applyMIGConfig method") +// }, +// applyMIGModeOnlyFunc: func() error { +// panic("mock out the applyMIGModeOnly method") +// }, +// assertMIGConfigFunc: func() error { +// panic("mock out the assertMIGConfig method") +// }, +// assertMIGModeOnlyFunc: func() error { +// panic("mock out the assertMIGModeOnly method") +// }, +// assertValidMIGConfigFunc: func() error { +// panic("mock out the assertValidMIGConfig method") +// }, +// } +// +// // use mockedmigParted in code that requires migParted +// // and then make assertions. +// +// } +type migPartedMock struct { + // applyMIGConfigFunc mocks the applyMIGConfig method. + applyMIGConfigFunc func() error + + // applyMIGModeOnlyFunc mocks the applyMIGModeOnly method. + applyMIGModeOnlyFunc func() error + + // assertMIGConfigFunc mocks the assertMIGConfig method. + assertMIGConfigFunc func() error + + // assertMIGModeOnlyFunc mocks the assertMIGModeOnly method. + assertMIGModeOnlyFunc func() error + + // assertValidMIGConfigFunc mocks the assertValidMIGConfig method. + assertValidMIGConfigFunc func() error + + // calls tracks calls to the methods. + calls struct { + // applyMIGConfig holds details about calls to the applyMIGConfig method. + applyMIGConfig []struct { + } + // applyMIGModeOnly holds details about calls to the applyMIGModeOnly method. + applyMIGModeOnly []struct { + } + // assertMIGConfig holds details about calls to the assertMIGConfig method. + assertMIGConfig []struct { + } + // assertMIGModeOnly holds details about calls to the assertMIGModeOnly method. + assertMIGModeOnly []struct { + } + // assertValidMIGConfig holds details about calls to the assertValidMIGConfig method. + assertValidMIGConfig []struct { + } + } + lockapplyMIGConfig sync.RWMutex + lockapplyMIGModeOnly sync.RWMutex + lockassertMIGConfig sync.RWMutex + lockassertMIGModeOnly sync.RWMutex + lockassertValidMIGConfig sync.RWMutex +} + +// applyMIGConfig calls applyMIGConfigFunc. +func (mock *migPartedMock) applyMIGConfig() error { + if mock.applyMIGConfigFunc == nil { + panic("migPartedMock.applyMIGConfigFunc: method is nil but migParted.applyMIGConfig was just called") + } + callInfo := struct { + }{} + mock.lockapplyMIGConfig.Lock() + mock.calls.applyMIGConfig = append(mock.calls.applyMIGConfig, callInfo) + mock.lockapplyMIGConfig.Unlock() + return mock.applyMIGConfigFunc() +} + +// applyMIGConfigCalls gets all the calls that were made to applyMIGConfig. +// Check the length with: +// +// len(mockedmigParted.applyMIGConfigCalls()) +func (mock *migPartedMock) applyMIGConfigCalls() []struct { +} { + var calls []struct { + } + mock.lockapplyMIGConfig.RLock() + calls = mock.calls.applyMIGConfig + mock.lockapplyMIGConfig.RUnlock() + return calls +} + +// applyMIGModeOnly calls applyMIGModeOnlyFunc. +func (mock *migPartedMock) applyMIGModeOnly() error { + if mock.applyMIGModeOnlyFunc == nil { + panic("migPartedMock.applyMIGModeOnlyFunc: method is nil but migParted.applyMIGModeOnly was just called") + } + callInfo := struct { + }{} + mock.lockapplyMIGModeOnly.Lock() + mock.calls.applyMIGModeOnly = append(mock.calls.applyMIGModeOnly, callInfo) + mock.lockapplyMIGModeOnly.Unlock() + return mock.applyMIGModeOnlyFunc() +} + +// applyMIGModeOnlyCalls gets all the calls that were made to applyMIGModeOnly. +// Check the length with: +// +// len(mockedmigParted.applyMIGModeOnlyCalls()) +func (mock *migPartedMock) applyMIGModeOnlyCalls() []struct { +} { + var calls []struct { + } + mock.lockapplyMIGModeOnly.RLock() + calls = mock.calls.applyMIGModeOnly + mock.lockapplyMIGModeOnly.RUnlock() + return calls +} + +// assertMIGConfig calls assertMIGConfigFunc. +func (mock *migPartedMock) assertMIGConfig() error { + if mock.assertMIGConfigFunc == nil { + panic("migPartedMock.assertMIGConfigFunc: method is nil but migParted.assertMIGConfig was just called") + } + callInfo := struct { + }{} + mock.lockassertMIGConfig.Lock() + mock.calls.assertMIGConfig = append(mock.calls.assertMIGConfig, callInfo) + mock.lockassertMIGConfig.Unlock() + return mock.assertMIGConfigFunc() +} + +// assertMIGConfigCalls gets all the calls that were made to assertMIGConfig. +// Check the length with: +// +// len(mockedmigParted.assertMIGConfigCalls()) +func (mock *migPartedMock) assertMIGConfigCalls() []struct { +} { + var calls []struct { + } + mock.lockassertMIGConfig.RLock() + calls = mock.calls.assertMIGConfig + mock.lockassertMIGConfig.RUnlock() + return calls +} + +// assertMIGModeOnly calls assertMIGModeOnlyFunc. +func (mock *migPartedMock) assertMIGModeOnly() error { + if mock.assertMIGModeOnlyFunc == nil { + panic("migPartedMock.assertMIGModeOnlyFunc: method is nil but migParted.assertMIGModeOnly was just called") + } + callInfo := struct { + }{} + mock.lockassertMIGModeOnly.Lock() + mock.calls.assertMIGModeOnly = append(mock.calls.assertMIGModeOnly, callInfo) + mock.lockassertMIGModeOnly.Unlock() + return mock.assertMIGModeOnlyFunc() +} + +// assertMIGModeOnlyCalls gets all the calls that were made to assertMIGModeOnly. +// Check the length with: +// +// len(mockedmigParted.assertMIGModeOnlyCalls()) +func (mock *migPartedMock) assertMIGModeOnlyCalls() []struct { +} { + var calls []struct { + } + mock.lockassertMIGModeOnly.RLock() + calls = mock.calls.assertMIGModeOnly + mock.lockassertMIGModeOnly.RUnlock() + return calls +} + +// assertValidMIGConfig calls assertValidMIGConfigFunc. +func (mock *migPartedMock) assertValidMIGConfig() error { + if mock.assertValidMIGConfigFunc == nil { + panic("migPartedMock.assertValidMIGConfigFunc: method is nil but migParted.assertValidMIGConfig was just called") + } + callInfo := struct { + }{} + mock.lockassertValidMIGConfig.Lock() + mock.calls.assertValidMIGConfig = append(mock.calls.assertValidMIGConfig, callInfo) + mock.lockassertValidMIGConfig.Unlock() + return mock.assertValidMIGConfigFunc() +} + +// assertValidMIGConfigCalls gets all the calls that were made to assertValidMIGConfig. +// Check the length with: +// +// len(mockedmigParted.assertValidMIGConfigCalls()) +func (mock *migPartedMock) assertValidMIGConfigCalls() []struct { +} { + var calls []struct { + } + mock.lockassertValidMIGConfig.RLock() + calls = mock.calls.assertValidMIGConfig + mock.lockassertValidMIGConfig.RUnlock() + return calls +} diff --git a/pkg/mig/reconfigure/node-labeller_mock.go b/pkg/mig/reconfigure/node-labeller_mock.go new file mode 100644 index 00000000..24c88036 --- /dev/null +++ b/pkg/mig/reconfigure/node-labeller_mock.go @@ -0,0 +1,124 @@ +// Code generated by moq; DO NOT EDIT. +// github.com/matryer/moq + +package reconfigure + +import ( + "sync" +) + +// Ensure, that nodeLabellerMock does implement nodeLabeller. +// If this is not the case, regenerate this file with moq. +var _ nodeLabeller = &nodeLabellerMock{} + +// nodeLabellerMock is a mock implementation of nodeLabeller. +// +// func TestSomethingThatUsesnodeLabeller(t *testing.T) { +// +// // make and configure a mocked nodeLabeller +// mockednodeLabeller := &nodeLabellerMock{ +// getNodeLabelValueFunc: func(s string) (string, error) { +// panic("mock out the getNodeLabelValue method") +// }, +// setNodeLabelValueFunc: func(s1 string, s2 string) error { +// panic("mock out the setNodeLabelValue method") +// }, +// } +// +// // use mockednodeLabeller in code that requires nodeLabeller +// // and then make assertions. +// +// } +type nodeLabellerMock struct { + // getNodeLabelValueFunc mocks the getNodeLabelValue method. + getNodeLabelValueFunc func(s string) (string, error) + + // setNodeLabelValueFunc mocks the setNodeLabelValue method. + setNodeLabelValueFunc func(s1 string, s2 string) error + + // calls tracks calls to the methods. + calls struct { + // getNodeLabelValue holds details about calls to the getNodeLabelValue method. + getNodeLabelValue []struct { + // S is the s argument value. + S string + } + // setNodeLabelValue holds details about calls to the setNodeLabelValue method. + setNodeLabelValue []struct { + // S1 is the s1 argument value. + S1 string + // S2 is the s2 argument value. + S2 string + } + } + lockgetNodeLabelValue sync.RWMutex + locksetNodeLabelValue sync.RWMutex +} + +// getNodeLabelValue calls getNodeLabelValueFunc. +func (mock *nodeLabellerMock) getNodeLabelValue(s string) (string, error) { + if mock.getNodeLabelValueFunc == nil { + panic("nodeLabellerMock.getNodeLabelValueFunc: method is nil but nodeLabeller.getNodeLabelValue was just called") + } + callInfo := struct { + S string + }{ + S: s, + } + mock.lockgetNodeLabelValue.Lock() + mock.calls.getNodeLabelValue = append(mock.calls.getNodeLabelValue, callInfo) + mock.lockgetNodeLabelValue.Unlock() + return mock.getNodeLabelValueFunc(s) +} + +// getNodeLabelValueCalls gets all the calls that were made to getNodeLabelValue. +// Check the length with: +// +// len(mockednodeLabeller.getNodeLabelValueCalls()) +func (mock *nodeLabellerMock) getNodeLabelValueCalls() []struct { + S string +} { + var calls []struct { + S string + } + mock.lockgetNodeLabelValue.RLock() + calls = mock.calls.getNodeLabelValue + mock.lockgetNodeLabelValue.RUnlock() + return calls +} + +// setNodeLabelValue calls setNodeLabelValueFunc. +func (mock *nodeLabellerMock) setNodeLabelValue(s1 string, s2 string) error { + if mock.setNodeLabelValueFunc == nil { + panic("nodeLabellerMock.setNodeLabelValueFunc: method is nil but nodeLabeller.setNodeLabelValue was just called") + } + callInfo := struct { + S1 string + S2 string + }{ + S1: s1, + S2: s2, + } + mock.locksetNodeLabelValue.Lock() + mock.calls.setNodeLabelValue = append(mock.calls.setNodeLabelValue, callInfo) + mock.locksetNodeLabelValue.Unlock() + return mock.setNodeLabelValueFunc(s1, s2) +} + +// setNodeLabelValueCalls gets all the calls that were made to setNodeLabelValue. +// Check the length with: +// +// len(mockednodeLabeller.setNodeLabelValueCalls()) +func (mock *nodeLabellerMock) setNodeLabelValueCalls() []struct { + S1 string + S2 string +} { + var calls []struct { + S1 string + S2 string + } + mock.locksetNodeLabelValue.RLock() + calls = mock.calls.setNodeLabelValue + mock.locksetNodeLabelValue.RUnlock() + return calls +} diff --git a/pkg/mig/reconfigure/options.go b/pkg/mig/reconfigure/options.go new file mode 100644 index 00000000..b27337d3 --- /dev/null +++ b/pkg/mig/reconfigure/options.go @@ -0,0 +1,149 @@ +/** +# SPDX-FileCopyrightText: Copyright (c) 2025 NVIDIA CORPORATION & AFFILIATES. All rights reserved. +# SPDX-License-Identifier: Apache-2.0 +# +# Licensed under the Apache License, Version 2.0 (the "License"); +# you may not use this file except in compliance with the License. +# You may obtain a copy of the License at +# +# http://www.apache.org/licenses/LICENSE-2.0 +# +# Unless required by applicable law or agreed to in writing, software +# distributed under the License is distributed on an "AS IS" BASIS, +# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +# See the License for the specific language governing permissions and +# limitations under the License. +**/ + +package reconfigure + +import ( + "k8s.io/client-go/kubernetes" +) + +// An Option represents a functional option passed to the constructor. +type Option func(*reconfigureMIGOptions) + +// reconfigureMIGOptions contains configuration options for reconfiguring MIG +// settings on a Kubernetes node. This struct is used to manage the various +// parameters required for applying MIG configurations through mig-parted, including node identification, configuration files, reboot behavior, and host +// system service management. +type reconfigureMIGOptions struct { + clientset *kubernetes.Clientset `validate:"required"` + + // NodeName is the kubernetes node to change the MIG configuration on. + // Its validation follows the RFC 1123 standard for DNS subdomain names. + // Source: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#dns-subdomain-names + NodeName string `validate:"required,hostname_rfc1123"` + + // MIGPartedConfigFile is the mig-parted configuration file path. + MIGPartedConfigFile string `validate:"required,filepath"` + + // SelectedMIGConfig is the selected mig-parted configuration to apply to the + // node. + // TODO: Define the validation schema. + SelectedMIGConfig string `validate:"required"` + + // DriverLibraryPath is the path to libnvidia-ml.so.1 in the container. + DriverLibraryPath string `validate:"required,filepath"` + + // WithReboot reboots the node if changing the MIG mode fails for any reason. + WithReboot bool + + // WithShutdownHostGPUClients shutdowns/restarts any required host GPU clients + // across a MIG configuration. + WithShutdownHostGPUClients bool + + // HostRootMount is the container path where host root directory is mounted. + HostRootMount string `validate:"dirpath"` + + // HostMIGManagerStateFile is the path where the systemd mig-manager state + // file is located. + HostMIGManagerStateFile string `validate:"omitempty,filepath"` + + // HostGPUClientServices is a comma separated list of host systemd services to + // shutdown/restart across a MIG reconfiguration. + HostGPUClientServices []string `validate:"dive,systemd_service_name"` + + // HostKubeletService is the name of the host's 'kubelet' systemd service + // which may need to be shutdown/restarted across a MIG mode reconfiguration. + HostKubeletService string `validate:"omitempty,systemd_service_name"` + + // TODO: Define the validation schema. + ConfigStateLabel string `validate:"required"` + + // TODO: The following is not an option, but is tracked during the reconfiguration. + hostGPUClientServicesStopped []string +} + +func WithAllowReboot(allowReboot bool) Option { + return func(o *reconfigureMIGOptions) { + o.WithReboot = allowReboot + } +} + +func WithClientset(clientset *kubernetes.Clientset) Option { + return func(o *reconfigureMIGOptions) { + o.clientset = clientset + } +} + +func WithConfigStateLabel(configStateLabel string) Option { + return func(o *reconfigureMIGOptions) { + o.ConfigStateLabel = configStateLabel + } +} + +func WithDriverLibraryPath(driverLibraryPath string) Option { + return func(o *reconfigureMIGOptions) { + o.DriverLibraryPath = driverLibraryPath + } +} + +func WithHostGPUClientServices(hostGPUClientServices ...string) Option { + return func(o *reconfigureMIGOptions) { + o.HostGPUClientServices = append([]string{}, hostGPUClientServices...) + } +} + +func WithHostKubeletService(hostKubeletService string) Option { + return func(o *reconfigureMIGOptions) { + o.HostKubeletService = hostKubeletService + } +} + +func WithHostMIGManagerStateFile(hostMIGManagerStateFile string) Option { + return func(o *reconfigureMIGOptions) { + o.HostMIGManagerStateFile = hostMIGManagerStateFile + } +} + +func WithHostRootMount(hostRootMount string) Option { + return func(o *reconfigureMIGOptions) { + o.HostRootMount = hostRootMount + } +} + +func WithMIGPartedConfigFile(migPartedConfigFile string) Option { + return func(o *reconfigureMIGOptions) { + o.MIGPartedConfigFile = migPartedConfigFile + } +} + +func WithNodeName(nodeName string) Option { + return func(o *reconfigureMIGOptions) { + o.NodeName = nodeName + } +} + +func WithSelectedMIGConfig(selectedMIGConfig string) Option { + return func(o *reconfigureMIGOptions) { + o.SelectedMIGConfig = selectedMIGConfig + } +} + +func WithShutdownHostGPUClients(shutdownHostGPUClients bool) Option { + return func(o *reconfigureMIGOptions) { + o.WithShutdownHostGPUClients = shutdownHostGPUClients + } +} diff --git a/pkg/mig/reconfigure/reconfigure.go b/pkg/mig/reconfigure/reconfigure.go new file mode 100644 index 00000000..8c0b50bc --- /dev/null +++ b/pkg/mig/reconfigure/reconfigure.go @@ -0,0 +1,436 @@ +/** +# SPDX-FileCopyrightText: Copyright (c) 2025 NVIDIA CORPORATION & AFFILIATES. All rights reserved. +# SPDX-License-Identifier: Apache-2.0 +# +# Licensed under the Apache License, Version 2.0 (the "License"); +# you may not use this file except in compliance with the License. +# You may obtain a copy of the License at +# +# http://www.apache.org/licenses/LICENSE-2.0 +# +# Unless required by applicable law or agreed to in writing, software +# distributed under the License is distributed on an "AS IS" BASIS, +# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +# See the License for the specific language governing permissions and +# limitations under the License. +**/ + +package reconfigure + +import ( + "context" + "errors" + "fmt" + "os" + "os/exec" + "path/filepath" + "strings" + "time" + + log "github.com/sirupsen/logrus" + metav1 "k8s.io/apimachinery/pkg/apis/meta/v1" + "k8s.io/client-go/kubernetes" +) + +const ( + migPartedCliName = "nvidia-mig-parted" + + configStateRebooting = "rebooting" + + ldPreloadEnvVar = "LD_PRELOAD" +) + +type reconfigurer struct { + *reconfigureMIGOptions + commandRunner + migParted migParted + node nodeLabeller +} + +// A commandWithOutput runs a command and ensures that STDERR and STDOUT are +// set. +type commandWithOutput struct{} + +var _ commandRunner = (*commandWithOutput)(nil) + +// New creates a MIG Reconfigurer with the supplied options. +func New(opts ...Option) (Reconfigurer, error) { + o := &reconfigureMIGOptions{} + + for _, opt := range opts { + opt(o) + } + + if err := o.Validate(); err != nil { + return nil, err + } + + c := &commandWithOutput{} + + r := &reconfigurer{ + reconfigureMIGOptions: o, + commandRunner: c, + migParted: &migPartedCLI{ + MIGPartedConfigFile: o.MIGPartedConfigFile, + SelectedMIGConfig: o.SelectedMIGConfig, + DriverLibraryPath: o.DriverLibraryPath, + commandRunner: c, + }, + node: &node{ + clientset: o.clientset, + name: o.NodeName, + }, + } + + return r, nil +} + +// Reconfigure configures MIG (Multi-Instance GPU) settings on a Kubernetes +// node. It validates the requested configuration, checks the current state, +// applies MIG mode changes, manages host GPU client services, and handles +// reboots when necessary. The function ensures that MIG configurations are +// applied safely with proper service lifecycle management. +func (opts *reconfigurer) Reconfigure() error { + log.Info("Asserting that the requested configuration is present in the configuration file") + if err := opts.migParted.assertValidMIGConfig(); err != nil { + return fmt.Errorf("error validating the selected MIG configuration: %w", err) + } + + log.Infof("Getting current value of the '%s' node label", opts.ConfigStateLabel) + state, err := opts.node.getNodeLabelValue(opts.ConfigStateLabel) + if err != nil { + return fmt.Errorf("unable to get the value of the %q label: %w", opts.ConfigStateLabel, err) + } + log.Infof("Current value of '%s=%s'", opts.ConfigStateLabel, state) + + log.Info("Checking if the selected MIG config is currently applied or not") + if err := opts.migParted.assertMIGConfig(); err == nil { + log.Info("MIG configuration already applied") + return nil + } + + if opts.HostRootMount != "" && opts.HostMIGManagerStateFile != "" { + stateFilePath := filepath.Join(opts.HostRootMount, opts.HostMIGManagerStateFile) + if _, err := os.Stat(stateFilePath); err == nil { + log.Infof("Persisting %s to %s", opts.SelectedMIGConfig, opts.HostMIGManagerStateFile) + if err := opts.hostPersistConfig(); err != nil { + return fmt.Errorf("unable to persist %s to %s: %w", opts.SelectedMIGConfig, opts.HostMIGManagerStateFile, err) + } + } + } + + log.Info("Checking if the MIG mode setting in the selected config is currently applied or not") + log.Infof("If the state is '%s', we expect this to always return true", configStateRebooting) + migModeChangeRequired := false + if err := opts.migParted.assertMIGModeOnly(); err != nil { + if state == configStateRebooting { + return fmt.Errorf("MIG mode change failed after reboot: %w", err) + } + if opts.WithShutdownHostGPUClients { + opts.HostGPUClientServices = append(opts.HostGPUClientServices, opts.HostKubeletService) + } + migModeChangeRequired = true + } + + if opts.WithShutdownHostGPUClients { + log.Info("Shutting down all GPU clients on the host by stopping their systemd services") + if err := opts.hostStopSystemdServices(); err != nil { + return fmt.Errorf("unable to shutdown host GPU clients: %w", err) + } + if migModeChangeRequired { + log.Info("Waiting 30 seconds for services to settle") + time.Sleep(30 * time.Second) + } + } + + log.Info("Applying the MIG mode change from the selected config to the node (and double checking it took effect)") + log.Info("If the -r option was passed, the node will be automatically rebooted if this is not successful") + if err := opts.migParted.applyMIGModeOnly(); err != nil || opts.migParted.assertMIGModeOnly() != nil { + if opts.WithReboot { + log.Infof("Changing the '%s' node label to '%s'", opts.ConfigStateLabel, configStateRebooting) + if err := opts.node.setNodeLabelValue(opts.ConfigStateLabel, configStateRebooting); err != nil { + log.Errorf("Unable to set the value of '%s' to '%s'", opts.ConfigStateLabel, configStateRebooting) + log.Error("Exiting so as not to reboot multiple times unexpectedly") + return fmt.Errorf("unable to set the value of %q to %q: %w", opts.ConfigStateLabel, configStateRebooting, err) + } + return rebootHost(opts.HostRootMount) + } + } + + log.Info("Applying the selected MIG config to the node") + if err := opts.migParted.applyMIGConfig(); err != nil { + return err + } + + if opts.WithShutdownHostGPUClients { + log.Info("Restarting all GPU clients previously shutdown on the host by restarting their systemd services") + if err := opts.hostStartSystemdServices(); err != nil { + return fmt.Errorf("unable to restart host GPU clients: %w", err) + } + } + + return nil +} + +type migPartedCLI struct { + MIGPartedConfigFile string + SelectedMIGConfig string + DriverLibraryPath string + commandRunner +} + +var _ migParted = (*migPartedCLI)(nil) + +func (opts *migPartedCLI) assertValidMIGConfig() error { + args := []string{ + "--debug", + "assert", + "--valid-config", + "--config-file", opts.MIGPartedConfigFile, + "--selected-config", opts.SelectedMIGConfig, + } + return opts.runMigParted(args...) +} + +func (opts *migPartedCLI) assertMIGConfig() error { + args := []string{ + "--debug", + "assert", + "--config-file", opts.MIGPartedConfigFile, + "--selected-config", opts.SelectedMIGConfig, + } + return opts.runMigParted(args...) +} + +func (opts *migPartedCLI) assertMIGModeOnly() error { + args := []string{ + "--debug", + "assert", + "--mode-only", + "--config-file", opts.MIGPartedConfigFile, + "--selected-config", opts.SelectedMIGConfig, + } + return opts.runMigParted(args...) +} + +func (opts *migPartedCLI) applyMIGModeOnly() error { + args := []string{ + "--debug", + "apply", + "--mode-only", + "--config-file", opts.MIGPartedConfigFile, + "--selected-config", opts.SelectedMIGConfig, + } + return opts.runMigParted(args...) +} + +func (opts *migPartedCLI) applyMIGConfig() error { + args := []string{ + "--debug", + "apply", + "--config-file", opts.MIGPartedConfigFile, + "--selected-config", opts.SelectedMIGConfig, + } + return opts.runMigParted(args...) +} + +func (opts *reconfigurer) hostPersistConfig() error { + config := fmt.Sprintf(`[Service] +Environment="MIG_PARTED_SELECTED_CONFIG=%s" +`, opts.SelectedMIGConfig) + + stateFilePath := filepath.Join(opts.HostRootMount, opts.HostMIGManagerStateFile) + // #nosec G306 -- We cannot use 0600 here as the file is read by systemd. + if err := os.WriteFile(stateFilePath, []byte(config), 0644); err != nil { + return err + } + + cmd := exec.Command("chroot", opts.HostRootMount, "systemctl", "daemon-reload") // #nosec G204 -- HostRootMount is validated via dirpath validator. + return opts.Run(cmd) +} + +func (opts *reconfigureMIGOptions) hostStopSystemdServices() error { + opts.hostGPUClientServicesStopped = []string{} + + for _, service := range opts.HostGPUClientServices { + if err := processSystemdService(opts, service, "stop"); err != nil { + return err + } + } + return nil +} + +func (opts *reconfigureMIGOptions) hostStartSystemdServices() error { + if len(opts.hostGPUClientServicesStopped) == 0 { + for _, service := range opts.HostGPUClientServices { + if shouldRestartService(opts, service) { + opts.hostGPUClientServicesStopped = append(opts.hostGPUClientServicesStopped, service) + } + } + } + + var errs error + for _, service := range opts.hostGPUClientServicesStopped { + log.Infof("Starting %s", service) + cmd := exec.Command("chroot", opts.HostRootMount, "systemctl", "start", service) // #nosec G204 -- HostRootMount validated via dirpath, service validated via systemd_service_name. + if err := cmd.Run(); err != nil { + serviceError := fmt.Errorf("error starting %q: %w", service, err) + log.Errorf("%v; skipping, but continuing...", serviceError) + + errs = errors.Join(errs, serviceError) + } + } + + if errs != nil { + return fmt.Errorf("some services failed to start: %w", errs) + } + return nil +} + +func processSystemdService(opts *reconfigureMIGOptions, service, action string) error { + cmd := exec.Command("chroot", opts.HostRootMount, "systemctl", "-q", "is-active", service) // #nosec G204 -- HostRootMount validated via dirpath, service validated via systemd_service_name. + if err := cmd.Run(); err == nil { + log.Infof("%s %s (active, will-restart)", action, service) + cmd = exec.Command("chroot", opts.HostRootMount, "systemctl", action, service) // #nosec G204 -- HostRootMount validated via dirpath, service validated via systemd_service_name, action is controlled parameter. + if err := cmd.Run(); err != nil { + return err + } + if action == "stop" { + opts.hostGPUClientServicesStopped = append([]string{service}, opts.hostGPUClientServicesStopped...) + } + return nil + } + + cmd = exec.Command("chroot", opts.HostRootMount, "systemctl", "-q", "is-enabled", service) // #nosec G204 -- HostRootMount validated via dirpath, service validated via systemd_service_name. + if err := cmd.Run(); err != nil { + log.Infof("Skipping %s (no-exist)", service) + return nil + } + + cmd = exec.Command("chroot", opts.HostRootMount, "systemctl", "-q", "is-failed", service) // #nosec G204 -- HostRootMount validated via dirpath, service validated via systemd_service_name. + if err := cmd.Run(); err == nil { + log.Infof("Skipping %s (is-failed, will-restart)", service) + if action == "stop" { + opts.hostGPUClientServicesStopped = append([]string{service}, opts.hostGPUClientServicesStopped...) + } + return nil + } + + cmd = exec.Command("chroot", opts.HostRootMount, "systemctl", "-q", "is-enabled", service) // #nosec G204 -- HostRootMount validated via dirpath, service validated via systemd_service_name. + if err := cmd.Run(); err != nil { + log.Infof("Skipping %s (disabled)", service) + return nil + } + + cmd = exec.Command("chroot", opts.HostRootMount, "systemctl", "show", "--property=Type", service) // #nosec G204 -- HostRootMount validated via dirpath, service validated via systemd_service_name. + output, err := cmd.Output() + if err != nil { + return err + } + if strings.TrimSpace(string(output)) == "Type=oneshot" { + log.Infof("Skipping %s (inactive, oneshot, no-restart)", service) + return nil + } + + log.Infof("Skipping %s (inactive, will-restart)", service) + if action == "stop" { + opts.hostGPUClientServicesStopped = append([]string{service}, opts.hostGPUClientServicesStopped...) + } + return nil +} + +func shouldRestartService(opts *reconfigureMIGOptions, service string) bool { + cmd := exec.Command("chroot", opts.HostRootMount, "systemctl", "-q", "is-active", service) // #nosec G204 -- HostRootMount validated via dirpath, service validated via systemd_service_name. + if err := cmd.Run(); err == nil { + return false + } + + cmd = exec.Command("chroot", opts.HostRootMount, "systemctl", "-q", "is-enabled", service) // #nosec G204 -- HostRootMount validated via dirpath, service validated via systemd_service_name. + if err := cmd.Run(); err != nil { + return false + } + + cmd = exec.Command("chroot", opts.HostRootMount, "systemctl", "-q", "is-failed", service) // #nosec G204 -- HostRootMount validated via dirpath, service validated via systemd_service_name. + if err := cmd.Run(); err == nil { + return true + } + + cmd = exec.Command("chroot", opts.HostRootMount, "systemctl", "-q", "is-enabled", service) // #nosec G204 -- HostRootMount validated via dirpath, service validated via systemd_service_name. + if err := cmd.Run(); err != nil { + return false + } + + cmd = exec.Command("chroot", opts.HostRootMount, "systemctl", "show", "--property=Type", service) // #nosec G204 -- HostRootMount validated via dirpath, service validated via systemd_service_name. + output, err := cmd.Output() + if err != nil { + return false + } + if strings.TrimSpace(string(output)) == "Type=oneshot" { + return false + } + + return true +} + +func (c *commandWithOutput) Run(cmd *exec.Cmd) error { + cmd.Stdout = os.Stdout + cmd.Stderr = os.Stderr + return cmd.Run() +} + +func (opts *migPartedCLI) runMigParted(args ...string) error { + cmd := opts.migPartedCmd(args...) + return opts.Run(cmd) +} + +func (opts *migPartedCLI) migPartedCmd(args ...string) *exec.Cmd { + cmd := exec.Command(migPartedCliName, args...) + cmd.Env = append(os.Environ(), fmt.Sprintf("%s=%s", ldPreloadEnvVar, opts.DriverLibraryPath)) + return cmd +} + +func rebootHost(hostRootMount string) error { + cmd := exec.Command("chroot", hostRootMount, "reboot") + if err := cmd.Start(); err != nil { + return err + } + + os.Exit(0) + return nil +} + +type node struct { + clientset *kubernetes.Clientset + name string +} + +func (n *node) getNodeLabelValue(label string) (string, error) { + node, err := n.clientset.CoreV1().Nodes().Get(context.TODO(), n.name, metav1.GetOptions{}) + if err != nil { + return "", fmt.Errorf("unable to get node object: %w", err) + } + + value, ok := node.Labels[label] + if !ok { + return "", nil + } + + return value, nil +} + +func (n *node) setNodeLabelValue(label, value string) error { + node, err := n.clientset.CoreV1().Nodes().Get(context.TODO(), n.name, metav1.GetOptions{}) + if err != nil { + return fmt.Errorf("unable to get node object: %w", err) + } + + labels := node.GetLabels() + labels[label] = value + node.SetLabels(labels) + _, err = n.clientset.CoreV1().Nodes().Update(context.TODO(), node, metav1.UpdateOptions{}) + if err != nil { + return fmt.Errorf("unable to update node object: %w", err) + } + + return nil +} diff --git a/pkg/mig/reconfigure/reconfigure_test.go b/pkg/mig/reconfigure/reconfigure_test.go new file mode 100644 index 00000000..83754d84 --- /dev/null +++ b/pkg/mig/reconfigure/reconfigure_test.go @@ -0,0 +1,352 @@ +/** +# SPDX-FileCopyrightText: Copyright (c) 2025 NVIDIA CORPORATION & AFFILIATES. All rights reserved. +# SPDX-License-Identifier: Apache-2.0 +# +# Licensed under the Apache License, Version 2.0 (the "License"); +# you may not use this file except in compliance with the License. +# You may obtain a copy of the License at +# +# http://www.apache.org/licenses/LICENSE-2.0 +# +# Unless required by applicable law or agreed to in writing, software +# distributed under the License is distributed on an "AS IS" BASIS, +# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +# See the License for the specific language governing permissions and +# limitations under the License. +**/ + +package reconfigure + +import ( + "fmt" + "os/exec" + "testing" + + "github.com/stretchr/testify/require" +) + +type commandRunnerWithCLI struct { + mock *commandRunnerMock + calls [][]string +} + +func (c *commandRunnerWithCLI) Run(cmd *exec.Cmd) error { + c.calls = append(c.calls, append([]string{cmd.Path}, cmd.Args...)) + return c.mock.Run(cmd) +} + +type nodeWithLabels struct { + mock *nodeLabellerMock + setLabels map[string]string +} + +func (n *nodeWithLabels) getNodeLabelValue(label string) (string, error) { + return n.mock.getNodeLabelValue(label) +} + +func (n *nodeWithLabels) setNodeLabelValue(label string, value string) error { + if err := n.mock.setNodeLabelValue(label, value); err != nil { + return err + } + if n.setLabels == nil { + n.setLabels = make(map[string]string) + } + n.setLabels[label] = value + return nil +} + +func TestReconfigure(t *testing.T) { + testCases := []struct { + description string + options reconfigureMIGOptions + migParted *migPartedMock + checkMigParted func(*migPartedMock) + nodeLabeller *nodeWithLabels + checkNodeLabeller func(*nodeWithLabels) + expectedError error + expectedCalls [][]string + }{ + { + description: "mig assert valid config failure does not call commands", + options: reconfigureMIGOptions{ + NodeName: "NodeName", + MIGPartedConfigFile: "/path/to/config/file.yaml", + SelectedMIGConfig: "selected-mig-config", + DriverLibraryPath: "/path/to/libnvidia-ml.so.1", + HostRootMount: "/host/", + ConfigStateLabel: "example.com/config.state", + }, + migParted: &migPartedMock{ + assertValidMIGConfigFunc: func() error { + return fmt.Errorf("invalid mig config") + }, + }, + checkMigParted: func(mpm *migPartedMock) { + require.Len(t, mpm.calls.assertValidMIGConfig, 1) + require.Len(t, mpm.calls.applyMIGConfig, 0) + require.Len(t, mpm.calls.assertMIGModeOnly, 0) + require.Len(t, mpm.calls.applyMIGModeOnly, 0) + require.Len(t, mpm.calls.applyMIGConfig, 0) + }, + expectedError: fmt.Errorf("error validating the selected MIG configuration: invalid mig config"), + expectedCalls: nil, + }, + { + description: "node label error is causes exit", + options: reconfigureMIGOptions{ + NodeName: "NodeName", + MIGPartedConfigFile: "/path/to/config/file.yaml", + SelectedMIGConfig: "selected-mig-config", + DriverLibraryPath: "/path/to/libnvidia-ml.so.1", + HostRootMount: "/host/", + ConfigStateLabel: "example.com/config.state", + }, + migParted: &migPartedMock{ + assertValidMIGConfigFunc: func() error { + return nil + }, + }, + checkMigParted: func(mpm *migPartedMock) { + require.Len(t, mpm.calls.assertValidMIGConfig, 1) + require.Len(t, mpm.calls.applyMIGConfig, 0) + require.Len(t, mpm.calls.assertMIGModeOnly, 0) + require.Len(t, mpm.calls.applyMIGModeOnly, 0) + require.Len(t, mpm.calls.applyMIGConfig, 0) + }, + nodeLabeller: &nodeWithLabels{ + mock: &nodeLabellerMock{ + getNodeLabelValueFunc: func(s string) (string, error) { + return "", fmt.Errorf("error getting label") + }, + }, + }, + checkNodeLabeller: func(nwl *nodeWithLabels) { + calls := nwl.mock.getNodeLabelValueCalls() + require.Len(t, calls, 1) + require.EqualValues(t, []struct{ S string }{{"example.com/config.state"}}, calls) + }, + expectedError: fmt.Errorf(`unable to get the value of the "example.com/config.state" label: error getting label`), + }, + { + description: "reconfigure exits if config is applied", + options: reconfigureMIGOptions{ + NodeName: "NodeName", + MIGPartedConfigFile: "/path/to/config/file.yaml", + SelectedMIGConfig: "selected-mig-config", + DriverLibraryPath: "/path/to/libnvidia-ml.so.1", + HostRootMount: "/host/", + ConfigStateLabel: "example.com/config.state", + }, + migParted: &migPartedMock{ + assertValidMIGConfigFunc: func() error { + return nil + }, + assertMIGConfigFunc: func() error { + return nil + }, + }, + checkMigParted: func(mpm *migPartedMock) { + require.Len(t, mpm.calls.assertValidMIGConfig, 1) + require.Len(t, mpm.calls.assertMIGConfig, 1) + require.Len(t, mpm.calls.applyMIGConfig, 0) + require.Len(t, mpm.calls.assertMIGModeOnly, 0) + require.Len(t, mpm.calls.applyMIGModeOnly, 0) + }, + nodeLabeller: &nodeWithLabels{ + mock: &nodeLabellerMock{ + getNodeLabelValueFunc: func(s string) (string, error) { + return "current-state", nil + }, + }, + }, + checkNodeLabeller: func(nwl *nodeWithLabels) { + calls := nwl.mock.getNodeLabelValueCalls() + require.Len(t, calls, 1) + require.EqualValues(t, []struct{ S string }{{"example.com/config.state"}}, calls) + }, + expectedError: nil, + }, + { + description: "mode change required after reboot is error", + options: reconfigureMIGOptions{ + NodeName: "NodeName", + MIGPartedConfigFile: "/path/to/config/file.yaml", + SelectedMIGConfig: "selected-mig-config", + DriverLibraryPath: "/path/to/libnvidia-ml.so.1", + HostRootMount: "/host/", + ConfigStateLabel: "example.com/config.state", + }, + migParted: &migPartedMock{ + assertValidMIGConfigFunc: func() error { + return nil + }, + assertMIGConfigFunc: func() error { + return fmt.Errorf("config needs updating") + }, + assertMIGModeOnlyFunc: func() error { + return fmt.Errorf("mode needs updating") + }, + }, + checkMigParted: func(mpm *migPartedMock) { + require.Len(t, mpm.calls.assertValidMIGConfig, 1) + require.Len(t, mpm.calls.assertMIGConfig, 1) + require.Len(t, mpm.calls.assertMIGModeOnly, 1) + require.Len(t, mpm.calls.applyMIGConfig, 0) + require.Len(t, mpm.calls.applyMIGModeOnly, 0) + }, + nodeLabeller: &nodeWithLabels{ + mock: &nodeLabellerMock{ + getNodeLabelValueFunc: func(s string) (string, error) { + return "rebooting", nil + }, + }, + }, + checkNodeLabeller: func(nwl *nodeWithLabels) { + calls := nwl.mock.getNodeLabelValueCalls() + require.Len(t, calls, 1) + require.EqualValues(t, []struct{ S string }{{"example.com/config.state"}}, calls) + }, + expectedError: fmt.Errorf("MIG mode change failed after reboot: mode needs updating"), + }, + { + description: "mode does not need updating; apply config error is returned", + options: reconfigureMIGOptions{ + NodeName: "NodeName", + MIGPartedConfigFile: "/path/to/config/file.yaml", + SelectedMIGConfig: "selected-mig-config", + DriverLibraryPath: "/path/to/libnvidia-ml.so.1", + HostRootMount: "/host/", + ConfigStateLabel: "example.com/config.state", + }, + migParted: &migPartedMock{ + assertValidMIGConfigFunc: func() error { + return nil + }, + assertMIGConfigFunc: func() error { + return fmt.Errorf("config needs updating") + }, + assertMIGModeOnlyFunc: func() error { + return nil + }, + applyMIGModeOnlyFunc: func() error { + return nil + }, + applyMIGConfigFunc: func() error { + return fmt.Errorf("failed to apply config") + }, + }, + checkMigParted: func(mpm *migPartedMock) { + require.Len(t, mpm.calls.assertValidMIGConfig, 1) + require.Len(t, mpm.calls.assertMIGConfig, 1) + require.Len(t, mpm.calls.assertMIGModeOnly, 2) + require.Len(t, mpm.calls.applyMIGModeOnly, 1) + require.Len(t, mpm.calls.applyMIGConfig, 1) + }, + nodeLabeller: &nodeWithLabels{ + mock: &nodeLabellerMock{ + getNodeLabelValueFunc: func(s string) (string, error) { + return "current-state", nil + }, + }, + }, + checkNodeLabeller: func(nwl *nodeWithLabels) { + calls := nwl.mock.getNodeLabelValueCalls() + require.Len(t, calls, 1) + require.EqualValues(t, []struct{ S string }{{"example.com/config.state"}}, calls) + }, + expectedError: fmt.Errorf("failed to apply config"), + }, + { + description: "mode does not need updating; apply config succeeds", + options: reconfigureMIGOptions{ + NodeName: "NodeName", + MIGPartedConfigFile: "/path/to/config/file.yaml", + SelectedMIGConfig: "selected-mig-config", + DriverLibraryPath: "/path/to/libnvidia-ml.so.1", + HostRootMount: "/host/", + ConfigStateLabel: "example.com/config.state", + }, + migParted: &migPartedMock{ + assertValidMIGConfigFunc: func() error { + return nil + }, + assertMIGConfigFunc: func() error { + return fmt.Errorf("config needs updating") + }, + assertMIGModeOnlyFunc: func() error { + return nil + }, + applyMIGModeOnlyFunc: func() error { + return nil + }, + applyMIGConfigFunc: func() error { + return nil + }, + }, + checkMigParted: func(mpm *migPartedMock) { + require.Len(t, mpm.calls.assertValidMIGConfig, 1) + require.Len(t, mpm.calls.assertMIGConfig, 1) + require.Len(t, mpm.calls.assertMIGModeOnly, 2) + require.Len(t, mpm.calls.applyMIGModeOnly, 1) + require.Len(t, mpm.calls.applyMIGConfig, 1) + }, + nodeLabeller: &nodeWithLabels{ + mock: &nodeLabellerMock{ + getNodeLabelValueFunc: func(s string) (string, error) { + return "current-state", nil + }, + }, + }, + checkNodeLabeller: func(nwl *nodeWithLabels) { + calls := nwl.mock.getNodeLabelValueCalls() + require.Len(t, calls, 1) + require.EqualValues(t, []struct{ S string }{{"example.com/config.state"}}, calls) + }, + expectedError: nil, + }, + } + + for _, tc := range testCases { + commandRunner := &commandRunnerWithCLI{ + mock: &commandRunnerMock{ + RunFunc: func(cmd *exec.Cmd) error { + return fmt.Errorf("error running command %v", cmd.Path) + }, + }, + } + + t.Run(tc.description, func(t *testing.T) { + // TODO: Once we have better mocks in place for the following + // functionality, we can update this. + require.False(t, tc.options.WithReboot) + require.False(t, tc.options.WithShutdownHostGPUClients) + + // We test explicit validation in a separate test. + // For now we only ensure that the options are valid. + require.NoError(t, tc.options.Validate()) + + r := &reconfigurer{ + reconfigureMIGOptions: &tc.options, + commandRunner: commandRunner, + migParted: tc.migParted, + node: tc.nodeLabeller, + } + + err := r.Reconfigure() + if tc.expectedError == nil { + require.NoError(t, err) + } else { + require.EqualError(t, err, tc.expectedError.Error()) + } + + if tc.checkMigParted != nil { + tc.checkMigParted(tc.migParted) + } + if tc.checkNodeLabeller != nil { + tc.checkNodeLabeller(tc.nodeLabeller) + } + + require.EqualValues(t, tc.expectedCalls, commandRunner.calls) + }) + } +} diff --git a/pkg/mig/reconfigure/validate.go b/pkg/mig/reconfigure/validate.go new file mode 100644 index 00000000..a25ad0b7 --- /dev/null +++ b/pkg/mig/reconfigure/validate.go @@ -0,0 +1,82 @@ +/** +# SPDX-FileCopyrightText: Copyright (c) 2025 NVIDIA CORPORATION & AFFILIATES. All rights reserved. +# SPDX-License-Identifier: Apache-2.0 +# +# Licensed under the Apache License, Version 2.0 (the "License"); +# you may not use this file except in compliance with the License. +# You may obtain a copy of the License at +# +# http://www.apache.org/licenses/LICENSE-2.0 +# +# Unless required by applicable law or agreed to in writing, software +# distributed under the License is distributed on an "AS IS" BASIS, +# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +# See the License for the specific language governing permissions and +# limitations under the License. +**/ + +package reconfigure + +import ( + "fmt" + "regexp" + "strings" + + "github.com/go-playground/validator/v10" +) + +var ( + systemdServicePrefixPattern = regexp.MustCompile(`^[a-zA-Z0-9:._\\-]+\.(service|socket|device|mount|automount|swap|target|path|timer|slice|scope)$`) +) + +// Validate the MIG reconfiguration options. +func (o *reconfigureMIGOptions) Validate() error { + validate := validator.New(validator.WithRequiredStructEnabled()) + + err := validate.RegisterValidation("systemd_service_name", validateSystemdServiceName) + if err != nil { + return fmt.Errorf("unable to register systemd service name validator: %w", err) + } + return validate.Struct(o) +} + +// validateSystemdServiceName validates a systemd service name according to systemd naming rules. +// The unit name prefix must consist of one or more valid characters (ASCII letters, digits, ":", "-", "_", ".", and "\"). +// The total length of the unit name including the suffix must not exceed 255 characters. +// The unit type suffix must be one of ".service", ".socket", ".device", ".mount", ".automount", ".swap", ".target", ".path", ".timer", ".slice", or ".scope". +// Source: https://www.freedesktop.org/software/systemd/man/latest/systemd.unit.html +func validateSystemdServiceName(fl validator.FieldLevel) bool { + serviceName := fl.Field().String() + + if len(serviceName) == 0 || len(serviceName) > 255 { + return false + } + + validSuffixes := []string{ + ".service", + ".socket", + ".device", + ".mount", + ".automount", + ".swap", + ".target", + ".path", + ".timer", + ".slice", + ".scope", + } + + hasSuffix := false + for _, suffix := range validSuffixes { + if strings.HasSuffix(serviceName, suffix) { + hasSuffix = true + break + } + } + + if !hasSuffix { + return false + } + + return systemdServicePrefixPattern.MatchString(serviceName) +} diff --git a/vendor/github.com/gabriel-vasile/mimetype/.gitattributes b/vendor/github.com/gabriel-vasile/mimetype/.gitattributes new file mode 100644 index 00000000..0cc26ec0 --- /dev/null +++ b/vendor/github.com/gabriel-vasile/mimetype/.gitattributes @@ -0,0 +1 @@ +testdata/* linguist-vendored diff --git a/vendor/github.com/gabriel-vasile/mimetype/CODE_OF_CONDUCT.md b/vendor/github.com/gabriel-vasile/mimetype/CODE_OF_CONDUCT.md new file mode 100644 index 00000000..8479cd87 --- /dev/null +++ b/vendor/github.com/gabriel-vasile/mimetype/CODE_OF_CONDUCT.md @@ -0,0 +1,76 @@ +# Contributor Covenant Code of Conduct + +## Our Pledge + +In the interest of fostering an open and welcoming environment, we as +contributors and maintainers pledge to making participation in our project and +our community a harassment-free experience for everyone, regardless of age, body +size, disability, ethnicity, sex characteristics, gender identity and expression, +level of experience, education, socio-economic status, nationality, personal +appearance, race, religion, or sexual identity and orientation. + +## Our Standards + +Examples of behavior that contributes to creating a positive environment +include: + +* Using welcoming and inclusive language +* Being respectful of differing viewpoints and experiences +* Gracefully accepting constructive criticism +* Focusing on what is best for the community +* Showing empathy towards other community members + +Examples of unacceptable behavior by participants include: + +* The use of sexualized language or imagery and unwelcome sexual attention or + advances +* Trolling, insulting/derogatory comments, and personal or political attacks +* Public or private harassment +* Publishing others' private information, such as a physical or electronic + address, without explicit permission +* Other conduct which could reasonably be considered inappropriate in a + professional setting + +## Our Responsibilities + +Project maintainers are responsible for clarifying the standards of acceptable +behavior and are expected to take appropriate and fair corrective action in +response to any instances of unacceptable behavior. + +Project maintainers have the right and responsibility to remove, edit, or +reject comments, commits, code, wiki edits, issues, and other contributions +that are not aligned to this Code of Conduct, or to ban temporarily or +permanently any contributor for other behaviors that they deem inappropriate, +threatening, offensive, or harmful. + +## Scope + +This Code of Conduct applies both within project spaces and in public spaces +when an individual is representing the project or its community. Examples of +representing a project or community include using an official project e-mail +address, posting via an official social media account, or acting as an appointed +representative at an online or offline event. Representation of a project may be +further defined and clarified by project maintainers. + +## Enforcement + +Instances of abusive, harassing, or otherwise unacceptable behavior may be +reported by contacting the project team at vasile.gabriel@email.com. All +complaints will be reviewed and investigated and will result in a response that +is deemed necessary and appropriate to the circumstances. The project team is +obligated to maintain confidentiality with regard to the reporter of an incident. +Further details of specific enforcement policies may be posted separately. + +Project maintainers who do not follow or enforce the Code of Conduct in good +faith may face temporary or permanent repercussions as determined by other +members of the project's leadership. + +## Attribution + +This Code of Conduct is adapted from the [Contributor Covenant][homepage], version 1.4, +available at https://www.contributor-covenant.org/version/1/4/code-of-conduct.html + +[homepage]: https://www.contributor-covenant.org + +For answers to common questions about this code of conduct, see +https://www.contributor-covenant.org/faq diff --git a/vendor/github.com/gabriel-vasile/mimetype/CONTRIBUTING.md b/vendor/github.com/gabriel-vasile/mimetype/CONTRIBUTING.md new file mode 100644 index 00000000..56ae4e57 --- /dev/null +++ b/vendor/github.com/gabriel-vasile/mimetype/CONTRIBUTING.md @@ -0,0 +1,12 @@ +## Contribute +Contributions to **mimetype** are welcome. If you find an issue and you consider +contributing, you can use the [Github issues tracker](https://github.com/gabriel-vasile/mimetype/issues) +in order to report it, or better yet, open a pull request. + +Code contributions must respect these rules: + - code must be test covered + - code must be formatted using gofmt tool + - exported names must be documented + +**Important**: By submitting a pull request, you agree to allow the project +owner to license your work under the same license as that used by the project. diff --git a/vendor/github.com/gabriel-vasile/mimetype/LICENSE b/vendor/github.com/gabriel-vasile/mimetype/LICENSE new file mode 100644 index 00000000..13b61daa --- /dev/null +++ b/vendor/github.com/gabriel-vasile/mimetype/LICENSE @@ -0,0 +1,21 @@ +MIT License + +Copyright (c) 2018 Gabriel Vasile + +Permission is hereby granted, free of charge, to any person obtaining a copy +of this software and associated documentation files (the "Software"), to deal +in the Software without restriction, including without limitation the rights +to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +copies of the Software, and to permit persons to whom the Software is +furnished to do so, subject to the following conditions: + +The above copyright notice and this permission notice shall be included in all +copies or substantial portions of the Software. + +THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE +SOFTWARE. diff --git a/vendor/github.com/gabriel-vasile/mimetype/README.md b/vendor/github.com/gabriel-vasile/mimetype/README.md new file mode 100644 index 00000000..aa88b4bd --- /dev/null +++ b/vendor/github.com/gabriel-vasile/mimetype/README.md @@ -0,0 +1,102 @@ +

+ mimetype +

+ +

+ A package for detecting MIME types and extensions based on magic numbers +

+
+ Goroutine safe, extensible, no C bindings +
+ +

+ + Go Reference + + + Go report card + + + License + +

+ +## Features +- fast and precise MIME type and file extension detection +- long list of [supported MIME types](supported_mimes.md) +- possibility to [extend](https://pkg.go.dev/github.com/gabriel-vasile/mimetype#example-package-Extend) with other file formats +- common file formats are prioritized +- [text vs. binary files differentiation](https://pkg.go.dev/github.com/gabriel-vasile/mimetype#example-package-TextVsBinary) +- safe for concurrent usage + +## Install +```bash +go get github.com/gabriel-vasile/mimetype +``` + +## Usage +```go +mtype := mimetype.Detect([]byte) +// OR +mtype, err := mimetype.DetectReader(io.Reader) +// OR +mtype, err := mimetype.DetectFile("/path/to/file") +fmt.Println(mtype.String(), mtype.Extension()) +``` +See the [runnable Go Playground examples](https://pkg.go.dev/github.com/gabriel-vasile/mimetype#pkg-overview). + +## Usage' +Only use libraries like **mimetype** as a last resort. Content type detection +using magic numbers is slow, inaccurate, and non-standard. Most of the times +protocols have methods for specifying such metadata; e.g., `Content-Type` header +in HTTP and SMTP. + +## FAQ +Q: My file is in the list of [supported MIME types](supported_mimes.md) but +it is not correctly detected. What should I do? + +A: Some file formats (often Microsoft Office documents) keep their signatures +towards the end of the file. Try increasing the number of bytes used for detection +with: +```go +mimetype.SetLimit(1024*1024) // Set limit to 1MB. +// or +mimetype.SetLimit(0) // No limit, whole file content used. +mimetype.DetectFile("file.doc") +``` +If increasing the limit does not help, please +[open an issue](https://github.com/gabriel-vasile/mimetype/issues/new?assignees=&labels=&template=mismatched-mime-type-detected.md&title=). + +## Structure +**mimetype** uses a hierarchical structure to keep the MIME type detection logic. +This reduces the number of calls needed for detecting the file type. The reason +behind this choice is that there are file formats used as containers for other +file formats. For example, Microsoft Office files are just zip archives, +containing specific metadata files. Once a file has been identified as a +zip, there is no need to check if it is a text file, but it is worth checking if +it is an Microsoft Office file. + +To prevent loading entire files into memory, when detecting from a +[reader](https://pkg.go.dev/github.com/gabriel-vasile/mimetype#DetectReader) +or from a [file](https://pkg.go.dev/github.com/gabriel-vasile/mimetype#DetectFile) +**mimetype** limits itself to reading only the header of the input. +
+ how project is structured +
+ +## Performance +Thanks to the hierarchical structure, searching for common formats first, +and limiting itself to file headers, **mimetype** matches the performance of +stdlib `http.DetectContentType` while outperforming the alternative package. + +```bash + mimetype http.DetectContentType filetype +BenchmarkMatchTar-24 250 ns/op 400 ns/op 3778 ns/op +BenchmarkMatchZip-24 524 ns/op 351 ns/op 4884 ns/op +BenchmarkMatchJpeg-24 103 ns/op 228 ns/op 839 ns/op +BenchmarkMatchGif-24 139 ns/op 202 ns/op 751 ns/op +BenchmarkMatchPng-24 165 ns/op 221 ns/op 1176 ns/op +``` + +## Contributing +See [CONTRIBUTING.md](CONTRIBUTING.md). diff --git a/vendor/github.com/gabriel-vasile/mimetype/internal/charset/charset.go b/vendor/github.com/gabriel-vasile/mimetype/internal/charset/charset.go new file mode 100644 index 00000000..0647f730 --- /dev/null +++ b/vendor/github.com/gabriel-vasile/mimetype/internal/charset/charset.go @@ -0,0 +1,309 @@ +package charset + +import ( + "bytes" + "encoding/xml" + "strings" + "unicode/utf8" + + "golang.org/x/net/html" +) + +const ( + F = 0 /* character never appears in text */ + T = 1 /* character appears in plain ASCII text */ + I = 2 /* character appears in ISO-8859 text */ + X = 3 /* character appears in non-ISO extended ASCII (Mac, IBM PC) */ +) + +var ( + boms = []struct { + bom []byte + enc string + }{ + {[]byte{0xEF, 0xBB, 0xBF}, "utf-8"}, + {[]byte{0x00, 0x00, 0xFE, 0xFF}, "utf-32be"}, + {[]byte{0xFF, 0xFE, 0x00, 0x00}, "utf-32le"}, + {[]byte{0xFE, 0xFF}, "utf-16be"}, + {[]byte{0xFF, 0xFE}, "utf-16le"}, + } + + // https://github.com/file/file/blob/fa93fb9f7d21935f1c7644c47d2975d31f12b812/src/encoding.c#L241 + textChars = [256]byte{ + /* BEL BS HT LF VT FF CR */ + F, F, F, F, F, F, F, T, T, T, T, T, T, T, F, F, /* 0x0X */ + /* ESC */ + F, F, F, F, F, F, F, F, F, F, F, T, F, F, F, F, /* 0x1X */ + T, T, T, T, T, T, T, T, T, T, T, T, T, T, T, T, /* 0x2X */ + T, T, T, T, T, T, T, T, T, T, T, T, T, T, T, T, /* 0x3X */ + T, T, T, T, T, T, T, T, T, T, T, T, T, T, T, T, /* 0x4X */ + T, T, T, T, T, T, T, T, T, T, T, T, T, T, T, T, /* 0x5X */ + T, T, T, T, T, T, T, T, T, T, T, T, T, T, T, T, /* 0x6X */ + T, T, T, T, T, T, T, T, T, T, T, T, T, T, T, F, /* 0x7X */ + /* NEL */ + X, X, X, X, X, T, X, X, X, X, X, X, X, X, X, X, /* 0x8X */ + X, X, X, X, X, X, X, X, X, X, X, X, X, X, X, X, /* 0x9X */ + I, I, I, I, I, I, I, I, I, I, I, I, I, I, I, I, /* 0xaX */ + I, I, I, I, I, I, I, I, I, I, I, I, I, I, I, I, /* 0xbX */ + I, I, I, I, I, I, I, I, I, I, I, I, I, I, I, I, /* 0xcX */ + I, I, I, I, I, I, I, I, I, I, I, I, I, I, I, I, /* 0xdX */ + I, I, I, I, I, I, I, I, I, I, I, I, I, I, I, I, /* 0xeX */ + I, I, I, I, I, I, I, I, I, I, I, I, I, I, I, I, /* 0xfX */ + } +) + +// FromBOM returns the charset declared in the BOM of content. +func FromBOM(content []byte) string { + for _, b := range boms { + if bytes.HasPrefix(content, b.bom) { + return b.enc + } + } + return "" +} + +// FromPlain returns the charset of a plain text. It relies on BOM presence +// and it falls back on checking each byte in content. +func FromPlain(content []byte) string { + if len(content) == 0 { + return "" + } + if cset := FromBOM(content); cset != "" { + return cset + } + origContent := content + // Try to detect UTF-8. + // First eliminate any partial rune at the end. + for i := len(content) - 1; i >= 0 && i > len(content)-4; i-- { + b := content[i] + if b < 0x80 { + break + } + if utf8.RuneStart(b) { + content = content[:i] + break + } + } + hasHighBit := false + for _, c := range content { + if c >= 0x80 { + hasHighBit = true + break + } + } + if hasHighBit && utf8.Valid(content) { + return "utf-8" + } + + // ASCII is a subset of UTF8. Follow W3C recommendation and replace with UTF8. + if ascii(origContent) { + return "utf-8" + } + + return latin(origContent) +} + +func latin(content []byte) string { + hasControlBytes := false + for _, b := range content { + t := textChars[b] + if t != T && t != I { + return "" + } + if b >= 0x80 && b <= 0x9F { + hasControlBytes = true + } + } + // Code range 0x80 to 0x9F is reserved for control characters in ISO-8859-1 + // (so-called C1 Controls). Windows 1252, however, has printable punctuation + // characters in this range. + if hasControlBytes { + return "windows-1252" + } + return "iso-8859-1" +} + +func ascii(content []byte) bool { + for _, b := range content { + if textChars[b] != T { + return false + } + } + return true +} + +// FromXML returns the charset of an XML document. It relies on the XML +// header and falls back on the plain +// text content. +func FromXML(content []byte) string { + if cset := fromXML(content); cset != "" { + return cset + } + return FromPlain(content) +} +func fromXML(content []byte) string { + content = trimLWS(content) + dec := xml.NewDecoder(bytes.NewReader(content)) + rawT, err := dec.RawToken() + if err != nil { + return "" + } + + t, ok := rawT.(xml.ProcInst) + if !ok { + return "" + } + + return strings.ToLower(xmlEncoding(string(t.Inst))) +} + +// FromHTML returns the charset of an HTML document. It first looks if a BOM is +// present and if so uses it to determine the charset. If no BOM is present, +// it relies on the meta tag and falls back on the +// plain text content. +func FromHTML(content []byte) string { + if cset := FromBOM(content); cset != "" { + return cset + } + if cset := fromHTML(content); cset != "" { + return cset + } + return FromPlain(content) +} + +func fromHTML(content []byte) string { + z := html.NewTokenizer(bytes.NewReader(content)) + for { + switch z.Next() { + case html.ErrorToken: + return "" + + case html.StartTagToken, html.SelfClosingTagToken: + tagName, hasAttr := z.TagName() + if !bytes.Equal(tagName, []byte("meta")) { + continue + } + attrList := make(map[string]bool) + gotPragma := false + + const ( + dontKnow = iota + doNeedPragma + doNotNeedPragma + ) + needPragma := dontKnow + + name := "" + for hasAttr { + var key, val []byte + key, val, hasAttr = z.TagAttr() + ks := string(key) + if attrList[ks] { + continue + } + attrList[ks] = true + for i, c := range val { + if 'A' <= c && c <= 'Z' { + val[i] = c + 0x20 + } + } + + switch ks { + case "http-equiv": + if bytes.Equal(val, []byte("content-type")) { + gotPragma = true + } + + case "content": + name = fromMetaElement(string(val)) + if name != "" { + needPragma = doNeedPragma + } + + case "charset": + name = string(val) + needPragma = doNotNeedPragma + } + } + + if needPragma == dontKnow || needPragma == doNeedPragma && !gotPragma { + continue + } + + if strings.HasPrefix(name, "utf-16") { + name = "utf-8" + } + + return name + } + } +} + +func fromMetaElement(s string) string { + for s != "" { + csLoc := strings.Index(s, "charset") + if csLoc == -1 { + return "" + } + s = s[csLoc+len("charset"):] + s = strings.TrimLeft(s, " \t\n\f\r") + if !strings.HasPrefix(s, "=") { + continue + } + s = s[1:] + s = strings.TrimLeft(s, " \t\n\f\r") + if s == "" { + return "" + } + if q := s[0]; q == '"' || q == '\'' { + s = s[1:] + closeQuote := strings.IndexRune(s, rune(q)) + if closeQuote == -1 { + return "" + } + return s[:closeQuote] + } + + end := strings.IndexAny(s, "; \t\n\f\r") + if end == -1 { + end = len(s) + } + return s[:end] + } + return "" +} + +func xmlEncoding(s string) string { + param := "encoding=" + idx := strings.Index(s, param) + if idx == -1 { + return "" + } + v := s[idx+len(param):] + if v == "" { + return "" + } + if v[0] != '\'' && v[0] != '"' { + return "" + } + idx = strings.IndexRune(v[1:], rune(v[0])) + if idx == -1 { + return "" + } + return v[1 : idx+1] +} + +// trimLWS trims whitespace from beginning of the input. +// TODO: find a way to call trimLWS once per detection instead of once in each +// detector which needs the trimmed input. +func trimLWS(in []byte) []byte { + firstNonWS := 0 + for ; firstNonWS < len(in) && isWS(in[firstNonWS]); firstNonWS++ { + } + + return in[firstNonWS:] +} + +func isWS(b byte) bool { + return b == '\t' || b == '\n' || b == '\x0c' || b == '\r' || b == ' ' +} diff --git a/vendor/github.com/gabriel-vasile/mimetype/internal/json/json.go b/vendor/github.com/gabriel-vasile/mimetype/internal/json/json.go new file mode 100644 index 00000000..5b2ecee4 --- /dev/null +++ b/vendor/github.com/gabriel-vasile/mimetype/internal/json/json.go @@ -0,0 +1,567 @@ +// Copyright (c) 2009 The Go Authors. All rights reserved. +// +// Redistribution and use in source and binary forms, with or without +// modification, are permitted provided that the following conditions are +// met: +// +// * Redistributions of source code must retain the above copyright +// notice, this list of conditions and the following disclaimer. +// * Redistributions in binary form must reproduce the above +// copyright notice, this list of conditions and the following disclaimer +// in the documentation and/or other materials provided with the +// distribution. +// * Neither the name of Google Inc. nor the names of its +// contributors may be used to endorse or promote products derived from +// this software without specific prior written permission. +// +// THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +// "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +// LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +// A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +// OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +// SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +// LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +// DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +// THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +// (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +// OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + +// Package json provides a JSON value parser state machine. +// This package is almost entirely copied from the Go stdlib. +// Changes made to it permit users of the package to tell +// if some slice of bytes is a valid beginning of a json string. +package json + +import ( + "fmt" + "sync" +) + +type ( + scanStatus int +) + +const ( + parseObjectKey = iota // parsing object key (before colon) + parseObjectValue // parsing object value (after colon) + parseArrayValue // parsing array value + + scanContinue scanStatus = iota // uninteresting byte + scanBeginLiteral // end implied by next result != scanContinue + scanBeginObject // begin object + scanObjectKey // just finished object key (string) + scanObjectValue // just finished non-last object value + scanEndObject // end object (implies scanObjectValue if possible) + scanBeginArray // begin array + scanArrayValue // just finished array value + scanEndArray // end array (implies scanArrayValue if possible) + scanSkipSpace // space byte; can skip; known to be last "continue" result + scanEnd // top-level value ended *before* this byte; known to be first "stop" result + scanError // hit an error, scanner.err. + + // This limits the max nesting depth to prevent stack overflow. + // This is permitted by https://tools.ietf.org/html/rfc7159#section-9 + maxNestingDepth = 10000 +) + +type ( + scanner struct { + step func(*scanner, byte) scanStatus + parseState []int + endTop bool + err error + index int + } +) + +var scannerPool = sync.Pool{ + New: func() any { + return &scanner{} + }, +} + +func newScanner() *scanner { + s := scannerPool.Get().(*scanner) + s.reset() + return s +} + +func freeScanner(s *scanner) { + // Avoid hanging on to too much memory in extreme cases. + if len(s.parseState) > 1024 { + s.parseState = nil + } + scannerPool.Put(s) +} + +// Scan returns the number of bytes scanned and if there was any error +// in trying to reach the end of data. +func Scan(data []byte) (int, error) { + s := newScanner() + defer freeScanner(s) + _ = checkValid(data, s) + return s.index, s.err +} + +// checkValid verifies that data is valid JSON-encoded data. +// scan is passed in for use by checkValid to avoid an allocation. +func checkValid(data []byte, scan *scanner) error { + for _, c := range data { + scan.index++ + if scan.step(scan, c) == scanError { + return scan.err + } + } + if scan.eof() == scanError { + return scan.err + } + return nil +} + +func isSpace(c byte) bool { + return c == ' ' || c == '\t' || c == '\r' || c == '\n' +} + +func (s *scanner) reset() { + s.step = stateBeginValue + s.parseState = s.parseState[0:0] + s.err = nil + s.endTop = false + s.index = 0 +} + +// eof tells the scanner that the end of input has been reached. +// It returns a scan status just as s.step does. +func (s *scanner) eof() scanStatus { + if s.err != nil { + return scanError + } + if s.endTop { + return scanEnd + } + s.step(s, ' ') + if s.endTop { + return scanEnd + } + if s.err == nil { + s.err = fmt.Errorf("unexpected end of JSON input") + } + return scanError +} + +// pushParseState pushes a new parse state p onto the parse stack. +// an error state is returned if maxNestingDepth was exceeded, otherwise successState is returned. +func (s *scanner) pushParseState(c byte, newParseState int, successState scanStatus) scanStatus { + s.parseState = append(s.parseState, newParseState) + if len(s.parseState) <= maxNestingDepth { + return successState + } + return s.error(c, "exceeded max depth") +} + +// popParseState pops a parse state (already obtained) off the stack +// and updates s.step accordingly. +func (s *scanner) popParseState() { + n := len(s.parseState) - 1 + s.parseState = s.parseState[0:n] + if n == 0 { + s.step = stateEndTop + s.endTop = true + } else { + s.step = stateEndValue + } +} + +// stateBeginValueOrEmpty is the state after reading `[`. +func stateBeginValueOrEmpty(s *scanner, c byte) scanStatus { + if c <= ' ' && isSpace(c) { + return scanSkipSpace + } + if c == ']' { + return stateEndValue(s, c) + } + return stateBeginValue(s, c) +} + +// stateBeginValue is the state at the beginning of the input. +func stateBeginValue(s *scanner, c byte) scanStatus { + if c <= ' ' && isSpace(c) { + return scanSkipSpace + } + switch c { + case '{': + s.step = stateBeginStringOrEmpty + return s.pushParseState(c, parseObjectKey, scanBeginObject) + case '[': + s.step = stateBeginValueOrEmpty + return s.pushParseState(c, parseArrayValue, scanBeginArray) + case '"': + s.step = stateInString + return scanBeginLiteral + case '-': + s.step = stateNeg + return scanBeginLiteral + case '0': // beginning of 0.123 + s.step = state0 + return scanBeginLiteral + case 't': // beginning of true + s.step = stateT + return scanBeginLiteral + case 'f': // beginning of false + s.step = stateF + return scanBeginLiteral + case 'n': // beginning of null + s.step = stateN + return scanBeginLiteral + } + if '1' <= c && c <= '9' { // beginning of 1234.5 + s.step = state1 + return scanBeginLiteral + } + return s.error(c, "looking for beginning of value") +} + +// stateBeginStringOrEmpty is the state after reading `{`. +func stateBeginStringOrEmpty(s *scanner, c byte) scanStatus { + if c <= ' ' && isSpace(c) { + return scanSkipSpace + } + if c == '}' { + n := len(s.parseState) + s.parseState[n-1] = parseObjectValue + return stateEndValue(s, c) + } + return stateBeginString(s, c) +} + +// stateBeginString is the state after reading `{"key": value,`. +func stateBeginString(s *scanner, c byte) scanStatus { + if c <= ' ' && isSpace(c) { + return scanSkipSpace + } + if c == '"' { + s.step = stateInString + return scanBeginLiteral + } + return s.error(c, "looking for beginning of object key string") +} + +// stateEndValue is the state after completing a value, +// such as after reading `{}` or `true` or `["x"`. +func stateEndValue(s *scanner, c byte) scanStatus { + n := len(s.parseState) + if n == 0 { + // Completed top-level before the current byte. + s.step = stateEndTop + s.endTop = true + return stateEndTop(s, c) + } + if c <= ' ' && isSpace(c) { + s.step = stateEndValue + return scanSkipSpace + } + ps := s.parseState[n-1] + switch ps { + case parseObjectKey: + if c == ':' { + s.parseState[n-1] = parseObjectValue + s.step = stateBeginValue + return scanObjectKey + } + return s.error(c, "after object key") + case parseObjectValue: + if c == ',' { + s.parseState[n-1] = parseObjectKey + s.step = stateBeginString + return scanObjectValue + } + if c == '}' { + s.popParseState() + return scanEndObject + } + return s.error(c, "after object key:value pair") + case parseArrayValue: + if c == ',' { + s.step = stateBeginValue + return scanArrayValue + } + if c == ']' { + s.popParseState() + return scanEndArray + } + return s.error(c, "after array element") + } + return s.error(c, "") +} + +// stateEndTop is the state after finishing the top-level value, +// such as after reading `{}` or `[1,2,3]`. +// Only space characters should be seen now. +func stateEndTop(s *scanner, c byte) scanStatus { + if c != ' ' && c != '\t' && c != '\r' && c != '\n' { + // Complain about non-space byte on next call. + s.error(c, "after top-level value") + } + return scanEnd +} + +// stateInString is the state after reading `"`. +func stateInString(s *scanner, c byte) scanStatus { + if c == '"' { + s.step = stateEndValue + return scanContinue + } + if c == '\\' { + s.step = stateInStringEsc + return scanContinue + } + if c < 0x20 { + return s.error(c, "in string literal") + } + return scanContinue +} + +// stateInStringEsc is the state after reading `"\` during a quoted string. +func stateInStringEsc(s *scanner, c byte) scanStatus { + switch c { + case 'b', 'f', 'n', 'r', 't', '\\', '/', '"': + s.step = stateInString + return scanContinue + case 'u': + s.step = stateInStringEscU + return scanContinue + } + return s.error(c, "in string escape code") +} + +// stateInStringEscU is the state after reading `"\u` during a quoted string. +func stateInStringEscU(s *scanner, c byte) scanStatus { + if '0' <= c && c <= '9' || 'a' <= c && c <= 'f' || 'A' <= c && c <= 'F' { + s.step = stateInStringEscU1 + return scanContinue + } + // numbers + return s.error(c, "in \\u hexadecimal character escape") +} + +// stateInStringEscU1 is the state after reading `"\u1` during a quoted string. +func stateInStringEscU1(s *scanner, c byte) scanStatus { + if '0' <= c && c <= '9' || 'a' <= c && c <= 'f' || 'A' <= c && c <= 'F' { + s.step = stateInStringEscU12 + return scanContinue + } + // numbers + return s.error(c, "in \\u hexadecimal character escape") +} + +// stateInStringEscU12 is the state after reading `"\u12` during a quoted string. +func stateInStringEscU12(s *scanner, c byte) scanStatus { + if '0' <= c && c <= '9' || 'a' <= c && c <= 'f' || 'A' <= c && c <= 'F' { + s.step = stateInStringEscU123 + return scanContinue + } + // numbers + return s.error(c, "in \\u hexadecimal character escape") +} + +// stateInStringEscU123 is the state after reading `"\u123` during a quoted string. +func stateInStringEscU123(s *scanner, c byte) scanStatus { + if '0' <= c && c <= '9' || 'a' <= c && c <= 'f' || 'A' <= c && c <= 'F' { + s.step = stateInString + return scanContinue + } + // numbers + return s.error(c, "in \\u hexadecimal character escape") +} + +// stateNeg is the state after reading `-` during a number. +func stateNeg(s *scanner, c byte) scanStatus { + if c == '0' { + s.step = state0 + return scanContinue + } + if '1' <= c && c <= '9' { + s.step = state1 + return scanContinue + } + return s.error(c, "in numeric literal") +} + +// state1 is the state after reading a non-zero integer during a number, +// such as after reading `1` or `100` but not `0`. +func state1(s *scanner, c byte) scanStatus { + if '0' <= c && c <= '9' { + s.step = state1 + return scanContinue + } + return state0(s, c) +} + +// state0 is the state after reading `0` during a number. +func state0(s *scanner, c byte) scanStatus { + if c == '.' { + s.step = stateDot + return scanContinue + } + if c == 'e' || c == 'E' { + s.step = stateE + return scanContinue + } + return stateEndValue(s, c) +} + +// stateDot is the state after reading the integer and decimal point in a number, +// such as after reading `1.`. +func stateDot(s *scanner, c byte) scanStatus { + if '0' <= c && c <= '9' { + s.step = stateDot0 + return scanContinue + } + return s.error(c, "after decimal point in numeric literal") +} + +// stateDot0 is the state after reading the integer, decimal point, and subsequent +// digits of a number, such as after reading `3.14`. +func stateDot0(s *scanner, c byte) scanStatus { + if '0' <= c && c <= '9' { + return scanContinue + } + if c == 'e' || c == 'E' { + s.step = stateE + return scanContinue + } + return stateEndValue(s, c) +} + +// stateE is the state after reading the mantissa and e in a number, +// such as after reading `314e` or `0.314e`. +func stateE(s *scanner, c byte) scanStatus { + if c == '+' || c == '-' { + s.step = stateESign + return scanContinue + } + return stateESign(s, c) +} + +// stateESign is the state after reading the mantissa, e, and sign in a number, +// such as after reading `314e-` or `0.314e+`. +func stateESign(s *scanner, c byte) scanStatus { + if '0' <= c && c <= '9' { + s.step = stateE0 + return scanContinue + } + return s.error(c, "in exponent of numeric literal") +} + +// stateE0 is the state after reading the mantissa, e, optional sign, +// and at least one digit of the exponent in a number, +// such as after reading `314e-2` or `0.314e+1` or `3.14e0`. +func stateE0(s *scanner, c byte) scanStatus { + if '0' <= c && c <= '9' { + return scanContinue + } + return stateEndValue(s, c) +} + +// stateT is the state after reading `t`. +func stateT(s *scanner, c byte) scanStatus { + if c == 'r' { + s.step = stateTr + return scanContinue + } + return s.error(c, "in literal true (expecting 'r')") +} + +// stateTr is the state after reading `tr`. +func stateTr(s *scanner, c byte) scanStatus { + if c == 'u' { + s.step = stateTru + return scanContinue + } + return s.error(c, "in literal true (expecting 'u')") +} + +// stateTru is the state after reading `tru`. +func stateTru(s *scanner, c byte) scanStatus { + if c == 'e' { + s.step = stateEndValue + return scanContinue + } + return s.error(c, "in literal true (expecting 'e')") +} + +// stateF is the state after reading `f`. +func stateF(s *scanner, c byte) scanStatus { + if c == 'a' { + s.step = stateFa + return scanContinue + } + return s.error(c, "in literal false (expecting 'a')") +} + +// stateFa is the state after reading `fa`. +func stateFa(s *scanner, c byte) scanStatus { + if c == 'l' { + s.step = stateFal + return scanContinue + } + return s.error(c, "in literal false (expecting 'l')") +} + +// stateFal is the state after reading `fal`. +func stateFal(s *scanner, c byte) scanStatus { + if c == 's' { + s.step = stateFals + return scanContinue + } + return s.error(c, "in literal false (expecting 's')") +} + +// stateFals is the state after reading `fals`. +func stateFals(s *scanner, c byte) scanStatus { + if c == 'e' { + s.step = stateEndValue + return scanContinue + } + return s.error(c, "in literal false (expecting 'e')") +} + +// stateN is the state after reading `n`. +func stateN(s *scanner, c byte) scanStatus { + if c == 'u' { + s.step = stateNu + return scanContinue + } + return s.error(c, "in literal null (expecting 'u')") +} + +// stateNu is the state after reading `nu`. +func stateNu(s *scanner, c byte) scanStatus { + if c == 'l' { + s.step = stateNul + return scanContinue + } + return s.error(c, "in literal null (expecting 'l')") +} + +// stateNul is the state after reading `nul`. +func stateNul(s *scanner, c byte) scanStatus { + if c == 'l' { + s.step = stateEndValue + return scanContinue + } + return s.error(c, "in literal null (expecting 'l')") +} + +// stateError is the state after reaching a syntax error, +// such as after reading `[1}` or `5.1.2`. +func stateError(s *scanner, c byte) scanStatus { + return scanError +} + +// error records an error and switches to the error state. +func (s *scanner) error(c byte, context string) scanStatus { + s.step = stateError + s.err = fmt.Errorf("invalid character <<%c>> %s", c, context) + return scanError +} diff --git a/vendor/github.com/gabriel-vasile/mimetype/internal/magic/archive.go b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/archive.go new file mode 100644 index 00000000..068d00f7 --- /dev/null +++ b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/archive.go @@ -0,0 +1,163 @@ +package magic + +import ( + "bytes" + "encoding/binary" +) + +var ( + // SevenZ matches a 7z archive. + SevenZ = prefix([]byte{0x37, 0x7A, 0xBC, 0xAF, 0x27, 0x1C}) + // Gzip matches gzip files based on http://www.zlib.org/rfc-gzip.html#header-trailer. + Gzip = prefix([]byte{0x1f, 0x8b}) + // Fits matches an Flexible Image Transport System file. + Fits = prefix([]byte{ + 0x53, 0x49, 0x4D, 0x50, 0x4C, 0x45, 0x20, 0x20, 0x3D, 0x20, + 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, + 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x54, + }) + // Xar matches an eXtensible ARchive format file. + Xar = prefix([]byte{0x78, 0x61, 0x72, 0x21}) + // Bz2 matches a bzip2 file. + Bz2 = prefix([]byte{0x42, 0x5A, 0x68}) + // Ar matches an ar (Unix) archive file. + Ar = prefix([]byte{0x21, 0x3C, 0x61, 0x72, 0x63, 0x68, 0x3E}) + // Deb matches a Debian package file. + Deb = offset([]byte{ + 0x64, 0x65, 0x62, 0x69, 0x61, 0x6E, 0x2D, + 0x62, 0x69, 0x6E, 0x61, 0x72, 0x79, + }, 8) + // Warc matches a Web ARChive file. + Warc = prefix([]byte("WARC/1.0"), []byte("WARC/1.1")) + // Cab matches a Microsoft Cabinet archive file. + Cab = prefix([]byte("MSCF\x00\x00\x00\x00")) + // Xz matches an xz compressed stream based on https://tukaani.org/xz/xz-file-format.txt. + Xz = prefix([]byte{0xFD, 0x37, 0x7A, 0x58, 0x5A, 0x00}) + // Lzip matches an Lzip compressed file. + Lzip = prefix([]byte{0x4c, 0x5a, 0x49, 0x50}) + // RPM matches an RPM or Delta RPM package file. + RPM = prefix([]byte{0xed, 0xab, 0xee, 0xdb}, []byte("drpm")) + // Cpio matches a cpio archive file. + Cpio = prefix([]byte("070707"), []byte("070701"), []byte("070702")) + // RAR matches a RAR archive file. + RAR = prefix([]byte("Rar!\x1A\x07\x00"), []byte("Rar!\x1A\x07\x01\x00")) +) + +// InstallShieldCab matches an InstallShield Cabinet archive file. +func InstallShieldCab(raw []byte, _ uint32) bool { + return len(raw) > 7 && + bytes.Equal(raw[0:4], []byte("ISc(")) && + raw[6] == 0 && + (raw[7] == 1 || raw[7] == 2 || raw[7] == 4) +} + +// Zstd matches a Zstandard archive file. +// https://github.com/facebook/zstd/blob/dev/doc/zstd_compression_format.md +func Zstd(raw []byte, limit uint32) bool { + if len(raw) < 4 { + return false + } + sig := binary.LittleEndian.Uint32(raw) + // Check for Zstandard frames and skippable frames. + return (sig >= 0xFD2FB522 && sig <= 0xFD2FB528) || + (sig >= 0x184D2A50 && sig <= 0x184D2A5F) +} + +// CRX matches a Chrome extension file: a zip archive prepended by a package header. +func CRX(raw []byte, limit uint32) bool { + const minHeaderLen = 16 + if len(raw) < minHeaderLen || !bytes.HasPrefix(raw, []byte("Cr24")) { + return false + } + pubkeyLen := binary.LittleEndian.Uint32(raw[8:12]) + sigLen := binary.LittleEndian.Uint32(raw[12:16]) + zipOffset := minHeaderLen + pubkeyLen + sigLen + if uint32(len(raw)) < zipOffset { + return false + } + return Zip(raw[zipOffset:], limit) +} + +// Tar matches a (t)ape (ar)chive file. +// Tar files are divided into 512 bytes records. First record contains a 257 +// bytes header padded with NUL. +func Tar(raw []byte, _ uint32) bool { + const sizeRecord = 512 + + // The structure of a tar header: + // type TarHeader struct { + // Name [100]byte + // Mode [8]byte + // Uid [8]byte + // Gid [8]byte + // Size [12]byte + // Mtime [12]byte + // Chksum [8]byte + // Linkflag byte + // Linkname [100]byte + // Magic [8]byte + // Uname [32]byte + // Gname [32]byte + // Devmajor [8]byte + // Devminor [8]byte + // } + + if len(raw) < sizeRecord { + return false + } + raw = raw[:sizeRecord] + + // First 100 bytes of the header represent the file name. + // Check if file looks like Gentoo GLEP binary package. + if bytes.Contains(raw[:100], []byte("/gpkg-1\x00")) { + return false + } + + // Get the checksum recorded into the file. + recsum := tarParseOctal(raw[148:156]) + if recsum == -1 { + return false + } + sum1, sum2 := tarChksum(raw) + return recsum == sum1 || recsum == sum2 +} + +// tarParseOctal converts octal string to decimal int. +func tarParseOctal(b []byte) int64 { + // Because unused fields are filled with NULs, we need to skip leading NULs. + // Fields may also be padded with spaces or NULs. + // So we remove leading and trailing NULs and spaces to be sure. + b = bytes.Trim(b, " \x00") + + if len(b) == 0 { + return -1 + } + ret := int64(0) + for _, b := range b { + if b == 0 { + break + } + if !(b >= '0' && b <= '7') { + return -1 + } + ret = (ret << 3) | int64(b-'0') + } + return ret +} + +// tarChksum computes the checksum for the header block b. +// The actual checksum is written to same b block after it has been calculated. +// Before calculation the bytes from b reserved for checksum have placeholder +// value of ASCII space 0x20. +// POSIX specifies a sum of the unsigned byte values, but the Sun tar used +// signed byte values. We compute and return both. +func tarChksum(b []byte) (unsigned, signed int64) { + for i, c := range b { + if 148 <= i && i < 156 { + c = ' ' // Treat the checksum field itself as all spaces. + } + unsigned += int64(c) + signed += int64(int8(c)) + } + return unsigned, signed +} diff --git a/vendor/github.com/gabriel-vasile/mimetype/internal/magic/audio.go b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/audio.go new file mode 100644 index 00000000..d17e3248 --- /dev/null +++ b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/audio.go @@ -0,0 +1,76 @@ +package magic + +import ( + "bytes" + "encoding/binary" +) + +var ( + // Flac matches a Free Lossless Audio Codec file. + Flac = prefix([]byte("\x66\x4C\x61\x43\x00\x00\x00\x22")) + // Midi matches a Musical Instrument Digital Interface file. + Midi = prefix([]byte("\x4D\x54\x68\x64")) + // Ape matches a Monkey's Audio file. + Ape = prefix([]byte("\x4D\x41\x43\x20\x96\x0F\x00\x00\x34\x00\x00\x00\x18\x00\x00\x00\x90\xE3")) + // MusePack matches a Musepack file. + MusePack = prefix([]byte("MPCK")) + // Au matches a Sun Microsystems au file. + Au = prefix([]byte("\x2E\x73\x6E\x64")) + // Amr matches an Adaptive Multi-Rate file. + Amr = prefix([]byte("\x23\x21\x41\x4D\x52")) + // Voc matches a Creative Voice file. + Voc = prefix([]byte("Creative Voice File")) + // M3u matches a Playlist file. + M3u = prefix([]byte("#EXTM3U")) + // AAC matches an Advanced Audio Coding file. + AAC = prefix([]byte{0xFF, 0xF1}, []byte{0xFF, 0xF9}) +) + +// Mp3 matches an mp3 file. +func Mp3(raw []byte, limit uint32) bool { + if len(raw) < 3 { + return false + } + + if bytes.HasPrefix(raw, []byte("ID3")) { + // MP3s with an ID3v2 tag will start with "ID3" + // ID3v1 tags, however appear at the end of the file. + return true + } + + // Match MP3 files without tags + switch binary.BigEndian.Uint16(raw[:2]) & 0xFFFE { + case 0xFFFA: + // MPEG ADTS, layer III, v1 + return true + case 0xFFF2: + // MPEG ADTS, layer III, v2 + return true + case 0xFFE2: + // MPEG ADTS, layer III, v2.5 + return true + } + + return false +} + +// Wav matches a Waveform Audio File Format file. +func Wav(raw []byte, limit uint32) bool { + return len(raw) > 12 && + bytes.Equal(raw[:4], []byte("RIFF")) && + bytes.Equal(raw[8:12], []byte{0x57, 0x41, 0x56, 0x45}) +} + +// Aiff matches Audio Interchange File Format file. +func Aiff(raw []byte, limit uint32) bool { + return len(raw) > 12 && + bytes.Equal(raw[:4], []byte{0x46, 0x4F, 0x52, 0x4D}) && + bytes.Equal(raw[8:12], []byte{0x41, 0x49, 0x46, 0x46}) +} + +// Qcp matches a Qualcomm Pure Voice file. +func Qcp(raw []byte, limit uint32) bool { + return len(raw) > 12 && + bytes.Equal(raw[:4], []byte("RIFF")) && + bytes.Equal(raw[8:12], []byte("QLCM")) +} diff --git a/vendor/github.com/gabriel-vasile/mimetype/internal/magic/binary.go b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/binary.go new file mode 100644 index 00000000..76973201 --- /dev/null +++ b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/binary.go @@ -0,0 +1,203 @@ +package magic + +import ( + "bytes" + "debug/macho" + "encoding/binary" +) + +var ( + // Lnk matches Microsoft lnk binary format. + Lnk = prefix([]byte{0x4C, 0x00, 0x00, 0x00, 0x01, 0x14, 0x02, 0x00}) + // Wasm matches a web assembly File Format file. + Wasm = prefix([]byte{0x00, 0x61, 0x73, 0x6D}) + // Exe matches a Windows/DOS executable file. + Exe = prefix([]byte{0x4D, 0x5A}) + // Elf matches an Executable and Linkable Format file. + Elf = prefix([]byte{0x7F, 0x45, 0x4C, 0x46}) + // Nes matches a Nintendo Entertainment system ROM file. + Nes = prefix([]byte{0x4E, 0x45, 0x53, 0x1A}) + // SWF matches an Adobe Flash swf file. + SWF = prefix([]byte("CWS"), []byte("FWS"), []byte("ZWS")) + // Torrent has bencoded text in the beginning. + Torrent = prefix([]byte("d8:announce")) + // PAR1 matches a parquet file. + Par1 = prefix([]byte{0x50, 0x41, 0x52, 0x31}) + // CBOR matches a Concise Binary Object Representation https://cbor.io/ + CBOR = prefix([]byte{0xD9, 0xD9, 0xF7}) +) + +// Java bytecode and Mach-O binaries share the same magic number. +// More info here https://github.com/threatstack/libmagic/blob/master/magic/Magdir/cafebabe +func classOrMachOFat(in []byte) bool { + // There should be at least 8 bytes for both of them because the only way to + // quickly distinguish them is by comparing byte at position 7 + if len(in) < 8 { + return false + } + + return binary.BigEndian.Uint32(in) == macho.MagicFat +} + +// Class matches a java class file. +func Class(raw []byte, limit uint32) bool { + return classOrMachOFat(raw) && raw[7] > 30 +} + +// MachO matches Mach-O binaries format. +func MachO(raw []byte, limit uint32) bool { + if classOrMachOFat(raw) && raw[7] < 0x14 { + return true + } + + if len(raw) < 4 { + return false + } + + be := binary.BigEndian.Uint32(raw) + le := binary.LittleEndian.Uint32(raw) + + return be == macho.Magic32 || + le == macho.Magic32 || + be == macho.Magic64 || + le == macho.Magic64 +} + +// Dbf matches a dBase file. +// https://www.dbase.com/Knowledgebase/INT/db7_file_fmt.htm +func Dbf(raw []byte, limit uint32) bool { + if len(raw) < 68 { + return false + } + + // 3rd and 4th bytes contain the last update month and day of month. + if !(0 < raw[2] && raw[2] < 13 && 0 < raw[3] && raw[3] < 32) { + return false + } + + // 12, 13, 30, 31 are reserved bytes and always filled with 0x00. + if raw[12] != 0x00 || raw[13] != 0x00 || raw[30] != 0x00 || raw[31] != 0x00 { + return false + } + // Production MDX flag; + // 0x01 if a production .MDX file exists for this table; + // 0x00 if no .MDX file exists. + if raw[28] > 0x01 { + return false + } + + // dbf type is dictated by the first byte. + dbfTypes := []byte{ + 0x02, 0x03, 0x04, 0x05, 0x30, 0x31, 0x32, 0x42, 0x62, 0x7B, 0x82, + 0x83, 0x87, 0x8A, 0x8B, 0x8E, 0xB3, 0xCB, 0xE5, 0xF5, 0xF4, 0xFB, + } + for _, b := range dbfTypes { + if raw[0] == b { + return true + } + } + + return false +} + +// ElfObj matches an object file. +func ElfObj(raw []byte, limit uint32) bool { + return len(raw) > 17 && ((raw[16] == 0x01 && raw[17] == 0x00) || + (raw[16] == 0x00 && raw[17] == 0x01)) +} + +// ElfExe matches an executable file. +func ElfExe(raw []byte, limit uint32) bool { + return len(raw) > 17 && ((raw[16] == 0x02 && raw[17] == 0x00) || + (raw[16] == 0x00 && raw[17] == 0x02)) +} + +// ElfLib matches a shared library file. +func ElfLib(raw []byte, limit uint32) bool { + return len(raw) > 17 && ((raw[16] == 0x03 && raw[17] == 0x00) || + (raw[16] == 0x00 && raw[17] == 0x03)) +} + +// ElfDump matches a core dump file. +func ElfDump(raw []byte, limit uint32) bool { + return len(raw) > 17 && ((raw[16] == 0x04 && raw[17] == 0x00) || + (raw[16] == 0x00 && raw[17] == 0x04)) +} + +// Dcm matches a DICOM medical format file. +func Dcm(raw []byte, limit uint32) bool { + return len(raw) > 131 && + bytes.Equal(raw[128:132], []byte{0x44, 0x49, 0x43, 0x4D}) +} + +// Marc matches a MARC21 (MAchine-Readable Cataloging) file. +func Marc(raw []byte, limit uint32) bool { + // File is at least 24 bytes ("leader" field size). + if len(raw) < 24 { + return false + } + + // Fixed bytes at offset 20. + if !bytes.Equal(raw[20:24], []byte("4500")) { + return false + } + + // First 5 bytes are ASCII digits. + for i := 0; i < 5; i++ { + if raw[i] < '0' || raw[i] > '9' { + return false + } + } + + // Field terminator is present in first 2048 bytes. + return bytes.Contains(raw[:min(2048, len(raw))], []byte{0x1E}) +} + +// Glb matches a glTF model format file. +// GLB is the binary file format representation of 3D models saved in +// the GL transmission Format (glTF). +// GLB uses little endian and its header structure is as follows: +// +// <-- 12-byte header --> +// | magic | version | length | +// | (uint32) | (uint32) | (uint32) | +// | \x67\x6C\x54\x46 | \x01\x00\x00\x00 | ... | +// | g l T F | 1 | ... | +// +// Visit [glTF specification] and [IANA glTF entry] for more details. +// +// [glTF specification]: https://registry.khronos.org/glTF/specs/2.0/glTF-2.0.html +// [IANA glTF entry]: https://www.iana.org/assignments/media-types/model/gltf-binary +var Glb = prefix([]byte("\x67\x6C\x54\x46\x02\x00\x00\x00"), + []byte("\x67\x6C\x54\x46\x01\x00\x00\x00")) + +// TzIf matches a Time Zone Information Format (TZif) file. +// See more: https://tools.ietf.org/id/draft-murchison-tzdist-tzif-00.html#rfc.section.3 +// Its header structure is shown below: +// +// +---------------+---+ +// | magic (4) | <-+-- version (1) +// +---------------+---+---------------------------------------+ +// | [unused - reserved for future use] (15) | +// +---------------+---------------+---------------+-----------+ +// | isutccnt (4) | isstdcnt (4) | leapcnt (4) | +// +---------------+---------------+---------------+ +// | timecnt (4) | typecnt (4) | charcnt (4) | +func TzIf(raw []byte, limit uint32) bool { + // File is at least 44 bytes (header size). + if len(raw) < 44 { + return false + } + + if !bytes.HasPrefix(raw, []byte("TZif")) { + return false + } + + // Field "typecnt" MUST not be zero. + if binary.BigEndian.Uint32(raw[36:40]) == 0 { + return false + } + + // Version has to be NUL (0x00), '2' (0x32) or '3' (0x33). + return raw[4] == 0x00 || raw[4] == 0x32 || raw[4] == 0x33 +} diff --git a/vendor/github.com/gabriel-vasile/mimetype/internal/magic/database.go b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/database.go new file mode 100644 index 00000000..cb1fed12 --- /dev/null +++ b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/database.go @@ -0,0 +1,13 @@ +package magic + +var ( + // Sqlite matches an SQLite database file. + Sqlite = prefix([]byte{ + 0x53, 0x51, 0x4c, 0x69, 0x74, 0x65, 0x20, 0x66, + 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x20, 0x33, 0x00, + }) + // MsAccessAce matches Microsoft Access dababase file. + MsAccessAce = offset([]byte("Standard ACE DB"), 4) + // MsAccessMdb matches legacy Microsoft Access database file (JET, 2003 and earlier). + MsAccessMdb = offset([]byte("Standard Jet DB"), 4) +) diff --git a/vendor/github.com/gabriel-vasile/mimetype/internal/magic/document.go b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/document.go new file mode 100644 index 00000000..b3b26d5a --- /dev/null +++ b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/document.go @@ -0,0 +1,62 @@ +package magic + +import "bytes" + +var ( + // Pdf matches a Portable Document Format file. + // https://github.com/file/file/blob/11010cc805546a3e35597e67e1129a481aed40e8/magic/Magdir/pdf + Pdf = prefix( + // usual pdf signature + []byte("%PDF-"), + // new-line prefixed signature + []byte("\012%PDF-"), + // UTF-8 BOM prefixed signature + []byte("\xef\xbb\xbf%PDF-"), + ) + // Fdf matches a Forms Data Format file. + Fdf = prefix([]byte("%FDF")) + // Mobi matches a Mobi file. + Mobi = offset([]byte("BOOKMOBI"), 60) + // Lit matches a Microsoft Lit file. + Lit = prefix([]byte("ITOLITLS")) +) + +// DjVu matches a DjVu file. +func DjVu(raw []byte, limit uint32) bool { + if len(raw) < 12 { + return false + } + if !bytes.HasPrefix(raw, []byte{0x41, 0x54, 0x26, 0x54, 0x46, 0x4F, 0x52, 0x4D}) { + return false + } + return bytes.HasPrefix(raw[12:], []byte("DJVM")) || + bytes.HasPrefix(raw[12:], []byte("DJVU")) || + bytes.HasPrefix(raw[12:], []byte("DJVI")) || + bytes.HasPrefix(raw[12:], []byte("THUM")) +} + +// P7s matches an .p7s signature File (PEM, Base64). +func P7s(raw []byte, limit uint32) bool { + // Check for PEM Encoding. + if bytes.HasPrefix(raw, []byte("-----BEGIN PKCS7")) { + return true + } + // Check if DER Encoding is long enough. + if len(raw) < 20 { + return false + } + // Magic Bytes for the signedData ASN.1 encoding. + startHeader := [][]byte{{0x30, 0x80}, {0x30, 0x81}, {0x30, 0x82}, {0x30, 0x83}, {0x30, 0x84}} + signedDataMatch := []byte{0x06, 0x09, 0x2A, 0x86, 0x48, 0x86, 0xF7, 0x0D, 0x01, 0x07} + // Check if Header is correct. There are multiple valid headers. + for i, match := range startHeader { + // If first bytes match, then check for ASN.1 Object Type. + if bytes.HasPrefix(raw, match) { + if bytes.HasPrefix(raw[i+2:], signedDataMatch) { + return true + } + } + } + + return false +} diff --git a/vendor/github.com/gabriel-vasile/mimetype/internal/magic/font.go b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/font.go new file mode 100644 index 00000000..43af2821 --- /dev/null +++ b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/font.go @@ -0,0 +1,39 @@ +package magic + +import ( + "bytes" +) + +var ( + // Woff matches a Web Open Font Format file. + Woff = prefix([]byte("wOFF")) + // Woff2 matches a Web Open Font Format version 2 file. + Woff2 = prefix([]byte("wOF2")) + // Otf matches an OpenType font file. + Otf = prefix([]byte{0x4F, 0x54, 0x54, 0x4F, 0x00}) +) + +// Ttf matches a TrueType font file. +func Ttf(raw []byte, limit uint32) bool { + if !bytes.HasPrefix(raw, []byte{0x00, 0x01, 0x00, 0x00}) { + return false + } + return !MsAccessAce(raw, limit) && !MsAccessMdb(raw, limit) +} + +// Eot matches an Embedded OpenType font file. +func Eot(raw []byte, limit uint32) bool { + return len(raw) > 35 && + bytes.Equal(raw[34:36], []byte{0x4C, 0x50}) && + (bytes.Equal(raw[8:11], []byte{0x02, 0x00, 0x01}) || + bytes.Equal(raw[8:11], []byte{0x01, 0x00, 0x00}) || + bytes.Equal(raw[8:11], []byte{0x02, 0x00, 0x02})) +} + +// Ttc matches a TrueType Collection font file. +func Ttc(raw []byte, limit uint32) bool { + return len(raw) > 7 && + bytes.HasPrefix(raw, []byte("ttcf")) && + (bytes.Equal(raw[4:8], []byte{0x00, 0x01, 0x00, 0x00}) || + bytes.Equal(raw[4:8], []byte{0x00, 0x02, 0x00, 0x00})) +} diff --git a/vendor/github.com/gabriel-vasile/mimetype/internal/magic/ftyp.go b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/ftyp.go new file mode 100644 index 00000000..ac727139 --- /dev/null +++ b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/ftyp.go @@ -0,0 +1,109 @@ +package magic + +import ( + "bytes" +) + +var ( + // AVIF matches an AV1 Image File Format still or animated. + // Wikipedia page seems outdated listing image/avif-sequence for animations. + // https://github.com/AOMediaCodec/av1-avif/issues/59 + AVIF = ftyp([]byte("avif"), []byte("avis")) + // ThreeGP matches a 3GPP file. + ThreeGP = ftyp( + []byte("3gp1"), []byte("3gp2"), []byte("3gp3"), []byte("3gp4"), + []byte("3gp5"), []byte("3gp6"), []byte("3gp7"), []byte("3gs7"), + []byte("3ge6"), []byte("3ge7"), []byte("3gg6"), + ) + // ThreeG2 matches a 3GPP2 file. + ThreeG2 = ftyp( + []byte("3g24"), []byte("3g25"), []byte("3g26"), []byte("3g2a"), + []byte("3g2b"), []byte("3g2c"), []byte("KDDI"), + ) + // AMp4 matches an audio MP4 file. + AMp4 = ftyp( + // audio for Adobe Flash Player 9+ + []byte("F4A "), []byte("F4B "), + // Apple iTunes AAC-LC (.M4A) Audio + []byte("M4B "), []byte("M4P "), + // MPEG-4 (.MP4) for SonyPSP + []byte("MSNV"), + // Nero Digital AAC Audio + []byte("NDAS"), + ) + // Mqv matches a Sony / Mobile QuickTime file. + Mqv = ftyp([]byte("mqt ")) + // M4a matches an audio M4A file. + M4a = ftyp([]byte("M4A ")) + // M4v matches an Appl4 M4V video file. + M4v = ftyp([]byte("M4V "), []byte("M4VH"), []byte("M4VP")) + // Heic matches a High Efficiency Image Coding (HEIC) file. + Heic = ftyp([]byte("heic"), []byte("heix")) + // HeicSequence matches a High Efficiency Image Coding (HEIC) file sequence. + HeicSequence = ftyp([]byte("hevc"), []byte("hevx")) + // Heif matches a High Efficiency Image File Format (HEIF) file. + Heif = ftyp([]byte("mif1"), []byte("heim"), []byte("heis"), []byte("avic")) + // HeifSequence matches a High Efficiency Image File Format (HEIF) file sequence. + HeifSequence = ftyp([]byte("msf1"), []byte("hevm"), []byte("hevs"), []byte("avcs")) + // Mj2 matches a Motion JPEG 2000 file: https://en.wikipedia.org/wiki/Motion_JPEG_2000. + Mj2 = ftyp([]byte("mj2s"), []byte("mjp2"), []byte("MFSM"), []byte("MGSV")) + // Dvb matches a Digital Video Broadcasting file: https://dvb.org. + // https://cconcolato.github.io/mp4ra/filetype.html + // https://github.com/file/file/blob/512840337ead1076519332d24fefcaa8fac36e06/magic/Magdir/animation#L135-L154 + Dvb = ftyp( + []byte("dby1"), []byte("dsms"), []byte("dts1"), []byte("dts2"), + []byte("dts3"), []byte("dxo "), []byte("dmb1"), []byte("dmpf"), + []byte("drc1"), []byte("dv1a"), []byte("dv1b"), []byte("dv2a"), + []byte("dv2b"), []byte("dv3a"), []byte("dv3b"), []byte("dvr1"), + []byte("dvt1"), []byte("emsg")) + // TODO: add support for remaining video formats at ftyps.com. +) + +// QuickTime matches a QuickTime File Format file. +// https://www.loc.gov/preservation/digital/formats/fdd/fdd000052.shtml +// https://developer.apple.com/library/archive/documentation/QuickTime/QTFF/QTFFChap1/qtff1.html#//apple_ref/doc/uid/TP40000939-CH203-38190 +// https://github.com/apache/tika/blob/0f5570691133c75ac4472c3340354a6c4080b104/tika-core/src/main/resources/org/apache/tika/mime/tika-mimetypes.xml#L7758-L7777 +func QuickTime(raw []byte, _ uint32) bool { + if len(raw) < 12 { + return false + } + // First 4 bytes represent the size of the atom as unsigned int. + // Next 4 bytes are the type of the atom. + // For `ftyp` atoms check if first byte in size is 0, otherwise, a text file + // which happens to contain 'ftypqt ' at index 4 will trigger a false positive. + if bytes.Equal(raw[4:12], []byte("ftypqt ")) || + bytes.Equal(raw[4:12], []byte("ftypmoov")) { + return raw[0] == 0x00 + } + basicAtomTypes := [][]byte{ + []byte("moov\x00"), + []byte("mdat\x00"), + []byte("free\x00"), + []byte("skip\x00"), + []byte("pnot\x00"), + } + for _, a := range basicAtomTypes { + if bytes.Equal(raw[4:9], a) { + return true + } + } + return bytes.Equal(raw[:8], []byte("\x00\x00\x00\x08wide")) +} + +// Mp4 detects an .mp4 file. Mp4 detections only does a basic ftyp check. +// Mp4 has many registered and unregistered code points so it's hard to keep track +// of all. Detection will default on video/mp4 for all ftyp files. +// ISO_IEC_14496-12 is the specification for the iso container. +func Mp4(raw []byte, _ uint32) bool { + if len(raw) < 12 { + return false + } + // ftyps are made out of boxes. The first 4 bytes of the box represent + // its size in big-endian uint32. First box is the ftyp box and it is small + // in size. Check most significant byte is 0 to filter out false positive + // text files that happen to contain the string "ftyp" at index 4. + if raw[0] != 0 { + return false + } + return bytes.Equal(raw[4:8], []byte("ftyp")) +} diff --git a/vendor/github.com/gabriel-vasile/mimetype/internal/magic/geo.go b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/geo.go new file mode 100644 index 00000000..f077e167 --- /dev/null +++ b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/geo.go @@ -0,0 +1,55 @@ +package magic + +import ( + "bytes" + "encoding/binary" +) + +// Shp matches a shape format file. +// https://www.esri.com/library/whitepapers/pdfs/shapefile.pdf +func Shp(raw []byte, limit uint32) bool { + if len(raw) < 112 { + return false + } + + if !(binary.BigEndian.Uint32(raw[0:4]) == 9994 && + binary.BigEndian.Uint32(raw[4:8]) == 0 && + binary.BigEndian.Uint32(raw[8:12]) == 0 && + binary.BigEndian.Uint32(raw[12:16]) == 0 && + binary.BigEndian.Uint32(raw[16:20]) == 0 && + binary.BigEndian.Uint32(raw[20:24]) == 0 && + binary.LittleEndian.Uint32(raw[28:32]) == 1000) { + return false + } + + shapeTypes := []int{ + 0, // Null shape + 1, // Point + 3, // Polyline + 5, // Polygon + 8, // MultiPoint + 11, // PointZ + 13, // PolylineZ + 15, // PolygonZ + 18, // MultiPointZ + 21, // PointM + 23, // PolylineM + 25, // PolygonM + 28, // MultiPointM + 31, // MultiPatch + } + + for _, st := range shapeTypes { + if st == int(binary.LittleEndian.Uint32(raw[108:112])) { + return true + } + } + + return false +} + +// Shx matches a shape index format file. +// https://www.esri.com/library/whitepapers/pdfs/shapefile.pdf +func Shx(raw []byte, limit uint32) bool { + return bytes.HasPrefix(raw, []byte{0x00, 0x00, 0x27, 0x0A}) +} diff --git a/vendor/github.com/gabriel-vasile/mimetype/internal/magic/image.go b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/image.go new file mode 100644 index 00000000..0eb7e95f --- /dev/null +++ b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/image.go @@ -0,0 +1,110 @@ +package magic + +import "bytes" + +var ( + // Png matches a Portable Network Graphics file. + // https://www.w3.org/TR/PNG/ + Png = prefix([]byte{0x89, 0x50, 0x4E, 0x47, 0x0D, 0x0A, 0x1A, 0x0A}) + // Apng matches an Animated Portable Network Graphics file. + // https://wiki.mozilla.org/APNG_Specification + Apng = offset([]byte("acTL"), 37) + // Jpg matches a Joint Photographic Experts Group file. + Jpg = prefix([]byte{0xFF, 0xD8, 0xFF}) + // Jp2 matches a JPEG 2000 Image file (ISO 15444-1). + Jp2 = jpeg2k([]byte{0x6a, 0x70, 0x32, 0x20}) + // Jpx matches a JPEG 2000 Image file (ISO 15444-2). + Jpx = jpeg2k([]byte{0x6a, 0x70, 0x78, 0x20}) + // Jpm matches a JPEG 2000 Image file (ISO 15444-6). + Jpm = jpeg2k([]byte{0x6a, 0x70, 0x6D, 0x20}) + // Gif matches a Graphics Interchange Format file. + Gif = prefix([]byte("GIF87a"), []byte("GIF89a")) + // Bmp matches a bitmap image file. + Bmp = prefix([]byte{0x42, 0x4D}) + // Ps matches a PostScript file. + Ps = prefix([]byte("%!PS-Adobe-")) + // Psd matches a Photoshop Document file. + Psd = prefix([]byte("8BPS")) + // Ico matches an ICO file. + Ico = prefix([]byte{0x00, 0x00, 0x01, 0x00}, []byte{0x00, 0x00, 0x02, 0x00}) + // Icns matches an ICNS (Apple Icon Image format) file. + Icns = prefix([]byte("icns")) + // Tiff matches a Tagged Image File Format file. + Tiff = prefix([]byte{0x49, 0x49, 0x2A, 0x00}, []byte{0x4D, 0x4D, 0x00, 0x2A}) + // Bpg matches a Better Portable Graphics file. + Bpg = prefix([]byte{0x42, 0x50, 0x47, 0xFB}) + // Xcf matches GIMP image data. + Xcf = prefix([]byte("gimp xcf")) + // Pat matches GIMP pattern data. + Pat = offset([]byte("GPAT"), 20) + // Gbr matches GIMP brush data. + Gbr = offset([]byte("GIMP"), 20) + // Hdr matches Radiance HDR image. + // https://web.archive.org/web/20060913152809/http://local.wasp.uwa.edu.au/~pbourke/dataformats/pic/ + Hdr = prefix([]byte("#?RADIANCE\n")) + // Xpm matches X PixMap image data. + Xpm = prefix([]byte{0x2F, 0x2A, 0x20, 0x58, 0x50, 0x4D, 0x20, 0x2A, 0x2F}) + // Jxs matches a JPEG XS coded image file (ISO/IEC 21122-3). + Jxs = prefix([]byte{0x00, 0x00, 0x00, 0x0C, 0x4A, 0x58, 0x53, 0x20, 0x0D, 0x0A, 0x87, 0x0A}) + // Jxr matches Microsoft HD JXR photo file. + Jxr = prefix([]byte{0x49, 0x49, 0xBC, 0x01}) +) + +func jpeg2k(sig []byte) Detector { + return func(raw []byte, _ uint32) bool { + if len(raw) < 24 { + return false + } + + if !bytes.Equal(raw[4:8], []byte{0x6A, 0x50, 0x20, 0x20}) && + !bytes.Equal(raw[4:8], []byte{0x6A, 0x50, 0x32, 0x20}) { + return false + } + return bytes.Equal(raw[20:24], sig) + } +} + +// Webp matches a WebP file. +func Webp(raw []byte, _ uint32) bool { + return len(raw) > 12 && + bytes.Equal(raw[0:4], []byte("RIFF")) && + bytes.Equal(raw[8:12], []byte{0x57, 0x45, 0x42, 0x50}) +} + +// Dwg matches a CAD drawing file. +func Dwg(raw []byte, _ uint32) bool { + if len(raw) < 6 || raw[0] != 0x41 || raw[1] != 0x43 { + return false + } + dwgVersions := [][]byte{ + {0x31, 0x2E, 0x34, 0x30}, + {0x31, 0x2E, 0x35, 0x30}, + {0x32, 0x2E, 0x31, 0x30}, + {0x31, 0x30, 0x30, 0x32}, + {0x31, 0x30, 0x30, 0x33}, + {0x31, 0x30, 0x30, 0x34}, + {0x31, 0x30, 0x30, 0x36}, + {0x31, 0x30, 0x30, 0x39}, + {0x31, 0x30, 0x31, 0x32}, + {0x31, 0x30, 0x31, 0x34}, + {0x31, 0x30, 0x31, 0x35}, + {0x31, 0x30, 0x31, 0x38}, + {0x31, 0x30, 0x32, 0x31}, + {0x31, 0x30, 0x32, 0x34}, + {0x31, 0x30, 0x33, 0x32}, + } + + for _, d := range dwgVersions { + if bytes.Equal(raw[2:6], d) { + return true + } + } + + return false +} + +// Jxl matches JPEG XL image file. +func Jxl(raw []byte, _ uint32) bool { + return bytes.HasPrefix(raw, []byte{0xFF, 0x0A}) || + bytes.HasPrefix(raw, []byte("\x00\x00\x00\x0cJXL\x20\x0d\x0a\x87\x0a")) +} diff --git a/vendor/github.com/gabriel-vasile/mimetype/internal/magic/magic.go b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/magic.go new file mode 100644 index 00000000..a34c6098 --- /dev/null +++ b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/magic.go @@ -0,0 +1,251 @@ +// Package magic holds the matching functions used to find MIME types. +package magic + +import ( + "bytes" + "fmt" +) + +type ( + // Detector receiveѕ the raw data of a file and returns whether the data + // meets any conditions. The limit parameter is an upper limit to the number + // of bytes received and is used to tell if the byte slice represents the + // whole file or is just the header of a file: len(raw) < limit or len(raw)>limit. + Detector func(raw []byte, limit uint32) bool + xmlSig struct { + // the local name of the root tag + localName []byte + // the namespace of the XML document + xmlns []byte + } +) + +// prefix creates a Detector which returns true if any of the provided signatures +// is the prefix of the raw input. +func prefix(sigs ...[]byte) Detector { + return func(raw []byte, limit uint32) bool { + for _, s := range sigs { + if bytes.HasPrefix(raw, s) { + return true + } + } + return false + } +} + +// offset creates a Detector which returns true if the provided signature can be +// found at offset in the raw input. +func offset(sig []byte, offset int) Detector { + return func(raw []byte, limit uint32) bool { + return len(raw) > offset && bytes.HasPrefix(raw[offset:], sig) + } +} + +// ciPrefix is like prefix but the check is case insensitive. +func ciPrefix(sigs ...[]byte) Detector { + return func(raw []byte, limit uint32) bool { + for _, s := range sigs { + if ciCheck(s, raw) { + return true + } + } + return false + } +} +func ciCheck(sig, raw []byte) bool { + if len(raw) < len(sig)+1 { + return false + } + // perform case insensitive check + for i, b := range sig { + db := raw[i] + if 'A' <= b && b <= 'Z' { + db &= 0xDF + } + if b != db { + return false + } + } + + return true +} + +// xml creates a Detector which returns true if any of the provided XML signatures +// matches the raw input. +func xml(sigs ...xmlSig) Detector { + return func(raw []byte, limit uint32) bool { + raw = trimLWS(raw) + if len(raw) == 0 { + return false + } + for _, s := range sigs { + if xmlCheck(s, raw) { + return true + } + } + return false + } +} +func xmlCheck(sig xmlSig, raw []byte) bool { + raw = raw[:min(len(raw), 512)] + + if len(sig.localName) == 0 { + return bytes.Index(raw, sig.xmlns) > 0 + } + if len(sig.xmlns) == 0 { + return bytes.Index(raw, sig.localName) > 0 + } + + localNameIndex := bytes.Index(raw, sig.localName) + return localNameIndex != -1 && localNameIndex < bytes.Index(raw, sig.xmlns) +} + +// markup creates a Detector which returns true is any of the HTML signatures +// matches the raw input. +func markup(sigs ...[]byte) Detector { + return func(raw []byte, limit uint32) bool { + if bytes.HasPrefix(raw, []byte{0xEF, 0xBB, 0xBF}) { + // We skip the UTF-8 BOM if present to ensure we correctly + // process any leading whitespace. The presence of the BOM + // is taken into account during charset detection in charset.go. + raw = trimLWS(raw[3:]) + } else { + raw = trimLWS(raw) + } + if len(raw) == 0 { + return false + } + for _, s := range sigs { + if markupCheck(s, raw) { + return true + } + } + return false + } +} +func markupCheck(sig, raw []byte) bool { + if len(raw) < len(sig)+1 { + return false + } + + // perform case insensitive check + for i, b := range sig { + db := raw[i] + if 'A' <= b && b <= 'Z' { + db &= 0xDF + } + if b != db { + return false + } + } + // Next byte must be space or right angle bracket. + if db := raw[len(sig)]; db != ' ' && db != '>' { + return false + } + + return true +} + +// ftyp creates a Detector which returns true if any of the FTYP signatures +// matches the raw input. +func ftyp(sigs ...[]byte) Detector { + return func(raw []byte, limit uint32) bool { + if len(raw) < 12 { + return false + } + for _, s := range sigs { + if bytes.Equal(raw[8:12], s) { + return true + } + } + return false + } +} + +func newXMLSig(localName, xmlns string) xmlSig { + ret := xmlSig{xmlns: []byte(xmlns)} + if localName != "" { + ret.localName = []byte(fmt.Sprintf("<%s", localName)) + } + + return ret +} + +// A valid shebang starts with the "#!" characters, +// followed by any number of spaces, +// followed by the path to the interpreter, +// and, optionally, followed by the arguments for the interpreter. +// +// Ex: +// +// #! /usr/bin/env php +// +// /usr/bin/env is the interpreter, php is the first and only argument. +func shebang(sigs ...[]byte) Detector { + return func(raw []byte, limit uint32) bool { + for _, s := range sigs { + if shebangCheck(s, firstLine(raw)) { + return true + } + } + return false + } +} + +func shebangCheck(sig, raw []byte) bool { + if len(raw) < len(sig)+2 { + return false + } + if raw[0] != '#' || raw[1] != '!' { + return false + } + + return bytes.Equal(trimLWS(trimRWS(raw[2:])), sig) +} + +// trimLWS trims whitespace from beginning of the input. +func trimLWS(in []byte) []byte { + firstNonWS := 0 + for ; firstNonWS < len(in) && isWS(in[firstNonWS]); firstNonWS++ { + } + + return in[firstNonWS:] +} + +// trimRWS trims whitespace from the end of the input. +func trimRWS(in []byte) []byte { + lastNonWS := len(in) - 1 + for ; lastNonWS > 0 && isWS(in[lastNonWS]); lastNonWS-- { + } + + return in[:lastNonWS+1] +} + +func firstLine(in []byte) []byte { + lineEnd := 0 + for ; lineEnd < len(in) && in[lineEnd] != '\n'; lineEnd++ { + } + + return in[:lineEnd] +} + +func isWS(b byte) bool { + return b == '\t' || b == '\n' || b == '\x0c' || b == '\r' || b == ' ' +} + +func min(a, b int) int { + if a < b { + return a + } + return b +} + +type readBuf []byte + +func (b *readBuf) advance(n int) bool { + if n < 0 || len(*b) < n { + return false + } + *b = (*b)[n:] + return true +} diff --git a/vendor/github.com/gabriel-vasile/mimetype/internal/magic/ms_office.go b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/ms_office.go new file mode 100644 index 00000000..7d60e22e --- /dev/null +++ b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/ms_office.go @@ -0,0 +1,186 @@ +package magic + +import ( + "bytes" + "encoding/binary" +) + +// Xlsx matches a Microsoft Excel 2007 file. +func Xlsx(raw []byte, limit uint32) bool { + return zipContains(raw, []byte("xl/"), true) +} + +// Docx matches a Microsoft Word 2007 file. +func Docx(raw []byte, limit uint32) bool { + return zipContains(raw, []byte("word/"), true) +} + +// Pptx matches a Microsoft PowerPoint 2007 file. +func Pptx(raw []byte, limit uint32) bool { + return zipContains(raw, []byte("ppt/"), true) +} + +// Ole matches an Open Linking and Embedding file. +// +// https://en.wikipedia.org/wiki/Object_Linking_and_Embedding +func Ole(raw []byte, limit uint32) bool { + return bytes.HasPrefix(raw, []byte{0xD0, 0xCF, 0x11, 0xE0, 0xA1, 0xB1, 0x1A, 0xE1}) +} + +// Aaf matches an Advanced Authoring Format file. +// See: https://pyaaf.readthedocs.io/en/latest/about.html +// See: https://en.wikipedia.org/wiki/Advanced_Authoring_Format +func Aaf(raw []byte, limit uint32) bool { + if len(raw) < 31 { + return false + } + return bytes.HasPrefix(raw[8:], []byte{0x41, 0x41, 0x46, 0x42, 0x0D, 0x00, 0x4F, 0x4D}) && + (raw[30] == 0x09 || raw[30] == 0x0C) +} + +// Doc matches a Microsoft Word 97-2003 file. +// See: https://github.com/decalage2/oletools/blob/412ee36ae45e70f42123e835871bac956d958461/oletools/common/clsid.py +func Doc(raw []byte, _ uint32) bool { + clsids := [][]byte{ + // Microsoft Word 97-2003 Document (Word.Document.8) + {0x06, 0x09, 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x46}, + // Microsoft Word 6.0-7.0 Document (Word.Document.6) + {0x00, 0x09, 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x46}, + // Microsoft Word Picture (Word.Picture.8) + {0x07, 0x09, 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, 0xc0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x46}, + } + + for _, clsid := range clsids { + if matchOleClsid(raw, clsid) { + return true + } + } + + return false +} + +// Ppt matches a Microsoft PowerPoint 97-2003 file or a PowerPoint 95 presentation. +func Ppt(raw []byte, limit uint32) bool { + // Root CLSID test is the safest way to detect identify OLE, however, the format + // often places the root CLSID at the end of the file. + if matchOleClsid(raw, []byte{ + 0x10, 0x8d, 0x81, 0x64, 0x9b, 0x4f, 0xcf, 0x11, + 0x86, 0xea, 0x00, 0xaa, 0x00, 0xb9, 0x29, 0xe8, + }) || matchOleClsid(raw, []byte{ + 0x70, 0xae, 0x7b, 0xea, 0x3b, 0xfb, 0xcd, 0x11, + 0xa9, 0x03, 0x00, 0xaa, 0x00, 0x51, 0x0e, 0xa3, + }) { + return true + } + + lin := len(raw) + if lin < 520 { + return false + } + pptSubHeaders := [][]byte{ + {0xA0, 0x46, 0x1D, 0xF0}, + {0x00, 0x6E, 0x1E, 0xF0}, + {0x0F, 0x00, 0xE8, 0x03}, + } + for _, h := range pptSubHeaders { + if bytes.HasPrefix(raw[512:], h) { + return true + } + } + + if bytes.HasPrefix(raw[512:], []byte{0xFD, 0xFF, 0xFF, 0xFF}) && + raw[518] == 0x00 && raw[519] == 0x00 { + return true + } + + return lin > 1152 && bytes.Contains(raw[1152:min(4096, lin)], + []byte("P\x00o\x00w\x00e\x00r\x00P\x00o\x00i\x00n\x00t\x00 D\x00o\x00c\x00u\x00m\x00e\x00n\x00t")) +} + +// Xls matches a Microsoft Excel 97-2003 file. +func Xls(raw []byte, limit uint32) bool { + // Root CLSID test is the safest way to detect identify OLE, however, the format + // often places the root CLSID at the end of the file. + if matchOleClsid(raw, []byte{ + 0x10, 0x08, 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, + }) || matchOleClsid(raw, []byte{ + 0x20, 0x08, 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, + }) { + return true + } + + lin := len(raw) + if lin < 520 { + return false + } + xlsSubHeaders := [][]byte{ + {0x09, 0x08, 0x10, 0x00, 0x00, 0x06, 0x05, 0x00}, + {0xFD, 0xFF, 0xFF, 0xFF, 0x10}, + {0xFD, 0xFF, 0xFF, 0xFF, 0x1F}, + {0xFD, 0xFF, 0xFF, 0xFF, 0x22}, + {0xFD, 0xFF, 0xFF, 0xFF, 0x23}, + {0xFD, 0xFF, 0xFF, 0xFF, 0x28}, + {0xFD, 0xFF, 0xFF, 0xFF, 0x29}, + } + for _, h := range xlsSubHeaders { + if bytes.HasPrefix(raw[512:], h) { + return true + } + } + + return lin > 1152 && bytes.Contains(raw[1152:min(4096, lin)], + []byte("W\x00k\x00s\x00S\x00S\x00W\x00o\x00r\x00k\x00B\x00o\x00o\x00k")) +} + +// Pub matches a Microsoft Publisher file. +func Pub(raw []byte, limit uint32) bool { + return matchOleClsid(raw, []byte{ + 0x01, 0x12, 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xC0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x46, + }) +} + +// Msg matches a Microsoft Outlook email file. +func Msg(raw []byte, limit uint32) bool { + return matchOleClsid(raw, []byte{ + 0x0B, 0x0D, 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xC0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x46, + }) +} + +// Msi matches a Microsoft Windows Installer file. +// http://fileformats.archiveteam.org/wiki/Microsoft_Compound_File +func Msi(raw []byte, limit uint32) bool { + return matchOleClsid(raw, []byte{ + 0x84, 0x10, 0x0C, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xC0, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x46, + }) +} + +// Helper to match by a specific CLSID of a compound file. +// +// http://fileformats.archiveteam.org/wiki/Microsoft_Compound_File +func matchOleClsid(in []byte, clsid []byte) bool { + // Microsoft Compound files v3 have a sector length of 512, while v4 has 4096. + // Change sector offset depending on file version. + // https://www.loc.gov/preservation/digital/formats/fdd/fdd000392.shtml + sectorLength := 512 + if len(in) < sectorLength { + return false + } + if in[26] == 0x04 && in[27] == 0x00 { + sectorLength = 4096 + } + + // SecID of first sector of the directory stream. + firstSecID := int(binary.LittleEndian.Uint32(in[48:52])) + + // Expected offset of CLSID for root storage object. + clsidOffset := sectorLength*(1+firstSecID) + 80 + + if len(in) <= clsidOffset+16 { + return false + } + + return bytes.HasPrefix(in[clsidOffset:], clsid) +} diff --git a/vendor/github.com/gabriel-vasile/mimetype/internal/magic/ogg.go b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/ogg.go new file mode 100644 index 00000000..bb4cd781 --- /dev/null +++ b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/ogg.go @@ -0,0 +1,42 @@ +package magic + +import ( + "bytes" +) + +/* + NOTE: + + In May 2003, two Internet RFCs were published relating to the format. + The Ogg bitstream was defined in RFC 3533 (which is classified as + 'informative') and its Internet content type (application/ogg) in RFC + 3534 (which is, as of 2006, a proposed standard protocol). In + September 2008, RFC 3534 was obsoleted by RFC 5334, which added + content types video/ogg, audio/ogg and filename extensions .ogx, .ogv, + .oga, .spx. + + See: + https://tools.ietf.org/html/rfc3533 + https://developer.mozilla.org/en-US/docs/Web/HTTP/Configuring_servers_for_Ogg_media#Serve_media_with_the_correct_MIME_type + https://github.com/file/file/blob/master/magic/Magdir/vorbis +*/ + +// Ogg matches an Ogg file. +func Ogg(raw []byte, limit uint32) bool { + return bytes.HasPrefix(raw, []byte("\x4F\x67\x67\x53\x00")) +} + +// OggAudio matches an audio ogg file. +func OggAudio(raw []byte, limit uint32) bool { + return len(raw) >= 37 && (bytes.HasPrefix(raw[28:], []byte("\x7fFLAC")) || + bytes.HasPrefix(raw[28:], []byte("\x01vorbis")) || + bytes.HasPrefix(raw[28:], []byte("OpusHead")) || + bytes.HasPrefix(raw[28:], []byte("Speex\x20\x20\x20"))) +} + +// OggVideo matches a video ogg file. +func OggVideo(raw []byte, limit uint32) bool { + return len(raw) >= 37 && (bytes.HasPrefix(raw[28:], []byte("\x80theora")) || + bytes.HasPrefix(raw[28:], []byte("fishead\x00")) || + bytes.HasPrefix(raw[28:], []byte("\x01video\x00\x00\x00"))) // OGM video +} diff --git a/vendor/github.com/gabriel-vasile/mimetype/internal/magic/text.go b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/text.go new file mode 100644 index 00000000..cf644639 --- /dev/null +++ b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/text.go @@ -0,0 +1,381 @@ +package magic + +import ( + "bytes" + "strings" + "time" + + "github.com/gabriel-vasile/mimetype/internal/charset" + "github.com/gabriel-vasile/mimetype/internal/json" +) + +var ( + // HTML matches a Hypertext Markup Language file. + HTML = markup( + []byte(" 0 +} + +// GeoJSON matches a RFC 7946 GeoJSON file. +// +// GeoJSON detection implies searching for key:value pairs like: `"type": "Feature"` +// in the input. +// BUG(gabriel-vasile): The "type" key should be searched for in the root object. +func GeoJSON(raw []byte, limit uint32) bool { + raw = trimLWS(raw) + if len(raw) == 0 { + return false + } + // GeoJSON is always a JSON object, not a JSON array or any other JSON value. + if raw[0] != '{' { + return false + } + + s := []byte(`"type"`) + si, sl := bytes.Index(raw, s), len(s) + + if si == -1 { + return false + } + + // If the "type" string is the suffix of the input, + // there is no need to search for the value of the key. + if si+sl == len(raw) { + return false + } + // Skip the "type" part. + raw = raw[si+sl:] + // Skip any whitespace before the colon. + raw = trimLWS(raw) + // Check for colon. + if len(raw) == 0 || raw[0] != ':' { + return false + } + // Skip any whitespace after the colon. + raw = trimLWS(raw[1:]) + + geoJSONTypes := [][]byte{ + []byte(`"Feature"`), + []byte(`"FeatureCollection"`), + []byte(`"Point"`), + []byte(`"LineString"`), + []byte(`"Polygon"`), + []byte(`"MultiPoint"`), + []byte(`"MultiLineString"`), + []byte(`"MultiPolygon"`), + []byte(`"GeometryCollection"`), + } + for _, t := range geoJSONTypes { + if bytes.HasPrefix(raw, t) { + return true + } + } + + return false +} + +// NdJSON matches a Newline delimited JSON file. All complete lines from raw +// must be valid JSON documents meaning they contain one of the valid JSON data +// types. +func NdJSON(raw []byte, limit uint32) bool { + lCount, hasObjOrArr := 0, false + raw = dropLastLine(raw, limit) + var l []byte + for len(raw) != 0 { + l, raw = scanLine(raw) + // Empty lines are allowed in NDJSON. + if l = trimRWS(trimLWS(l)); len(l) == 0 { + continue + } + _, err := json.Scan(l) + if err != nil { + return false + } + if l[0] == '[' || l[0] == '{' { + hasObjOrArr = true + } + lCount++ + } + + return lCount > 1 && hasObjOrArr +} + +// HAR matches a HAR Spec file. +// Spec: http://www.softwareishard.com/blog/har-12-spec/ +func HAR(raw []byte, limit uint32) bool { + s := []byte(`"log"`) + si, sl := bytes.Index(raw, s), len(s) + + if si == -1 { + return false + } + + // If the "log" string is the suffix of the input, + // there is no need to search for the value of the key. + if si+sl == len(raw) { + return false + } + // Skip the "log" part. + raw = raw[si+sl:] + // Skip any whitespace before the colon. + raw = trimLWS(raw) + // Check for colon. + if len(raw) == 0 || raw[0] != ':' { + return false + } + // Skip any whitespace after the colon. + raw = trimLWS(raw[1:]) + + harJSONTypes := [][]byte{ + []byte(`"version"`), + []byte(`"creator"`), + []byte(`"entries"`), + } + for _, t := range harJSONTypes { + si := bytes.Index(raw, t) + if si > -1 { + return true + } + } + + return false +} + +// Svg matches a SVG file. +func Svg(raw []byte, limit uint32) bool { + return bytes.Contains(raw, []byte(" 00:02:19,376) limits secondLine + // length to exactly 29 characters. + if len(secondLine) != 29 { + return false + } + // Decimal separator of fractional seconds in the timestamps must be a + // comma, not a period. + if strings.Contains(secondLine, ".") { + return false + } + // Second line must be a time range. + ts := strings.Split(secondLine, " --> ") + if len(ts) != 2 { + return false + } + const layout = "15:04:05,000" + t0, err := time.Parse(layout, ts[0]) + if err != nil { + return false + } + t1, err := time.Parse(layout, ts[1]) + if err != nil { + return false + } + if t0.After(t1) { + return false + } + + line, _ = scanLine(raw) + // A third line must exist and not be empty. This is the actual subtitle text. + return len(line) != 0 +} + +// Vtt matches a Web Video Text Tracks (WebVTT) file. See +// https://www.iana.org/assignments/media-types/text/vtt. +func Vtt(raw []byte, limit uint32) bool { + // Prefix match. + prefixes := [][]byte{ + {0xEF, 0xBB, 0xBF, 0x57, 0x45, 0x42, 0x56, 0x54, 0x54, 0x0A}, // UTF-8 BOM, "WEBVTT" and a line feed + {0xEF, 0xBB, 0xBF, 0x57, 0x45, 0x42, 0x56, 0x54, 0x54, 0x0D}, // UTF-8 BOM, "WEBVTT" and a carriage return + {0xEF, 0xBB, 0xBF, 0x57, 0x45, 0x42, 0x56, 0x54, 0x54, 0x20}, // UTF-8 BOM, "WEBVTT" and a space + {0xEF, 0xBB, 0xBF, 0x57, 0x45, 0x42, 0x56, 0x54, 0x54, 0x09}, // UTF-8 BOM, "WEBVTT" and a horizontal tab + {0x57, 0x45, 0x42, 0x56, 0x54, 0x54, 0x0A}, // "WEBVTT" and a line feed + {0x57, 0x45, 0x42, 0x56, 0x54, 0x54, 0x0D}, // "WEBVTT" and a carriage return + {0x57, 0x45, 0x42, 0x56, 0x54, 0x54, 0x20}, // "WEBVTT" and a space + {0x57, 0x45, 0x42, 0x56, 0x54, 0x54, 0x09}, // "WEBVTT" and a horizontal tab + } + for _, p := range prefixes { + if bytes.HasPrefix(raw, p) { + return true + } + } + + // Exact match. + return bytes.Equal(raw, []byte{0xEF, 0xBB, 0xBF, 0x57, 0x45, 0x42, 0x56, 0x54, 0x54}) || // UTF-8 BOM and "WEBVTT" + bytes.Equal(raw, []byte{0x57, 0x45, 0x42, 0x56, 0x54, 0x54}) // "WEBVTT" +} + +// dropCR drops a terminal \r from the data. +func dropCR(data []byte) []byte { + if len(data) > 0 && data[len(data)-1] == '\r' { + return data[0 : len(data)-1] + } + return data +} +func scanLine(b []byte) (line, remainder []byte) { + line, remainder, _ = bytes.Cut(b, []byte("\n")) + return dropCR(line), remainder +} diff --git a/vendor/github.com/gabriel-vasile/mimetype/internal/magic/text_csv.go b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/text_csv.go new file mode 100644 index 00000000..6083ba8c --- /dev/null +++ b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/text_csv.go @@ -0,0 +1,77 @@ +package magic + +import ( + "bufio" + "bytes" + "encoding/csv" + "errors" + "io" + "sync" +) + +// A bufio.Reader pool to alleviate problems with memory allocations. +var readerPool = sync.Pool{ + New: func() any { + // Initiate with empty source reader. + return bufio.NewReader(nil) + }, +} + +func newReader(r io.Reader) *bufio.Reader { + br := readerPool.Get().(*bufio.Reader) + br.Reset(r) + return br +} + +// Csv matches a comma-separated values file. +func Csv(raw []byte, limit uint32) bool { + return sv(raw, ',', limit) +} + +// Tsv matches a tab-separated values file. +func Tsv(raw []byte, limit uint32) bool { + return sv(raw, '\t', limit) +} + +func sv(in []byte, comma rune, limit uint32) bool { + in = dropLastLine(in, limit) + + br := newReader(bytes.NewReader(in)) + defer readerPool.Put(br) + r := csv.NewReader(br) + r.Comma = comma + r.ReuseRecord = true + r.LazyQuotes = true + r.Comment = '#' + + lines := 0 + for { + _, err := r.Read() + if errors.Is(err, io.EOF) { + break + } + if err != nil { + return false + } + lines++ + } + + return r.FieldsPerRecord > 1 && lines > 1 +} + +// dropLastLine drops the last incomplete line from b. +// +// mimetype limits itself to ReadLimit bytes when performing a detection. +// This means, for file formats like CSV for NDJSON, the last line of the input +// can be an incomplete line. +func dropLastLine(b []byte, readLimit uint32) []byte { + if readLimit == 0 || uint32(len(b)) < readLimit { + return b + } + for i := len(b) - 1; i > 0; i-- { + if b[i] == '\n' { + return b[:i] + } + } + return b +} diff --git a/vendor/github.com/gabriel-vasile/mimetype/internal/magic/video.go b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/video.go new file mode 100644 index 00000000..9caf5553 --- /dev/null +++ b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/video.go @@ -0,0 +1,85 @@ +package magic + +import ( + "bytes" +) + +var ( + // Flv matches a Flash video file. + Flv = prefix([]byte("\x46\x4C\x56\x01")) + // Asf matches an Advanced Systems Format file. + Asf = prefix([]byte{ + 0x30, 0x26, 0xB2, 0x75, 0x8E, 0x66, 0xCF, 0x11, + 0xA6, 0xD9, 0x00, 0xAA, 0x00, 0x62, 0xCE, 0x6C, + }) + // Rmvb matches a RealMedia Variable Bitrate file. + Rmvb = prefix([]byte{0x2E, 0x52, 0x4D, 0x46}) +) + +// WebM matches a WebM file. +func WebM(raw []byte, limit uint32) bool { + return isMatroskaFileTypeMatched(raw, "webm") +} + +// Mkv matches a mkv file. +func Mkv(raw []byte, limit uint32) bool { + return isMatroskaFileTypeMatched(raw, "matroska") +} + +// isMatroskaFileTypeMatched is used for webm and mkv file matching. +// It checks for .Eߣ sequence. If the sequence is found, +// then it means it is Matroska media container, including WebM. +// Then it verifies which of the file type it is representing by matching the +// file specific string. +func isMatroskaFileTypeMatched(in []byte, flType string) bool { + if bytes.HasPrefix(in, []byte("\x1A\x45\xDF\xA3")) { + return isFileTypeNamePresent(in, flType) + } + return false +} + +// isFileTypeNamePresent accepts the matroska input data stream and searches +// for the given file type in the stream. Return whether a match is found. +// The logic of search is: find first instance of \x42\x82 and then +// search for given string after n bytes of above instance. +func isFileTypeNamePresent(in []byte, flType string) bool { + ind, maxInd, lenIn := 0, 4096, len(in) + if lenIn < maxInd { // restricting length to 4096 + maxInd = lenIn + } + ind = bytes.Index(in[:maxInd], []byte("\x42\x82")) + if ind > 0 && lenIn > ind+2 { + ind += 2 + + // filetype name will be present exactly + // n bytes after the match of the two bytes "\x42\x82" + n := vintWidth(int(in[ind])) + if lenIn > ind+n { + return bytes.HasPrefix(in[ind+n:], []byte(flType)) + } + } + return false +} + +// vintWidth parses the variable-integer width in matroska containers +func vintWidth(v int) int { + mask, max, num := 128, 8, 1 + for num < max && v&mask == 0 { + mask = mask >> 1 + num++ + } + return num +} + +// Mpeg matches a Moving Picture Experts Group file. +func Mpeg(raw []byte, limit uint32) bool { + return len(raw) > 3 && bytes.HasPrefix(raw, []byte{0x00, 0x00, 0x01}) && + raw[3] >= 0xB0 && raw[3] <= 0xBF +} + +// Avi matches an Audio Video Interleaved file. +func Avi(raw []byte, limit uint32) bool { + return len(raw) > 16 && + bytes.Equal(raw[:4], []byte("RIFF")) && + bytes.Equal(raw[8:16], []byte("AVI LIST")) +} diff --git a/vendor/github.com/gabriel-vasile/mimetype/internal/magic/zip.go b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/zip.go new file mode 100644 index 00000000..f6c64829 --- /dev/null +++ b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/zip.go @@ -0,0 +1,131 @@ +package magic + +import ( + "bytes" + "encoding/binary" +) + +var ( + // Odt matches an OpenDocument Text file. + Odt = offset([]byte("mimetypeapplication/vnd.oasis.opendocument.text"), 30) + // Ott matches an OpenDocument Text Template file. + Ott = offset([]byte("mimetypeapplication/vnd.oasis.opendocument.text-template"), 30) + // Ods matches an OpenDocument Spreadsheet file. + Ods = offset([]byte("mimetypeapplication/vnd.oasis.opendocument.spreadsheet"), 30) + // Ots matches an OpenDocument Spreadsheet Template file. + Ots = offset([]byte("mimetypeapplication/vnd.oasis.opendocument.spreadsheet-template"), 30) + // Odp matches an OpenDocument Presentation file. + Odp = offset([]byte("mimetypeapplication/vnd.oasis.opendocument.presentation"), 30) + // Otp matches an OpenDocument Presentation Template file. + Otp = offset([]byte("mimetypeapplication/vnd.oasis.opendocument.presentation-template"), 30) + // Odg matches an OpenDocument Drawing file. + Odg = offset([]byte("mimetypeapplication/vnd.oasis.opendocument.graphics"), 30) + // Otg matches an OpenDocument Drawing Template file. + Otg = offset([]byte("mimetypeapplication/vnd.oasis.opendocument.graphics-template"), 30) + // Odf matches an OpenDocument Formula file. + Odf = offset([]byte("mimetypeapplication/vnd.oasis.opendocument.formula"), 30) + // Odc matches an OpenDocument Chart file. + Odc = offset([]byte("mimetypeapplication/vnd.oasis.opendocument.chart"), 30) + // Epub matches an EPUB file. + Epub = offset([]byte("mimetypeapplication/epub+zip"), 30) + // Sxc matches an OpenOffice Spreadsheet file. + Sxc = offset([]byte("mimetypeapplication/vnd.sun.xml.calc"), 30) +) + +// Zip matches a zip archive. +func Zip(raw []byte, limit uint32) bool { + return len(raw) > 3 && + raw[0] == 0x50 && raw[1] == 0x4B && + (raw[2] == 0x3 || raw[2] == 0x5 || raw[2] == 0x7) && + (raw[3] == 0x4 || raw[3] == 0x6 || raw[3] == 0x8) +} + +// Jar matches a Java archive file. +func Jar(raw []byte, limit uint32) bool { + return zipContains(raw, []byte("META-INF/MANIFEST.MF"), false) +} + +func zipContains(raw, sig []byte, msoCheck bool) bool { + b := readBuf(raw) + pk := []byte("PK\003\004") + if len(b) < 0x1E { + return false + } + + if !b.advance(0x1E) { + return false + } + if bytes.HasPrefix(b, sig) { + return true + } + + if msoCheck { + skipFiles := [][]byte{ + []byte("[Content_Types].xml"), + []byte("_rels/.rels"), + []byte("docProps"), + []byte("customXml"), + []byte("[trash]"), + } + + hasSkipFile := false + for _, sf := range skipFiles { + if bytes.HasPrefix(b, sf) { + hasSkipFile = true + break + } + } + if !hasSkipFile { + return false + } + } + + searchOffset := binary.LittleEndian.Uint32(raw[18:]) + 49 + if !b.advance(int(searchOffset)) { + return false + } + + nextHeader := bytes.Index(raw[searchOffset:], pk) + if !b.advance(nextHeader) { + return false + } + if bytes.HasPrefix(b, sig) { + return true + } + + for i := 0; i < 4; i++ { + if !b.advance(0x1A) { + return false + } + nextHeader = bytes.Index(b, pk) + if nextHeader == -1 { + return false + } + if !b.advance(nextHeader + 0x1E) { + return false + } + if bytes.HasPrefix(b, sig) { + return true + } + } + return false +} + +// APK matches an Android Package Archive. +// The source of signatures is https://github.com/file/file/blob/1778642b8ba3d947a779a36fcd81f8e807220a19/magic/Magdir/archive#L1820-L1887 +func APK(raw []byte, _ uint32) bool { + apkSignatures := [][]byte{ + []byte("AndroidManifest.xml"), + []byte("META-INF/com/android/build/gradle/app-metadata.properties"), + []byte("classes.dex"), + []byte("resources.arsc"), + []byte("res/drawable"), + } + for _, sig := range apkSignatures { + if zipContains(raw, sig, false) { + return true + } + } + + return false +} diff --git a/vendor/github.com/gabriel-vasile/mimetype/mime.go b/vendor/github.com/gabriel-vasile/mimetype/mime.go new file mode 100644 index 00000000..62cb15f5 --- /dev/null +++ b/vendor/github.com/gabriel-vasile/mimetype/mime.go @@ -0,0 +1,186 @@ +package mimetype + +import ( + "mime" + + "github.com/gabriel-vasile/mimetype/internal/charset" + "github.com/gabriel-vasile/mimetype/internal/magic" +) + +// MIME struct holds information about a file format: the string representation +// of the MIME type, the extension and the parent file format. +type MIME struct { + mime string + aliases []string + extension string + // detector receives the raw input and a limit for the number of bytes it is + // allowed to check. It returns whether the input matches a signature or not. + detector magic.Detector + children []*MIME + parent *MIME +} + +// String returns the string representation of the MIME type, e.g., "application/zip". +func (m *MIME) String() string { + return m.mime +} + +// Extension returns the file extension associated with the MIME type. +// It includes the leading dot, as in ".html". When the file format does not +// have an extension, the empty string is returned. +func (m *MIME) Extension() string { + return m.extension +} + +// Parent returns the parent MIME type from the hierarchy. +// Each MIME type has a non-nil parent, except for the root MIME type. +// +// For example, the application/json and text/html MIME types have text/plain as +// their parent because they are text files who happen to contain JSON or HTML. +// Another example is the ZIP format, which is used as container +// for Microsoft Office files, EPUB files, JAR files, and others. +func (m *MIME) Parent() *MIME { + return m.parent +} + +// Is checks whether this MIME type, or any of its aliases, is equal to the +// expected MIME type. MIME type equality test is done on the "type/subtype" +// section, ignores any optional MIME parameters, ignores any leading and +// trailing whitespace, and is case insensitive. +func (m *MIME) Is(expectedMIME string) bool { + // Parsing is needed because some detected MIME types contain parameters + // that need to be stripped for the comparison. + expectedMIME, _, _ = mime.ParseMediaType(expectedMIME) + found, _, _ := mime.ParseMediaType(m.mime) + + if expectedMIME == found { + return true + } + + for _, alias := range m.aliases { + if alias == expectedMIME { + return true + } + } + + return false +} + +func newMIME( + mime, extension string, + detector magic.Detector, + children ...*MIME) *MIME { + m := &MIME{ + mime: mime, + extension: extension, + detector: detector, + children: children, + } + + for _, c := range children { + c.parent = m + } + + return m +} + +func (m *MIME) alias(aliases ...string) *MIME { + m.aliases = aliases + return m +} + +// match does a depth-first search on the signature tree. It returns the deepest +// successful node for which all the children detection functions fail. +func (m *MIME) match(in []byte, readLimit uint32) *MIME { + for _, c := range m.children { + if c.detector(in, readLimit) { + return c.match(in, readLimit) + } + } + + needsCharset := map[string]func([]byte) string{ + "text/plain": charset.FromPlain, + "text/html": charset.FromHTML, + "text/xml": charset.FromXML, + } + // ps holds optional MIME parameters. + ps := map[string]string{} + if f, ok := needsCharset[m.mime]; ok { + if cset := f(in); cset != "" { + ps["charset"] = cset + } + } + + return m.cloneHierarchy(ps) +} + +// flatten transforms an hierarchy of MIMEs into a slice of MIMEs. +func (m *MIME) flatten() []*MIME { + out := []*MIME{m} + for _, c := range m.children { + out = append(out, c.flatten()...) + } + + return out +} + +// clone creates a new MIME with the provided optional MIME parameters. +func (m *MIME) clone(ps map[string]string) *MIME { + clonedMIME := m.mime + if len(ps) > 0 { + clonedMIME = mime.FormatMediaType(m.mime, ps) + } + + return &MIME{ + mime: clonedMIME, + aliases: m.aliases, + extension: m.extension, + } +} + +// cloneHierarchy creates a clone of m and all its ancestors. The optional MIME +// parameters are set on the last child of the hierarchy. +func (m *MIME) cloneHierarchy(ps map[string]string) *MIME { + ret := m.clone(ps) + lastChild := ret + for p := m.Parent(); p != nil; p = p.Parent() { + pClone := p.clone(nil) + lastChild.parent = pClone + lastChild = pClone + } + + return ret +} + +func (m *MIME) lookup(mime string) *MIME { + for _, n := range append(m.aliases, m.mime) { + if n == mime { + return m + } + } + + for _, c := range m.children { + if m := c.lookup(mime); m != nil { + return m + } + } + return nil +} + +// Extend adds detection for a sub-format. The detector is a function +// returning true when the raw input file satisfies a signature. +// The sub-format will be detected if all the detectors in the parent chain return true. +// The extension should include the leading dot, as in ".html". +func (m *MIME) Extend(detector func(raw []byte, limit uint32) bool, mime, extension string, aliases ...string) { + c := &MIME{ + mime: mime, + extension: extension, + detector: detector, + parent: m, + aliases: aliases, + } + + mu.Lock() + m.children = append([]*MIME{c}, m.children...) + mu.Unlock() +} diff --git a/vendor/github.com/gabriel-vasile/mimetype/mimetype.go b/vendor/github.com/gabriel-vasile/mimetype/mimetype.go new file mode 100644 index 00000000..d8d512b8 --- /dev/null +++ b/vendor/github.com/gabriel-vasile/mimetype/mimetype.go @@ -0,0 +1,126 @@ +// Package mimetype uses magic number signatures to detect the MIME type of a file. +// +// File formats are stored in a hierarchy with application/octet-stream at its root. +// For example, the hierarchy for HTML format is application/octet-stream -> +// text/plain -> text/html. +package mimetype + +import ( + "io" + "mime" + "os" + "sync/atomic" +) + +var defaultLimit uint32 = 3072 + +// readLimit is the maximum number of bytes from the input used when detecting. +var readLimit uint32 = defaultLimit + +// Detect returns the MIME type found from the provided byte slice. +// +// The result is always a valid MIME type, with application/octet-stream +// returned when identification failed. +func Detect(in []byte) *MIME { + // Using atomic because readLimit can be written at the same time in other goroutine. + l := atomic.LoadUint32(&readLimit) + if l > 0 && len(in) > int(l) { + in = in[:l] + } + mu.RLock() + defer mu.RUnlock() + return root.match(in, l) +} + +// DetectReader returns the MIME type of the provided reader. +// +// The result is always a valid MIME type, with application/octet-stream +// returned when identification failed with or without an error. +// Any error returned is related to the reading from the input reader. +// +// DetectReader assumes the reader offset is at the start. If the input is an +// io.ReadSeeker you previously read from, it should be rewinded before detection: +// +// reader.Seek(0, io.SeekStart) +func DetectReader(r io.Reader) (*MIME, error) { + var in []byte + var err error + + // Using atomic because readLimit can be written at the same time in other goroutine. + l := atomic.LoadUint32(&readLimit) + if l == 0 { + in, err = io.ReadAll(r) + if err != nil { + return errMIME, err + } + } else { + var n int + in = make([]byte, l) + // io.UnexpectedEOF means len(r) < len(in). It is not an error in this case, + // it just means the input file is smaller than the allocated bytes slice. + n, err = io.ReadFull(r, in) + if err != nil && err != io.EOF && err != io.ErrUnexpectedEOF { + return errMIME, err + } + in = in[:n] + } + + mu.RLock() + defer mu.RUnlock() + return root.match(in, l), nil +} + +// DetectFile returns the MIME type of the provided file. +// +// The result is always a valid MIME type, with application/octet-stream +// returned when identification failed with or without an error. +// Any error returned is related to the opening and reading from the input file. +func DetectFile(path string) (*MIME, error) { + f, err := os.Open(path) + if err != nil { + return errMIME, err + } + defer f.Close() + + return DetectReader(f) +} + +// EqualsAny reports whether s MIME type is equal to any MIME type in mimes. +// MIME type equality test is done on the "type/subtype" section, ignores +// any optional MIME parameters, ignores any leading and trailing whitespace, +// and is case insensitive. +func EqualsAny(s string, mimes ...string) bool { + s, _, _ = mime.ParseMediaType(s) + for _, m := range mimes { + m, _, _ = mime.ParseMediaType(m) + if s == m { + return true + } + } + + return false +} + +// SetLimit sets the maximum number of bytes read from input when detecting the MIME type. +// Increasing the limit provides better detection for file formats which store +// their magical numbers towards the end of the file: docx, pptx, xlsx, etc. +// During detection data is read in a single block of size limit, i.e. it is not buffered. +// A limit of 0 means the whole input file will be used. +func SetLimit(limit uint32) { + // Using atomic because readLimit can be read at the same time in other goroutine. + atomic.StoreUint32(&readLimit, limit) +} + +// Extend adds detection for other file formats. +// It is equivalent to calling Extend() on the root mime type "application/octet-stream". +func Extend(detector func(raw []byte, limit uint32) bool, mime, extension string, aliases ...string) { + root.Extend(detector, mime, extension, aliases...) +} + +// Lookup finds a MIME object by its string representation. +// The representation can be the main mime type, or any of its aliases. +func Lookup(mime string) *MIME { + mu.RLock() + defer mu.RUnlock() + return root.lookup(mime) +} diff --git a/vendor/github.com/gabriel-vasile/mimetype/supported_mimes.md b/vendor/github.com/gabriel-vasile/mimetype/supported_mimes.md new file mode 100644 index 00000000..f9bf03cb --- /dev/null +++ b/vendor/github.com/gabriel-vasile/mimetype/supported_mimes.md @@ -0,0 +1,183 @@ +## 178 Supported MIME types +This file is automatically generated when running tests. Do not edit manually. + +Extension | MIME type | Aliases +--------- | --------- | ------- +**n/a** | application/octet-stream | - +**.xpm** | image/x-xpixmap | - +**.7z** | application/x-7z-compressed | - +**.zip** | application/zip | application/x-zip, application/x-zip-compressed +**.xlsx** | application/vnd.openxmlformats-officedocument.spreadsheetml.sheet | - +**.docx** | application/vnd.openxmlformats-officedocument.wordprocessingml.document | - +**.pptx** | application/vnd.openxmlformats-officedocument.presentationml.presentation | - +**.epub** | application/epub+zip | - +**.apk** | application/vnd.android.package-archive | - +**.jar** | application/jar | - +**.odt** | application/vnd.oasis.opendocument.text | application/x-vnd.oasis.opendocument.text +**.ott** | application/vnd.oasis.opendocument.text-template | application/x-vnd.oasis.opendocument.text-template +**.ods** | application/vnd.oasis.opendocument.spreadsheet | application/x-vnd.oasis.opendocument.spreadsheet +**.ots** | application/vnd.oasis.opendocument.spreadsheet-template | application/x-vnd.oasis.opendocument.spreadsheet-template +**.odp** | application/vnd.oasis.opendocument.presentation | application/x-vnd.oasis.opendocument.presentation +**.otp** | application/vnd.oasis.opendocument.presentation-template | application/x-vnd.oasis.opendocument.presentation-template +**.odg** | application/vnd.oasis.opendocument.graphics | application/x-vnd.oasis.opendocument.graphics +**.otg** | application/vnd.oasis.opendocument.graphics-template | application/x-vnd.oasis.opendocument.graphics-template +**.odf** | application/vnd.oasis.opendocument.formula | application/x-vnd.oasis.opendocument.formula +**.odc** | application/vnd.oasis.opendocument.chart | application/x-vnd.oasis.opendocument.chart +**.sxc** | application/vnd.sun.xml.calc | - +**.pdf** | application/pdf | application/x-pdf +**.fdf** | application/vnd.fdf | - +**n/a** | application/x-ole-storage | - +**.msi** | application/x-ms-installer | application/x-windows-installer, application/x-msi +**.aaf** | application/octet-stream | - +**.msg** | application/vnd.ms-outlook | - +**.xls** | application/vnd.ms-excel | application/msexcel +**.pub** | application/vnd.ms-publisher | - +**.ppt** | application/vnd.ms-powerpoint | application/mspowerpoint +**.doc** | application/msword | application/vnd.ms-word +**.ps** | application/postscript | - +**.psd** | image/vnd.adobe.photoshop | image/x-psd, application/photoshop +**.p7s** | application/pkcs7-signature | - +**.ogg** | application/ogg | application/x-ogg +**.oga** | audio/ogg | - +**.ogv** | video/ogg | - +**.png** | image/png | - +**.png** | image/vnd.mozilla.apng | - +**.jpg** | image/jpeg | - +**.jxl** | image/jxl | - +**.jp2** | image/jp2 | - +**.jpf** | image/jpx | - +**.jpm** | image/jpm | video/jpm +**.jxs** | image/jxs | - +**.gif** | image/gif | - +**.webp** | image/webp | - +**.exe** | application/vnd.microsoft.portable-executable | - +**n/a** | application/x-elf | - +**n/a** | application/x-object | - +**n/a** | application/x-executable | - +**.so** | application/x-sharedlib | - +**n/a** | application/x-coredump | - +**.a** | application/x-archive | application/x-unix-archive +**.deb** | application/vnd.debian.binary-package | - +**.tar** | application/x-tar | - +**.xar** | application/x-xar | - +**.bz2** | application/x-bzip2 | - +**.fits** | application/fits | - +**.tiff** | image/tiff | - +**.bmp** | image/bmp | image/x-bmp, image/x-ms-bmp +**.ico** | image/x-icon | - +**.mp3** | audio/mpeg | audio/x-mpeg, audio/mp3 +**.flac** | audio/flac | - +**.midi** | audio/midi | audio/mid, audio/sp-midi, audio/x-mid, audio/x-midi +**.ape** | audio/ape | - +**.mpc** | audio/musepack | - +**.amr** | audio/amr | audio/amr-nb +**.wav** | audio/wav | audio/x-wav, audio/vnd.wave, audio/wave +**.aiff** | audio/aiff | audio/x-aiff +**.au** | audio/basic | - +**.mpeg** | video/mpeg | - +**.mov** | video/quicktime | - +**.mp4** | video/mp4 | - +**.avif** | image/avif | - +**.3gp** | video/3gpp | video/3gp, audio/3gpp +**.3g2** | video/3gpp2 | video/3g2, audio/3gpp2 +**.mp4** | audio/mp4 | audio/x-mp4a +**.mqv** | video/quicktime | - +**.m4a** | audio/x-m4a | - +**.m4v** | video/x-m4v | - +**.heic** | image/heic | - +**.heic** | image/heic-sequence | - +**.heif** | image/heif | - +**.heif** | image/heif-sequence | - +**.mj2** | video/mj2 | - +**.dvb** | video/vnd.dvb.file | - +**.webm** | video/webm | audio/webm +**.avi** | video/x-msvideo | video/avi, video/msvideo +**.flv** | video/x-flv | - +**.mkv** | video/x-matroska | - +**.asf** | video/x-ms-asf | video/asf, video/x-ms-wmv +**.aac** | audio/aac | - +**.voc** | audio/x-unknown | - +**.m3u** | application/vnd.apple.mpegurl | audio/mpegurl +**.rmvb** | application/vnd.rn-realmedia-vbr | - +**.gz** | application/gzip | application/x-gzip, application/x-gunzip, application/gzipped, application/gzip-compressed, application/x-gzip-compressed, gzip/document +**.class** | application/x-java-applet | - +**.swf** | application/x-shockwave-flash | - +**.crx** | application/x-chrome-extension | - +**.ttf** | font/ttf | font/sfnt, application/x-font-ttf, application/font-sfnt +**.woff** | font/woff | - +**.woff2** | font/woff2 | - +**.otf** | font/otf | - +**.ttc** | font/collection | - +**.eot** | application/vnd.ms-fontobject | - +**.wasm** | application/wasm | - +**.shx** | application/vnd.shx | - +**.shp** | application/vnd.shp | - +**.dbf** | application/x-dbf | - +**.dcm** | application/dicom | - +**.rar** | application/x-rar-compressed | application/x-rar +**.djvu** | image/vnd.djvu | - +**.mobi** | application/x-mobipocket-ebook | - +**.lit** | application/x-ms-reader | - +**.bpg** | image/bpg | - +**.cbor** | application/cbor | - +**.sqlite** | application/vnd.sqlite3 | application/x-sqlite3 +**.dwg** | image/vnd.dwg | image/x-dwg, application/acad, application/x-acad, application/autocad_dwg, application/dwg, application/x-dwg, application/x-autocad, drawing/dwg +**.nes** | application/vnd.nintendo.snes.rom | - +**.lnk** | application/x-ms-shortcut | - +**.macho** | application/x-mach-binary | - +**.qcp** | audio/qcelp | - +**.icns** | image/x-icns | - +**.hdr** | image/vnd.radiance | - +**.mrc** | application/marc | - +**.mdb** | application/x-msaccess | - +**.accdb** | application/x-msaccess | - +**.zst** | application/zstd | - +**.cab** | application/vnd.ms-cab-compressed | - +**.rpm** | application/x-rpm | - +**.xz** | application/x-xz | - +**.lz** | application/lzip | application/x-lzip +**.torrent** | application/x-bittorrent | - +**.cpio** | application/x-cpio | - +**n/a** | application/tzif | - +**.xcf** | image/x-xcf | - +**.pat** | image/x-gimp-pat | - +**.gbr** | image/x-gimp-gbr | - +**.glb** | model/gltf-binary | - +**.cab** | application/x-installshield | - +**.jxr** | image/jxr | image/vnd.ms-photo +**.parquet** | application/vnd.apache.parquet | application/x-parquet +**.txt** | text/plain | - +**.html** | text/html | - +**.svg** | image/svg+xml | - +**.xml** | text/xml | application/xml +**.rss** | application/rss+xml | text/rss +**.atom** | application/atom+xml | - +**.x3d** | model/x3d+xml | - +**.kml** | application/vnd.google-earth.kml+xml | - +**.xlf** | application/x-xliff+xml | - +**.dae** | model/vnd.collada+xml | - +**.gml** | application/gml+xml | - +**.gpx** | application/gpx+xml | - +**.tcx** | application/vnd.garmin.tcx+xml | - +**.amf** | application/x-amf | - +**.3mf** | application/vnd.ms-package.3dmanufacturing-3dmodel+xml | - +**.xfdf** | application/vnd.adobe.xfdf | - +**.owl** | application/owl+xml | - +**.php** | text/x-php | - +**.js** | text/javascript | application/x-javascript, application/javascript +**.lua** | text/x-lua | - +**.pl** | text/x-perl | - +**.py** | text/x-python | text/x-script.python, application/x-python +**.json** | application/json | - +**.geojson** | application/geo+json | - +**.har** | application/json | - +**.ndjson** | application/x-ndjson | - +**.rtf** | text/rtf | application/rtf +**.srt** | application/x-subrip | application/x-srt, text/x-srt +**.tcl** | text/x-tcl | application/x-tcl +**.csv** | text/csv | - +**.tsv** | text/tab-separated-values | - +**.vcf** | text/vcard | - +**.ics** | text/calendar | - +**.warc** | application/warc | - +**.vtt** | text/vtt | - diff --git a/vendor/github.com/gabriel-vasile/mimetype/tree.go b/vendor/github.com/gabriel-vasile/mimetype/tree.go new file mode 100644 index 00000000..b5f56622 --- /dev/null +++ b/vendor/github.com/gabriel-vasile/mimetype/tree.go @@ -0,0 +1,270 @@ +package mimetype + +import ( + "sync" + + "github.com/gabriel-vasile/mimetype/internal/magic" +) + +// mimetype stores the list of MIME types in a tree structure with +// "application/octet-stream" at the root of the hierarchy. The hierarchy +// approach minimizes the number of checks that need to be done on the input +// and allows for more precise results once the base type of file has been +// identified. +// +// root is a detector which passes for any slice of bytes. +// When a detector passes the check, the children detectors +// are tried in order to find a more accurate MIME type. +var root = newMIME("application/octet-stream", "", + func([]byte, uint32) bool { return true }, + xpm, sevenZ, zip, pdf, fdf, ole, ps, psd, p7s, ogg, png, jpg, jxl, jp2, jpx, + jpm, jxs, gif, webp, exe, elf, ar, tar, xar, bz2, fits, tiff, bmp, ico, mp3, + flac, midi, ape, musePack, amr, wav, aiff, au, mpeg, quickTime, mp4, webM, + avi, flv, mkv, asf, aac, voc, m3u, rmvb, gzip, class, swf, crx, ttf, woff, + woff2, otf, ttc, eot, wasm, shx, dbf, dcm, rar, djvu, mobi, lit, bpg, cbor, + sqlite3, dwg, nes, lnk, macho, qcp, icns, hdr, mrc, mdb, accdb, zstd, cab, + rpm, xz, lzip, torrent, cpio, tzif, xcf, pat, gbr, glb, cabIS, jxr, parquet, + // Keep text last because it is the slowest check. + text, +) + +// errMIME is returned from Detect functions when err is not nil. +// Detect could return root for erroneous cases, but it needs to lock mu in order to do so. +// errMIME is same as root but it does not require locking. +var errMIME = newMIME("application/octet-stream", "", func([]byte, uint32) bool { return false }) + +// mu guards access to the root MIME tree. Access to root must be synchronized with this lock. +var mu = &sync.RWMutex{} + +// The list of nodes appended to the root node. +var ( + xz = newMIME("application/x-xz", ".xz", magic.Xz) + gzip = newMIME("application/gzip", ".gz", magic.Gzip).alias( + "application/x-gzip", "application/x-gunzip", "application/gzipped", + "application/gzip-compressed", "application/x-gzip-compressed", + "gzip/document") + sevenZ = newMIME("application/x-7z-compressed", ".7z", magic.SevenZ) + // APK must be checked before JAR because APK is a subset of JAR. + // This means APK should be a child of JAR detector, but in practice, + // the decisive signature for JAR might be located at the end of the file + // and not reachable because of library readLimit. + zip = newMIME("application/zip", ".zip", magic.Zip, xlsx, docx, pptx, epub, apk, jar, odt, ods, odp, odg, odf, odc, sxc). + alias("application/x-zip", "application/x-zip-compressed") + tar = newMIME("application/x-tar", ".tar", magic.Tar) + xar = newMIME("application/x-xar", ".xar", magic.Xar) + bz2 = newMIME("application/x-bzip2", ".bz2", magic.Bz2) + pdf = newMIME("application/pdf", ".pdf", magic.Pdf). + alias("application/x-pdf") + fdf = newMIME("application/vnd.fdf", ".fdf", magic.Fdf) + xlsx = newMIME("application/vnd.openxmlformats-officedocument.spreadsheetml.sheet", ".xlsx", magic.Xlsx) + docx = newMIME("application/vnd.openxmlformats-officedocument.wordprocessingml.document", ".docx", magic.Docx) + pptx = newMIME("application/vnd.openxmlformats-officedocument.presentationml.presentation", ".pptx", magic.Pptx) + epub = newMIME("application/epub+zip", ".epub", magic.Epub) + jar = newMIME("application/jar", ".jar", magic.Jar) + apk = newMIME("application/vnd.android.package-archive", ".apk", magic.APK) + ole = newMIME("application/x-ole-storage", "", magic.Ole, msi, aaf, msg, xls, pub, ppt, doc) + msi = newMIME("application/x-ms-installer", ".msi", magic.Msi). + alias("application/x-windows-installer", "application/x-msi") + aaf = newMIME("application/octet-stream", ".aaf", magic.Aaf) + doc = newMIME("application/msword", ".doc", magic.Doc). + alias("application/vnd.ms-word") + ppt = newMIME("application/vnd.ms-powerpoint", ".ppt", magic.Ppt). + alias("application/mspowerpoint") + pub = newMIME("application/vnd.ms-publisher", ".pub", magic.Pub) + xls = newMIME("application/vnd.ms-excel", ".xls", magic.Xls). + alias("application/msexcel") + msg = newMIME("application/vnd.ms-outlook", ".msg", magic.Msg) + ps = newMIME("application/postscript", ".ps", magic.Ps) + fits = newMIME("application/fits", ".fits", magic.Fits) + ogg = newMIME("application/ogg", ".ogg", magic.Ogg, oggAudio, oggVideo). + alias("application/x-ogg") + oggAudio = newMIME("audio/ogg", ".oga", magic.OggAudio) + oggVideo = newMIME("video/ogg", ".ogv", magic.OggVideo) + text = newMIME("text/plain", ".txt", magic.Text, html, svg, xml, php, js, lua, perl, python, json, ndJSON, rtf, srt, tcl, csv, tsv, vCard, iCalendar, warc, vtt) + xml = newMIME("text/xml", ".xml", magic.XML, rss, atom, x3d, kml, xliff, collada, gml, gpx, tcx, amf, threemf, xfdf, owl2). + alias("application/xml") + json = newMIME("application/json", ".json", magic.JSON, geoJSON, har) + har = newMIME("application/json", ".har", magic.HAR) + csv = newMIME("text/csv", ".csv", magic.Csv) + tsv = newMIME("text/tab-separated-values", ".tsv", magic.Tsv) + geoJSON = newMIME("application/geo+json", ".geojson", magic.GeoJSON) + ndJSON = newMIME("application/x-ndjson", ".ndjson", magic.NdJSON) + html = newMIME("text/html", ".html", magic.HTML) + php = newMIME("text/x-php", ".php", magic.Php) + rtf = newMIME("text/rtf", ".rtf", magic.Rtf).alias("application/rtf") + js = newMIME("text/javascript", ".js", magic.Js). + alias("application/x-javascript", "application/javascript") + srt = newMIME("application/x-subrip", ".srt", magic.Srt). + alias("application/x-srt", "text/x-srt") + vtt = newMIME("text/vtt", ".vtt", magic.Vtt) + lua = newMIME("text/x-lua", ".lua", magic.Lua) + perl = newMIME("text/x-perl", ".pl", magic.Perl) + python = newMIME("text/x-python", ".py", magic.Python). + alias("text/x-script.python", "application/x-python") + tcl = newMIME("text/x-tcl", ".tcl", magic.Tcl). + alias("application/x-tcl") + vCard = newMIME("text/vcard", ".vcf", magic.VCard) + iCalendar = newMIME("text/calendar", ".ics", magic.ICalendar) + svg = newMIME("image/svg+xml", ".svg", magic.Svg) + rss = newMIME("application/rss+xml", ".rss", magic.Rss). + alias("text/rss") + owl2 = newMIME("application/owl+xml", ".owl", magic.Owl2) + atom = newMIME("application/atom+xml", ".atom", magic.Atom) + x3d = newMIME("model/x3d+xml", ".x3d", magic.X3d) + kml = newMIME("application/vnd.google-earth.kml+xml", ".kml", magic.Kml) + xliff = newMIME("application/x-xliff+xml", ".xlf", magic.Xliff) + collada = newMIME("model/vnd.collada+xml", ".dae", magic.Collada) + gml = newMIME("application/gml+xml", ".gml", magic.Gml) + gpx = newMIME("application/gpx+xml", ".gpx", magic.Gpx) + tcx = newMIME("application/vnd.garmin.tcx+xml", ".tcx", magic.Tcx) + amf = newMIME("application/x-amf", ".amf", magic.Amf) + threemf = newMIME("application/vnd.ms-package.3dmanufacturing-3dmodel+xml", ".3mf", magic.Threemf) + png = newMIME("image/png", ".png", magic.Png, apng) + apng = newMIME("image/vnd.mozilla.apng", ".png", magic.Apng) + jpg = newMIME("image/jpeg", ".jpg", magic.Jpg) + jxl = newMIME("image/jxl", ".jxl", magic.Jxl) + jp2 = newMIME("image/jp2", ".jp2", magic.Jp2) + jpx = newMIME("image/jpx", ".jpf", magic.Jpx) + jpm = newMIME("image/jpm", ".jpm", magic.Jpm). + alias("video/jpm") + jxs = newMIME("image/jxs", ".jxs", magic.Jxs) + xpm = newMIME("image/x-xpixmap", ".xpm", magic.Xpm) + bpg = newMIME("image/bpg", ".bpg", magic.Bpg) + gif = newMIME("image/gif", ".gif", magic.Gif) + webp = newMIME("image/webp", ".webp", magic.Webp) + tiff = newMIME("image/tiff", ".tiff", magic.Tiff) + bmp = newMIME("image/bmp", ".bmp", magic.Bmp). + alias("image/x-bmp", "image/x-ms-bmp") + ico = newMIME("image/x-icon", ".ico", magic.Ico) + icns = newMIME("image/x-icns", ".icns", magic.Icns) + psd = newMIME("image/vnd.adobe.photoshop", ".psd", magic.Psd). + alias("image/x-psd", "application/photoshop") + heic = newMIME("image/heic", ".heic", magic.Heic) + heicSeq = newMIME("image/heic-sequence", ".heic", magic.HeicSequence) + heif = newMIME("image/heif", ".heif", magic.Heif) + heifSeq = newMIME("image/heif-sequence", ".heif", magic.HeifSequence) + hdr = newMIME("image/vnd.radiance", ".hdr", magic.Hdr) + avif = newMIME("image/avif", ".avif", magic.AVIF) + mp3 = newMIME("audio/mpeg", ".mp3", magic.Mp3). + alias("audio/x-mpeg", "audio/mp3") + flac = newMIME("audio/flac", ".flac", magic.Flac) + midi = newMIME("audio/midi", ".midi", magic.Midi). + alias("audio/mid", "audio/sp-midi", "audio/x-mid", "audio/x-midi") + ape = newMIME("audio/ape", ".ape", magic.Ape) + musePack = newMIME("audio/musepack", ".mpc", magic.MusePack) + wav = newMIME("audio/wav", ".wav", magic.Wav). + alias("audio/x-wav", "audio/vnd.wave", "audio/wave") + aiff = newMIME("audio/aiff", ".aiff", magic.Aiff).alias("audio/x-aiff") + au = newMIME("audio/basic", ".au", magic.Au) + amr = newMIME("audio/amr", ".amr", magic.Amr). + alias("audio/amr-nb") + aac = newMIME("audio/aac", ".aac", magic.AAC) + voc = newMIME("audio/x-unknown", ".voc", magic.Voc) + aMp4 = newMIME("audio/mp4", ".mp4", magic.AMp4). + alias("audio/x-mp4a") + m4a = newMIME("audio/x-m4a", ".m4a", magic.M4a) + m3u = newMIME("application/vnd.apple.mpegurl", ".m3u", magic.M3u). + alias("audio/mpegurl") + m4v = newMIME("video/x-m4v", ".m4v", magic.M4v) + mj2 = newMIME("video/mj2", ".mj2", magic.Mj2) + dvb = newMIME("video/vnd.dvb.file", ".dvb", magic.Dvb) + mp4 = newMIME("video/mp4", ".mp4", magic.Mp4, avif, threeGP, threeG2, aMp4, mqv, m4a, m4v, heic, heicSeq, heif, heifSeq, mj2, dvb) + webM = newMIME("video/webm", ".webm", magic.WebM). + alias("audio/webm") + mpeg = newMIME("video/mpeg", ".mpeg", magic.Mpeg) + quickTime = newMIME("video/quicktime", ".mov", magic.QuickTime) + mqv = newMIME("video/quicktime", ".mqv", magic.Mqv) + threeGP = newMIME("video/3gpp", ".3gp", magic.ThreeGP). + alias("video/3gp", "audio/3gpp") + threeG2 = newMIME("video/3gpp2", ".3g2", magic.ThreeG2). + alias("video/3g2", "audio/3gpp2") + avi = newMIME("video/x-msvideo", ".avi", magic.Avi). + alias("video/avi", "video/msvideo") + flv = newMIME("video/x-flv", ".flv", magic.Flv) + mkv = newMIME("video/x-matroska", ".mkv", magic.Mkv) + asf = newMIME("video/x-ms-asf", ".asf", magic.Asf). + alias("video/asf", "video/x-ms-wmv") + rmvb = newMIME("application/vnd.rn-realmedia-vbr", ".rmvb", magic.Rmvb) + class = newMIME("application/x-java-applet", ".class", magic.Class) + swf = newMIME("application/x-shockwave-flash", ".swf", magic.SWF) + crx = newMIME("application/x-chrome-extension", ".crx", magic.CRX) + ttf = newMIME("font/ttf", ".ttf", magic.Ttf). + alias("font/sfnt", "application/x-font-ttf", "application/font-sfnt") + woff = newMIME("font/woff", ".woff", magic.Woff) + woff2 = newMIME("font/woff2", ".woff2", magic.Woff2) + otf = newMIME("font/otf", ".otf", magic.Otf) + ttc = newMIME("font/collection", ".ttc", magic.Ttc) + eot = newMIME("application/vnd.ms-fontobject", ".eot", magic.Eot) + wasm = newMIME("application/wasm", ".wasm", magic.Wasm) + shp = newMIME("application/vnd.shp", ".shp", magic.Shp) + shx = newMIME("application/vnd.shx", ".shx", magic.Shx, shp) + dbf = newMIME("application/x-dbf", ".dbf", magic.Dbf) + exe = newMIME("application/vnd.microsoft.portable-executable", ".exe", magic.Exe) + elf = newMIME("application/x-elf", "", magic.Elf, elfObj, elfExe, elfLib, elfDump) + elfObj = newMIME("application/x-object", "", magic.ElfObj) + elfExe = newMIME("application/x-executable", "", magic.ElfExe) + elfLib = newMIME("application/x-sharedlib", ".so", magic.ElfLib) + elfDump = newMIME("application/x-coredump", "", magic.ElfDump) + ar = newMIME("application/x-archive", ".a", magic.Ar, deb). + alias("application/x-unix-archive") + deb = newMIME("application/vnd.debian.binary-package", ".deb", magic.Deb) + rpm = newMIME("application/x-rpm", ".rpm", magic.RPM) + dcm = newMIME("application/dicom", ".dcm", magic.Dcm) + odt = newMIME("application/vnd.oasis.opendocument.text", ".odt", magic.Odt, ott). + alias("application/x-vnd.oasis.opendocument.text") + ott = newMIME("application/vnd.oasis.opendocument.text-template", ".ott", magic.Ott). + alias("application/x-vnd.oasis.opendocument.text-template") + ods = newMIME("application/vnd.oasis.opendocument.spreadsheet", ".ods", magic.Ods, ots). + alias("application/x-vnd.oasis.opendocument.spreadsheet") + ots = newMIME("application/vnd.oasis.opendocument.spreadsheet-template", ".ots", magic.Ots). + alias("application/x-vnd.oasis.opendocument.spreadsheet-template") + odp = newMIME("application/vnd.oasis.opendocument.presentation", ".odp", magic.Odp, otp). + alias("application/x-vnd.oasis.opendocument.presentation") + otp = newMIME("application/vnd.oasis.opendocument.presentation-template", ".otp", magic.Otp). + alias("application/x-vnd.oasis.opendocument.presentation-template") + odg = newMIME("application/vnd.oasis.opendocument.graphics", ".odg", magic.Odg, otg). + alias("application/x-vnd.oasis.opendocument.graphics") + otg = newMIME("application/vnd.oasis.opendocument.graphics-template", ".otg", magic.Otg). + alias("application/x-vnd.oasis.opendocument.graphics-template") + odf = newMIME("application/vnd.oasis.opendocument.formula", ".odf", magic.Odf). + alias("application/x-vnd.oasis.opendocument.formula") + odc = newMIME("application/vnd.oasis.opendocument.chart", ".odc", magic.Odc). + alias("application/x-vnd.oasis.opendocument.chart") + sxc = newMIME("application/vnd.sun.xml.calc", ".sxc", magic.Sxc) + rar = newMIME("application/x-rar-compressed", ".rar", magic.RAR). + alias("application/x-rar") + djvu = newMIME("image/vnd.djvu", ".djvu", magic.DjVu) + mobi = newMIME("application/x-mobipocket-ebook", ".mobi", magic.Mobi) + lit = newMIME("application/x-ms-reader", ".lit", magic.Lit) + sqlite3 = newMIME("application/vnd.sqlite3", ".sqlite", magic.Sqlite). + alias("application/x-sqlite3") + dwg = newMIME("image/vnd.dwg", ".dwg", magic.Dwg). + alias("image/x-dwg", "application/acad", "application/x-acad", + "application/autocad_dwg", "application/dwg", "application/x-dwg", + "application/x-autocad", "drawing/dwg") + warc = newMIME("application/warc", ".warc", magic.Warc) + nes = newMIME("application/vnd.nintendo.snes.rom", ".nes", magic.Nes) + lnk = newMIME("application/x-ms-shortcut", ".lnk", magic.Lnk) + macho = newMIME("application/x-mach-binary", ".macho", magic.MachO) + qcp = newMIME("audio/qcelp", ".qcp", magic.Qcp) + mrc = newMIME("application/marc", ".mrc", magic.Marc) + mdb = newMIME("application/x-msaccess", ".mdb", magic.MsAccessMdb) + accdb = newMIME("application/x-msaccess", ".accdb", magic.MsAccessAce) + zstd = newMIME("application/zstd", ".zst", magic.Zstd) + cab = newMIME("application/vnd.ms-cab-compressed", ".cab", magic.Cab) + cabIS = newMIME("application/x-installshield", ".cab", magic.InstallShieldCab) + lzip = newMIME("application/lzip", ".lz", magic.Lzip).alias("application/x-lzip") + torrent = newMIME("application/x-bittorrent", ".torrent", magic.Torrent) + cpio = newMIME("application/x-cpio", ".cpio", magic.Cpio) + tzif = newMIME("application/tzif", "", magic.TzIf) + p7s = newMIME("application/pkcs7-signature", ".p7s", magic.P7s) + xcf = newMIME("image/x-xcf", ".xcf", magic.Xcf) + pat = newMIME("image/x-gimp-pat", ".pat", magic.Pat) + gbr = newMIME("image/x-gimp-gbr", ".gbr", magic.Gbr) + xfdf = newMIME("application/vnd.adobe.xfdf", ".xfdf", magic.Xfdf) + glb = newMIME("model/gltf-binary", ".glb", magic.Glb) + jxr = newMIME("image/jxr", ".jxr", magic.Jxr).alias("image/vnd.ms-photo") + parquet = newMIME("application/vnd.apache.parquet", ".parquet", magic.Par1). + alias("application/x-parquet") + cbor = newMIME("application/cbor", ".cbor", magic.CBOR) +) diff --git a/vendor/github.com/go-playground/locales/.gitignore b/vendor/github.com/go-playground/locales/.gitignore new file mode 100644 index 00000000..daf913b1 --- /dev/null +++ b/vendor/github.com/go-playground/locales/.gitignore @@ -0,0 +1,24 @@ +# Compiled Object files, Static and Dynamic libs (Shared Objects) +*.o +*.a +*.so + +# Folders +_obj +_test + +# Architecture specific extensions/prefixes +*.[568vq] +[568vq].out + +*.cgo1.go +*.cgo2.c +_cgo_defun.c +_cgo_gotypes.go +_cgo_export.* + +_testmain.go + +*.exe +*.test +*.prof diff --git a/vendor/github.com/go-playground/locales/.travis.yml b/vendor/github.com/go-playground/locales/.travis.yml new file mode 100644 index 00000000..d50237a6 --- /dev/null +++ b/vendor/github.com/go-playground/locales/.travis.yml @@ -0,0 +1,26 @@ +language: go +go: + - 1.13.1 + - tip +matrix: + allow_failures: + - go: tip + +notifications: + email: + recipients: dean.karn@gmail.com + on_success: change + on_failure: always + +before_install: + - go install github.com/mattn/goveralls + +# Only clone the most recent commit. +git: + depth: 1 + +script: + - go test -v -race -covermode=atomic -coverprofile=coverage.coverprofile ./... + +after_success: | + goveralls -coverprofile=coverage.coverprofile -service travis-ci -repotoken $COVERALLS_TOKEN \ No newline at end of file diff --git a/vendor/github.com/go-playground/locales/LICENSE b/vendor/github.com/go-playground/locales/LICENSE new file mode 100644 index 00000000..75854ac4 --- /dev/null +++ b/vendor/github.com/go-playground/locales/LICENSE @@ -0,0 +1,21 @@ +The MIT License (MIT) + +Copyright (c) 2016 Go Playground + +Permission is hereby granted, free of charge, to any person obtaining a copy +of this software and associated documentation files (the "Software"), to deal +in the Software without restriction, including without limitation the rights +to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +copies of the Software, and to permit persons to whom the Software is +furnished to do so, subject to the following conditions: + +The above copyright notice and this permission notice shall be included in all +copies or substantial portions of the Software. + +THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE +SOFTWARE. \ No newline at end of file diff --git a/vendor/github.com/go-playground/locales/README.md b/vendor/github.com/go-playground/locales/README.md new file mode 100644 index 00000000..7b6be2c6 --- /dev/null +++ b/vendor/github.com/go-playground/locales/README.md @@ -0,0 +1,170 @@ +## locales +![Project status](https://img.shields.io/badge/version-0.14.1-green.svg) +[![Build Status](https://travis-ci.org/go-playground/locales.svg?branch=master)](https://travis-ci.org/go-playground/locales) +[![GoDoc](https://godoc.org/github.com/go-playground/locales?status.svg)](https://godoc.org/github.com/go-playground/locales) +![License](https://img.shields.io/dub/l/vibe-d.svg) + +Locales is a set of locales generated from the [Unicode CLDR Project](http://cldr.unicode.org/) which can be used independently or within +an i18n package; these were built for use with, but not exclusive to, [Universal Translator](https://github.com/go-playground/universal-translator). + +Features +-------- +- [x] Rules generated from the latest [CLDR](http://cldr.unicode.org/index/downloads) data, v36.0.1 +- [x] Contains Cardinal, Ordinal and Range Plural Rules +- [x] Contains Month, Weekday and Timezone translations built in +- [x] Contains Date & Time formatting functions +- [x] Contains Number, Currency, Accounting and Percent formatting functions +- [x] Supports the "Gregorian" calendar only ( my time isn't unlimited, had to draw the line somewhere ) + +Full Tests +-------------------- +I could sure use your help adding tests for every locale, it is a huge undertaking and I just don't have the free time to do it all at the moment; +any help would be **greatly appreciated!!!!** please see [issue](https://github.com/go-playground/locales/issues/1) for details. + +Installation +----------- + +Use go get + +```shell +go get github.com/go-playground/locales +``` + +NOTES +-------- +You'll notice most return types are []byte, this is because most of the time the results will be concatenated with a larger body +of text and can avoid some allocations if already appending to a byte array, otherwise just cast as string. + +Usage +------- +```go +package main + +import ( + "fmt" + "time" + + "github.com/go-playground/locales/currency" + "github.com/go-playground/locales/en_CA" +) + +func main() { + + loc, _ := time.LoadLocation("America/Toronto") + datetime := time.Date(2016, 02, 03, 9, 0, 1, 0, loc) + + l := en_CA.New() + + // Dates + fmt.Println(l.FmtDateFull(datetime)) + fmt.Println(l.FmtDateLong(datetime)) + fmt.Println(l.FmtDateMedium(datetime)) + fmt.Println(l.FmtDateShort(datetime)) + + // Times + fmt.Println(l.FmtTimeFull(datetime)) + fmt.Println(l.FmtTimeLong(datetime)) + fmt.Println(l.FmtTimeMedium(datetime)) + fmt.Println(l.FmtTimeShort(datetime)) + + // Months Wide + fmt.Println(l.MonthWide(time.January)) + fmt.Println(l.MonthWide(time.February)) + fmt.Println(l.MonthWide(time.March)) + // ... + + // Months Abbreviated + fmt.Println(l.MonthAbbreviated(time.January)) + fmt.Println(l.MonthAbbreviated(time.February)) + fmt.Println(l.MonthAbbreviated(time.March)) + // ... + + // Months Narrow + fmt.Println(l.MonthNarrow(time.January)) + fmt.Println(l.MonthNarrow(time.February)) + fmt.Println(l.MonthNarrow(time.March)) + // ... + + // Weekdays Wide + fmt.Println(l.WeekdayWide(time.Sunday)) + fmt.Println(l.WeekdayWide(time.Monday)) + fmt.Println(l.WeekdayWide(time.Tuesday)) + // ... + + // Weekdays Abbreviated + fmt.Println(l.WeekdayAbbreviated(time.Sunday)) + fmt.Println(l.WeekdayAbbreviated(time.Monday)) + fmt.Println(l.WeekdayAbbreviated(time.Tuesday)) + // ... + + // Weekdays Short + fmt.Println(l.WeekdayShort(time.Sunday)) + fmt.Println(l.WeekdayShort(time.Monday)) + fmt.Println(l.WeekdayShort(time.Tuesday)) + // ... + + // Weekdays Narrow + fmt.Println(l.WeekdayNarrow(time.Sunday)) + fmt.Println(l.WeekdayNarrow(time.Monday)) + fmt.Println(l.WeekdayNarrow(time.Tuesday)) + // ... + + var f64 float64 + + f64 = -10356.4523 + + // Number + fmt.Println(l.FmtNumber(f64, 2)) + + // Currency + fmt.Println(l.FmtCurrency(f64, 2, currency.CAD)) + fmt.Println(l.FmtCurrency(f64, 2, currency.USD)) + + // Accounting + fmt.Println(l.FmtAccounting(f64, 2, currency.CAD)) + fmt.Println(l.FmtAccounting(f64, 2, currency.USD)) + + f64 = 78.12 + + // Percent + fmt.Println(l.FmtPercent(f64, 0)) + + // Plural Rules for locale, so you know what rules you must cover + fmt.Println(l.PluralsCardinal()) + fmt.Println(l.PluralsOrdinal()) + + // Cardinal Plural Rules + fmt.Println(l.CardinalPluralRule(1, 0)) + fmt.Println(l.CardinalPluralRule(1.0, 0)) + fmt.Println(l.CardinalPluralRule(1.0, 1)) + fmt.Println(l.CardinalPluralRule(3, 0)) + + // Ordinal Plural Rules + fmt.Println(l.OrdinalPluralRule(21, 0)) // 21st + fmt.Println(l.OrdinalPluralRule(22, 0)) // 22nd + fmt.Println(l.OrdinalPluralRule(33, 0)) // 33rd + fmt.Println(l.OrdinalPluralRule(34, 0)) // 34th + + // Range Plural Rules + fmt.Println(l.RangePluralRule(1, 0, 1, 0)) // 1-1 + fmt.Println(l.RangePluralRule(1, 0, 2, 0)) // 1-2 + fmt.Println(l.RangePluralRule(5, 0, 8, 0)) // 5-8 +} +``` + +NOTES: +------- +These rules were generated from the [Unicode CLDR Project](http://cldr.unicode.org/), if you encounter any issues +I strongly encourage contributing to the CLDR project to get the locale information corrected and the next time +these locales are regenerated the fix will come with. + +I do however realize that time constraints are often important and so there are two options: + +1. Create your own locale, copy, paste and modify, and ensure it complies with the `Translator` interface. +2. Add an exception in the locale generation code directly and once regenerated, fix will be in place. + +Please to not make fixes inside the locale files, they WILL get overwritten when the locales are regenerated. + +License +------ +Distributed under MIT License, please see license file in code for more details. diff --git a/vendor/github.com/go-playground/locales/currency/currency.go b/vendor/github.com/go-playground/locales/currency/currency.go new file mode 100644 index 00000000..b5a95fb0 --- /dev/null +++ b/vendor/github.com/go-playground/locales/currency/currency.go @@ -0,0 +1,311 @@ +package currency + +// Type is the currency type associated with the locales currency enum +type Type int + +// locale currencies +const ( + ADP Type = iota + AED + AFA + AFN + ALK + ALL + AMD + ANG + AOA + AOK + AON + AOR + ARA + ARL + ARM + ARP + ARS + ATS + AUD + AWG + AZM + AZN + BAD + BAM + BAN + BBD + BDT + BEC + BEF + BEL + BGL + BGM + BGN + BGO + BHD + BIF + BMD + BND + BOB + BOL + BOP + BOV + BRB + BRC + BRE + BRL + BRN + BRR + BRZ + BSD + BTN + BUK + BWP + BYB + BYN + BYR + BZD + CAD + CDF + CHE + CHF + CHW + CLE + CLF + CLP + CNH + CNX + CNY + COP + COU + CRC + CSD + CSK + CUC + CUP + CVE + CYP + CZK + DDM + DEM + DJF + DKK + DOP + DZD + ECS + ECV + EEK + EGP + ERN + ESA + ESB + ESP + ETB + EUR + FIM + FJD + FKP + FRF + GBP + GEK + GEL + GHC + GHS + GIP + GMD + GNF + GNS + GQE + GRD + GTQ + GWE + GWP + GYD + HKD + HNL + HRD + HRK + HTG + HUF + IDR + IEP + ILP + ILR + ILS + INR + IQD + IRR + ISJ + ISK + ITL + JMD + JOD + JPY + KES + KGS + KHR + KMF + KPW + KRH + KRO + KRW + KWD + KYD + KZT + LAK + LBP + LKR + LRD + LSL + LTL + LTT + LUC + LUF + LUL + LVL + LVR + LYD + MAD + MAF + MCF + MDC + MDL + MGA + MGF + MKD + MKN + MLF + MMK + MNT + MOP + MRO + MRU + MTL + MTP + MUR + MVP + MVR + MWK + MXN + MXP + MXV + MYR + MZE + MZM + MZN + NAD + NGN + NIC + NIO + NLG + NOK + NPR + NZD + OMR + PAB + PEI + PEN + PES + PGK + PHP + PKR + PLN + PLZ + PTE + PYG + QAR + RHD + ROL + RON + RSD + RUB + RUR + RWF + SAR + SBD + SCR + SDD + SDG + SDP + SEK + SGD + SHP + SIT + SKK + SLL + SOS + SRD + SRG + SSP + STD + STN + SUR + SVC + SYP + SZL + THB + TJR + TJS + TMM + TMT + TND + TOP + TPE + TRL + TRY + TTD + TWD + TZS + UAH + UAK + UGS + UGX + USD + USN + USS + UYI + UYP + UYU + UYW + UZS + VEB + VEF + VES + VND + VNN + VUV + WST + XAF + XAG + XAU + XBA + XBB + XBC + XBD + XCD + XDR + XEU + XFO + XFU + XOF + XPD + XPF + XPT + XRE + XSU + XTS + XUA + XXX + YDD + YER + YUD + YUM + YUN + YUR + ZAL + ZAR + ZMK + ZMW + ZRN + ZRZ + ZWD + ZWL + ZWR +) diff --git a/vendor/github.com/go-playground/locales/logo.png b/vendor/github.com/go-playground/locales/logo.png new file mode 100644 index 00000000..3038276e Binary files /dev/null and b/vendor/github.com/go-playground/locales/logo.png differ diff --git a/vendor/github.com/go-playground/locales/rules.go b/vendor/github.com/go-playground/locales/rules.go new file mode 100644 index 00000000..92029001 --- /dev/null +++ b/vendor/github.com/go-playground/locales/rules.go @@ -0,0 +1,293 @@ +package locales + +import ( + "strconv" + "time" + + "github.com/go-playground/locales/currency" +) + +// // ErrBadNumberValue is returned when the number passed for +// // plural rule determination cannot be parsed +// type ErrBadNumberValue struct { +// NumberValue string +// InnerError error +// } + +// // Error returns ErrBadNumberValue error string +// func (e *ErrBadNumberValue) Error() string { +// return fmt.Sprintf("Invalid Number Value '%s' %s", e.NumberValue, e.InnerError) +// } + +// var _ error = new(ErrBadNumberValue) + +// PluralRule denotes the type of plural rules +type PluralRule int + +// PluralRule's +const ( + PluralRuleUnknown PluralRule = iota + PluralRuleZero // zero + PluralRuleOne // one - singular + PluralRuleTwo // two - dual + PluralRuleFew // few - paucal + PluralRuleMany // many - also used for fractions if they have a separate class + PluralRuleOther // other - required—general plural form—also used if the language only has a single form +) + +const ( + pluralsString = "UnknownZeroOneTwoFewManyOther" +) + +// Translator encapsulates an instance of a locale +// NOTE: some values are returned as a []byte just in case the caller +// wishes to add more and can help avoid allocations; otherwise just cast as string +type Translator interface { + + // The following Functions are for overriding, debugging or developing + // with a Translator Locale + + // Locale returns the string value of the translator + Locale() string + + // returns an array of cardinal plural rules associated + // with this translator + PluralsCardinal() []PluralRule + + // returns an array of ordinal plural rules associated + // with this translator + PluralsOrdinal() []PluralRule + + // returns an array of range plural rules associated + // with this translator + PluralsRange() []PluralRule + + // returns the cardinal PluralRule given 'num' and digits/precision of 'v' for locale + CardinalPluralRule(num float64, v uint64) PluralRule + + // returns the ordinal PluralRule given 'num' and digits/precision of 'v' for locale + OrdinalPluralRule(num float64, v uint64) PluralRule + + // returns the ordinal PluralRule given 'num1', 'num2' and digits/precision of 'v1' and 'v2' for locale + RangePluralRule(num1 float64, v1 uint64, num2 float64, v2 uint64) PluralRule + + // returns the locales abbreviated month given the 'month' provided + MonthAbbreviated(month time.Month) string + + // returns the locales abbreviated months + MonthsAbbreviated() []string + + // returns the locales narrow month given the 'month' provided + MonthNarrow(month time.Month) string + + // returns the locales narrow months + MonthsNarrow() []string + + // returns the locales wide month given the 'month' provided + MonthWide(month time.Month) string + + // returns the locales wide months + MonthsWide() []string + + // returns the locales abbreviated weekday given the 'weekday' provided + WeekdayAbbreviated(weekday time.Weekday) string + + // returns the locales abbreviated weekdays + WeekdaysAbbreviated() []string + + // returns the locales narrow weekday given the 'weekday' provided + WeekdayNarrow(weekday time.Weekday) string + + // WeekdaysNarrowreturns the locales narrow weekdays + WeekdaysNarrow() []string + + // returns the locales short weekday given the 'weekday' provided + WeekdayShort(weekday time.Weekday) string + + // returns the locales short weekdays + WeekdaysShort() []string + + // returns the locales wide weekday given the 'weekday' provided + WeekdayWide(weekday time.Weekday) string + + // returns the locales wide weekdays + WeekdaysWide() []string + + // The following Functions are common Formatting functionsfor the Translator's Locale + + // returns 'num' with digits/precision of 'v' for locale and handles both Whole and Real numbers based on 'v' + FmtNumber(num float64, v uint64) string + + // returns 'num' with digits/precision of 'v' for locale and handles both Whole and Real numbers based on 'v' + // NOTE: 'num' passed into FmtPercent is assumed to be in percent already + FmtPercent(num float64, v uint64) string + + // returns the currency representation of 'num' with digits/precision of 'v' for locale + FmtCurrency(num float64, v uint64, currency currency.Type) string + + // returns the currency representation of 'num' with digits/precision of 'v' for locale + // in accounting notation. + FmtAccounting(num float64, v uint64, currency currency.Type) string + + // returns the short date representation of 't' for locale + FmtDateShort(t time.Time) string + + // returns the medium date representation of 't' for locale + FmtDateMedium(t time.Time) string + + // returns the long date representation of 't' for locale + FmtDateLong(t time.Time) string + + // returns the full date representation of 't' for locale + FmtDateFull(t time.Time) string + + // returns the short time representation of 't' for locale + FmtTimeShort(t time.Time) string + + // returns the medium time representation of 't' for locale + FmtTimeMedium(t time.Time) string + + // returns the long time representation of 't' for locale + FmtTimeLong(t time.Time) string + + // returns the full time representation of 't' for locale + FmtTimeFull(t time.Time) string +} + +// String returns the string value of PluralRule +func (p PluralRule) String() string { + + switch p { + case PluralRuleZero: + return pluralsString[7:11] + case PluralRuleOne: + return pluralsString[11:14] + case PluralRuleTwo: + return pluralsString[14:17] + case PluralRuleFew: + return pluralsString[17:20] + case PluralRuleMany: + return pluralsString[20:24] + case PluralRuleOther: + return pluralsString[24:] + default: + return pluralsString[:7] + } +} + +// +// Precision Notes: +// +// must specify a precision >= 0, and here is why https://play.golang.org/p/LyL90U0Vyh +// +// v := float64(3.141) +// i := float64(int64(v)) +// +// fmt.Println(v - i) +// +// or +// +// s := strconv.FormatFloat(v-i, 'f', -1, 64) +// fmt.Println(s) +// +// these will not print what you'd expect: 0.14100000000000001 +// and so this library requires a precision to be specified, or +// inaccurate plural rules could be applied. +// +// +// +// n - absolute value of the source number (integer and decimals). +// i - integer digits of n. +// v - number of visible fraction digits in n, with trailing zeros. +// w - number of visible fraction digits in n, without trailing zeros. +// f - visible fractional digits in n, with trailing zeros. +// t - visible fractional digits in n, without trailing zeros. +// +// +// Func(num float64, v uint64) // v = digits/precision and prevents -1 as a special case as this can lead to very unexpected behaviour, see precision note's above. +// +// n := math.Abs(num) +// i := int64(n) +// v := v +// +// +// w := strconv.FormatFloat(num-float64(i), 'f', int(v), 64) // then parse backwards on string until no more zero's.... +// f := strconv.FormatFloat(n, 'f', int(v), 64) // then turn everything after decimal into an int64 +// t := strconv.FormatFloat(n, 'f', int(v), 64) // then parse backwards on string until no more zero's.... +// +// +// +// General Inclusion Rules +// - v will always be available inherently +// - all require n +// - w requires i +// + +// W returns the number of visible fraction digits in N, without trailing zeros. +func W(n float64, v uint64) (w int64) { + + s := strconv.FormatFloat(n-float64(int64(n)), 'f', int(v), 64) + + // with either be '0' or '0.xxxx', so if 1 then w will be zero + // otherwise need to parse + if len(s) != 1 { + + s = s[2:] + end := len(s) + 1 + + for i := end; i >= 0; i-- { + if s[i] != '0' { + end = i + 1 + break + } + } + + w = int64(len(s[:end])) + } + + return +} + +// F returns the visible fractional digits in N, with trailing zeros. +func F(n float64, v uint64) (f int64) { + + s := strconv.FormatFloat(n-float64(int64(n)), 'f', int(v), 64) + + // with either be '0' or '0.xxxx', so if 1 then f will be zero + // otherwise need to parse + if len(s) != 1 { + + // ignoring error, because it can't fail as we generated + // the string internally from a real number + f, _ = strconv.ParseInt(s[2:], 10, 64) + } + + return +} + +// T returns the visible fractional digits in N, without trailing zeros. +func T(n float64, v uint64) (t int64) { + + s := strconv.FormatFloat(n-float64(int64(n)), 'f', int(v), 64) + + // with either be '0' or '0.xxxx', so if 1 then t will be zero + // otherwise need to parse + if len(s) != 1 { + + s = s[2:] + end := len(s) + 1 + + for i := end; i >= 0; i-- { + if s[i] != '0' { + end = i + 1 + break + } + } + + // ignoring error, because it can't fail as we generated + // the string internally from a real number + t, _ = strconv.ParseInt(s[:end], 10, 64) + } + + return +} diff --git a/vendor/github.com/go-playground/universal-translator/.gitignore b/vendor/github.com/go-playground/universal-translator/.gitignore new file mode 100644 index 00000000..bc4e07f3 --- /dev/null +++ b/vendor/github.com/go-playground/universal-translator/.gitignore @@ -0,0 +1,25 @@ +# Compiled Object files, Static and Dynamic libs (Shared Objects) +*.o +*.a +*.so + +# Folders +_obj +_test + +# Architecture specific extensions/prefixes +*.[568vq] +[568vq].out + +*.cgo1.go +*.cgo2.c +_cgo_defun.c +_cgo_gotypes.go +_cgo_export.* + +_testmain.go + +*.exe +*.test +*.prof +*.coverprofile \ No newline at end of file diff --git a/vendor/github.com/go-playground/universal-translator/.travis.yml b/vendor/github.com/go-playground/universal-translator/.travis.yml new file mode 100644 index 00000000..39b8b923 --- /dev/null +++ b/vendor/github.com/go-playground/universal-translator/.travis.yml @@ -0,0 +1,27 @@ +language: go +go: + - 1.13.4 + - tip +matrix: + allow_failures: + - go: tip + +notifications: + email: + recipients: dean.karn@gmail.com + on_success: change + on_failure: always + +before_install: + - go install github.com/mattn/goveralls + +# Only clone the most recent commit. +git: + depth: 1 + +script: + - go test -v -race -covermode=atomic -coverprofile=coverage.coverprofile ./... + +after_success: | + [ $TRAVIS_GO_VERSION = 1.13.4 ] && + goveralls -coverprofile=coverage.coverprofile -service travis-ci -repotoken $COVERALLS_TOKEN \ No newline at end of file diff --git a/vendor/github.com/go-playground/universal-translator/LICENSE b/vendor/github.com/go-playground/universal-translator/LICENSE new file mode 100644 index 00000000..8d8aba15 --- /dev/null +++ b/vendor/github.com/go-playground/universal-translator/LICENSE @@ -0,0 +1,21 @@ +The MIT License (MIT) + +Copyright (c) 2016 Go Playground + +Permission is hereby granted, free of charge, to any person obtaining a copy +of this software and associated documentation files (the "Software"), to deal +in the Software without restriction, including without limitation the rights +to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +copies of the Software, and to permit persons to whom the Software is +furnished to do so, subject to the following conditions: + +The above copyright notice and this permission notice shall be included in all +copies or substantial portions of the Software. + +THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE +SOFTWARE. diff --git a/vendor/github.com/go-playground/universal-translator/Makefile b/vendor/github.com/go-playground/universal-translator/Makefile new file mode 100644 index 00000000..ec3455bd --- /dev/null +++ b/vendor/github.com/go-playground/universal-translator/Makefile @@ -0,0 +1,18 @@ +GOCMD=GO111MODULE=on go + +linters-install: + @golangci-lint --version >/dev/null 2>&1 || { \ + echo "installing linting tools..."; \ + curl -sfL https://raw.githubusercontent.com/golangci/golangci-lint/master/install.sh| sh -s v1.41.1; \ + } + +lint: linters-install + golangci-lint run + +test: + $(GOCMD) test -cover -race ./... + +bench: + $(GOCMD) test -bench=. -benchmem ./... + +.PHONY: test lint linters-install \ No newline at end of file diff --git a/vendor/github.com/go-playground/universal-translator/README.md b/vendor/github.com/go-playground/universal-translator/README.md new file mode 100644 index 00000000..d9b66547 --- /dev/null +++ b/vendor/github.com/go-playground/universal-translator/README.md @@ -0,0 +1,87 @@ +## universal-translator +![Project status](https://img.shields.io/badge/version-0.18.1-green.svg) +[![Coverage Status](https://coveralls.io/repos/github/go-playground/universal-translator/badge.svg)](https://coveralls.io/github/go-playground/universal-translator) +[![Go Report Card](https://goreportcard.com/badge/github.com/go-playground/universal-translator)](https://goreportcard.com/report/github.com/go-playground/universal-translator) +[![GoDoc](https://godoc.org/github.com/go-playground/universal-translator?status.svg)](https://godoc.org/github.com/go-playground/universal-translator) +![License](https://img.shields.io/dub/l/vibe-d.svg) + +Universal Translator is an i18n Translator for Go/Golang using CLDR data + pluralization rules + +Why another i18n library? +-------------------------- +Because none of the plural rules seem to be correct out there, including the previous implementation of this package, +so I took it upon myself to create [locales](https://github.com/go-playground/locales) for everyone to use; this package +is a thin wrapper around [locales](https://github.com/go-playground/locales) in order to store and translate text for +use in your applications. + +Features +-------- +- [x] Rules generated from the [CLDR](http://cldr.unicode.org/index/downloads) data, v36.0.1 +- [x] Contains Cardinal, Ordinal and Range Plural Rules +- [x] Contains Month, Weekday and Timezone translations built in +- [x] Contains Date & Time formatting functions +- [x] Contains Number, Currency, Accounting and Percent formatting functions +- [x] Supports the "Gregorian" calendar only ( my time isn't unlimited, had to draw the line somewhere ) +- [x] Support loading translations from files +- [x] Exporting translations to file(s), mainly for getting them professionally translated +- [ ] Code Generation for translation files -> Go code.. i.e. after it has been professionally translated +- [ ] Tests for all languages, I need help with this, please see [here](https://github.com/go-playground/locales/issues/1) + +Installation +----------- + +Use go get + +```shell +go get github.com/go-playground/universal-translator +``` + +Usage & Documentation +------- + +Please see https://godoc.org/github.com/go-playground/universal-translator for usage docs + +##### Examples: + +- [Basic](https://github.com/go-playground/universal-translator/tree/master/_examples/basic) +- [Full - no files](https://github.com/go-playground/universal-translator/tree/master/_examples/full-no-files) +- [Full - with files](https://github.com/go-playground/universal-translator/tree/master/_examples/full-with-files) + +File formatting +-------------- +All types, Plain substitution, Cardinal, Ordinal and Range translations can all be contained within the same file(s); +they are only separated for easy viewing. + +##### Examples: + +- [Formats](https://github.com/go-playground/universal-translator/tree/master/_examples/file-formats) + +##### Basic Makeup +NOTE: not all fields are needed for all translation types, see [examples](https://github.com/go-playground/universal-translator/tree/master/_examples/file-formats) +```json +{ + "locale": "en", + "key": "days-left", + "trans": "You have {0} day left.", + "type": "Cardinal", + "rule": "One", + "override": false +} +``` +|Field|Description| +|---|---| +|locale|The locale for which the translation is for.| +|key|The translation key that will be used to store and lookup each translation; normally it is a string or integer.| +|trans|The actual translation text.| +|type|The type of translation Cardinal, Ordinal, Range or "" for a plain substitution(not required to be defined if plain used)| +|rule|The plural rule for which the translation is for eg. One, Two, Few, Many or Other.(not required to be defined if plain used)| +|override|If you wish to override an existing translation that has already been registered, set this to 'true'. 99% of the time there is no need to define it.| + +Help With Tests +--------------- +To anyone interesting in helping or contributing, I sure could use some help creating tests for each language. +Please see issue [here](https://github.com/go-playground/locales/issues/1) for details. + +License +------ +Distributed under MIT License, please see license file in code for more details. diff --git a/vendor/github.com/go-playground/universal-translator/errors.go b/vendor/github.com/go-playground/universal-translator/errors.go new file mode 100644 index 00000000..38b163b6 --- /dev/null +++ b/vendor/github.com/go-playground/universal-translator/errors.go @@ -0,0 +1,148 @@ +package ut + +import ( + "errors" + "fmt" + + "github.com/go-playground/locales" +) + +var ( + // ErrUnknowTranslation indicates the translation could not be found + ErrUnknowTranslation = errors.New("Unknown Translation") +) + +var _ error = new(ErrConflictingTranslation) +var _ error = new(ErrRangeTranslation) +var _ error = new(ErrOrdinalTranslation) +var _ error = new(ErrCardinalTranslation) +var _ error = new(ErrMissingPluralTranslation) +var _ error = new(ErrExistingTranslator) + +// ErrExistingTranslator is the error representing a conflicting translator +type ErrExistingTranslator struct { + locale string +} + +// Error returns ErrExistingTranslator's internal error text +func (e *ErrExistingTranslator) Error() string { + return fmt.Sprintf("error: conflicting translator for locale '%s'", e.locale) +} + +// ErrConflictingTranslation is the error representing a conflicting translation +type ErrConflictingTranslation struct { + locale string + key interface{} + rule locales.PluralRule + text string +} + +// Error returns ErrConflictingTranslation's internal error text +func (e *ErrConflictingTranslation) Error() string { + + if _, ok := e.key.(string); !ok { + return fmt.Sprintf("error: conflicting key '%#v' rule '%s' with text '%s' for locale '%s', value being ignored", e.key, e.rule, e.text, e.locale) + } + + return fmt.Sprintf("error: conflicting key '%s' rule '%s' with text '%s' for locale '%s', value being ignored", e.key, e.rule, e.text, e.locale) +} + +// ErrRangeTranslation is the error representing a range translation error +type ErrRangeTranslation struct { + text string +} + +// Error returns ErrRangeTranslation's internal error text +func (e *ErrRangeTranslation) Error() string { + return e.text +} + +// ErrOrdinalTranslation is the error representing an ordinal translation error +type ErrOrdinalTranslation struct { + text string +} + +// Error returns ErrOrdinalTranslation's internal error text +func (e *ErrOrdinalTranslation) Error() string { + return e.text +} + +// ErrCardinalTranslation is the error representing a cardinal translation error +type ErrCardinalTranslation struct { + text string +} + +// Error returns ErrCardinalTranslation's internal error text +func (e *ErrCardinalTranslation) Error() string { + return e.text +} + +// ErrMissingPluralTranslation is the error signifying a missing translation given +// the locales plural rules. +type ErrMissingPluralTranslation struct { + locale string + key interface{} + rule locales.PluralRule + translationType string +} + +// Error returns ErrMissingPluralTranslation's internal error text +func (e *ErrMissingPluralTranslation) Error() string { + + if _, ok := e.key.(string); !ok { + return fmt.Sprintf("error: missing '%s' plural rule '%s' for translation with key '%#v' and locale '%s'", e.translationType, e.rule, e.key, e.locale) + } + + return fmt.Sprintf("error: missing '%s' plural rule '%s' for translation with key '%s' and locale '%s'", e.translationType, e.rule, e.key, e.locale) +} + +// ErrMissingBracket is the error representing a missing bracket in a translation +// eg. This is a {0 <-- missing ending '}' +type ErrMissingBracket struct { + locale string + key interface{} + text string +} + +// Error returns ErrMissingBracket error message +func (e *ErrMissingBracket) Error() string { + return fmt.Sprintf("error: missing bracket '{}', in translation. locale: '%s' key: '%v' text: '%s'", e.locale, e.key, e.text) +} + +// ErrBadParamSyntax is the error representing a bad parameter definition in a translation +// eg. This is a {must-be-int} +type ErrBadParamSyntax struct { + locale string + param string + key interface{} + text string +} + +// Error returns ErrBadParamSyntax error message +func (e *ErrBadParamSyntax) Error() string { + return fmt.Sprintf("error: bad parameter syntax, missing parameter '%s' in translation. locale: '%s' key: '%v' text: '%s'", e.param, e.locale, e.key, e.text) +} + +// import/export errors + +// ErrMissingLocale is the error representing an expected locale that could +// not be found aka locale not registered with the UniversalTranslator Instance +type ErrMissingLocale struct { + locale string +} + +// Error returns ErrMissingLocale's internal error text +func (e *ErrMissingLocale) Error() string { + return fmt.Sprintf("error: locale '%s' not registered.", e.locale) +} + +// ErrBadPluralDefinition is the error representing an incorrect plural definition +// usually found within translations defined within files during the import process. +type ErrBadPluralDefinition struct { + tl translation +} + +// Error returns ErrBadPluralDefinition's internal error text +func (e *ErrBadPluralDefinition) Error() string { + return fmt.Sprintf("error: bad plural definition '%#v'", e.tl) +} diff --git a/vendor/github.com/go-playground/universal-translator/import_export.go b/vendor/github.com/go-playground/universal-translator/import_export.go new file mode 100644 index 00000000..87a1b465 --- /dev/null +++ b/vendor/github.com/go-playground/universal-translator/import_export.go @@ -0,0 +1,274 @@ +package ut + +import ( + "encoding/json" + "fmt" + "os" + "path/filepath" + + "io" + + "github.com/go-playground/locales" +) + +type translation struct { + Locale string `json:"locale"` + Key interface{} `json:"key"` // either string or integer + Translation string `json:"trans"` + PluralType string `json:"type,omitempty"` + PluralRule string `json:"rule,omitempty"` + OverrideExisting bool `json:"override,omitempty"` +} + +const ( + cardinalType = "Cardinal" + ordinalType = "Ordinal" + rangeType = "Range" +) + +// ImportExportFormat is the format of the file import or export +type ImportExportFormat uint8 + +// supported Export Formats +const ( + FormatJSON ImportExportFormat = iota +) + +// Export writes the translations out to a file on disk. +// +// NOTE: this currently only works with string or int translations keys. +func (t *UniversalTranslator) Export(format ImportExportFormat, dirname string) error { + + _, err := os.Stat(dirname) + if err != nil { + + if !os.IsNotExist(err) { + return err + } + + if err = os.MkdirAll(dirname, 0744); err != nil { + return err + } + } + + // build up translations + var trans []translation + var b []byte + var ext string + + for _, locale := range t.translators { + + for k, v := range locale.(*translator).translations { + trans = append(trans, translation{ + Locale: locale.Locale(), + Key: k, + Translation: v.text, + }) + } + + for k, pluralTrans := range locale.(*translator).cardinalTanslations { + + for i, plural := range pluralTrans { + + // leave enough for all plural rules + // but not all are set for all languages. + if plural == nil { + continue + } + + trans = append(trans, translation{ + Locale: locale.Locale(), + Key: k.(string), + Translation: plural.text, + PluralType: cardinalType, + PluralRule: locales.PluralRule(i).String(), + }) + } + } + + for k, pluralTrans := range locale.(*translator).ordinalTanslations { + + for i, plural := range pluralTrans { + + // leave enough for all plural rules + // but not all are set for all languages. + if plural == nil { + continue + } + + trans = append(trans, translation{ + Locale: locale.Locale(), + Key: k.(string), + Translation: plural.text, + PluralType: ordinalType, + PluralRule: locales.PluralRule(i).String(), + }) + } + } + + for k, pluralTrans := range locale.(*translator).rangeTanslations { + + for i, plural := range pluralTrans { + + // leave enough for all plural rules + // but not all are set for all languages. + if plural == nil { + continue + } + + trans = append(trans, translation{ + Locale: locale.Locale(), + Key: k.(string), + Translation: plural.text, + PluralType: rangeType, + PluralRule: locales.PluralRule(i).String(), + }) + } + } + + switch format { + case FormatJSON: + b, err = json.MarshalIndent(trans, "", " ") + ext = ".json" + } + + if err != nil { + return err + } + + err = os.WriteFile(filepath.Join(dirname, fmt.Sprintf("%s%s", locale.Locale(), ext)), b, 0644) + if err != nil { + return err + } + + trans = trans[0:0] + } + + return nil +} + +// Import reads the translations out of a file or directory on disk. +// +// NOTE: this currently only works with string or int translations keys. +func (t *UniversalTranslator) Import(format ImportExportFormat, dirnameOrFilename string) error { + + fi, err := os.Stat(dirnameOrFilename) + if err != nil { + return err + } + + processFn := func(filename string) error { + + f, err := os.Open(filename) + if err != nil { + return err + } + defer f.Close() + + return t.ImportByReader(format, f) + } + + if !fi.IsDir() { + return processFn(dirnameOrFilename) + } + + // recursively go through directory + walker := func(path string, info os.FileInfo, err error) error { + + if info.IsDir() { + return nil + } + + switch format { + case FormatJSON: + // skip non JSON files + if filepath.Ext(info.Name()) != ".json" { + return nil + } + } + + return processFn(path) + } + + return filepath.Walk(dirnameOrFilename, walker) +} + +// ImportByReader imports the the translations found within the contents read from the supplied reader. +// +// NOTE: generally used when assets have been embedded into the binary and are already in memory. +func (t *UniversalTranslator) ImportByReader(format ImportExportFormat, reader io.Reader) error { + + b, err := io.ReadAll(reader) + if err != nil { + return err + } + + var trans []translation + + switch format { + case FormatJSON: + err = json.Unmarshal(b, &trans) + } + + if err != nil { + return err + } + + for _, tl := range trans { + + locale, found := t.FindTranslator(tl.Locale) + if !found { + return &ErrMissingLocale{locale: tl.Locale} + } + + pr := stringToPR(tl.PluralRule) + + if pr == locales.PluralRuleUnknown { + + err = locale.Add(tl.Key, tl.Translation, tl.OverrideExisting) + if err != nil { + return err + } + + continue + } + + switch tl.PluralType { + case cardinalType: + err = locale.AddCardinal(tl.Key, tl.Translation, pr, tl.OverrideExisting) + case ordinalType: + err = locale.AddOrdinal(tl.Key, tl.Translation, pr, tl.OverrideExisting) + case rangeType: + err = locale.AddRange(tl.Key, tl.Translation, pr, tl.OverrideExisting) + default: + return &ErrBadPluralDefinition{tl: tl} + } + + if err != nil { + return err + } + } + + return nil +} + +func stringToPR(s string) locales.PluralRule { + + switch s { + case "Zero": + return locales.PluralRuleZero + case "One": + return locales.PluralRuleOne + case "Two": + return locales.PluralRuleTwo + case "Few": + return locales.PluralRuleFew + case "Many": + return locales.PluralRuleMany + case "Other": + return locales.PluralRuleOther + default: + return locales.PluralRuleUnknown + } + +} diff --git a/vendor/github.com/go-playground/universal-translator/logo.png b/vendor/github.com/go-playground/universal-translator/logo.png new file mode 100644 index 00000000..a37aa8c0 Binary files /dev/null and b/vendor/github.com/go-playground/universal-translator/logo.png differ diff --git a/vendor/github.com/go-playground/universal-translator/translator.go b/vendor/github.com/go-playground/universal-translator/translator.go new file mode 100644 index 00000000..24b18db9 --- /dev/null +++ b/vendor/github.com/go-playground/universal-translator/translator.go @@ -0,0 +1,420 @@ +package ut + +import ( + "fmt" + "strconv" + "strings" + + "github.com/go-playground/locales" +) + +const ( + paramZero = "{0}" + paramOne = "{1}" + unknownTranslation = "" +) + +// Translator is universal translators +// translator instance which is a thin wrapper +// around locales.Translator instance providing +// some extra functionality +type Translator interface { + locales.Translator + + // adds a normal translation for a particular language/locale + // {#} is the only replacement type accepted and are ad infinitum + // eg. one: '{0} day left' other: '{0} days left' + Add(key interface{}, text string, override bool) error + + // adds a cardinal plural translation for a particular language/locale + // {0} is the only replacement type accepted and only one variable is accepted as + // multiple cannot be used for a plural rule determination, unless it is a range; + // see AddRange below. + // eg. in locale 'en' one: '{0} day left' other: '{0} days left' + AddCardinal(key interface{}, text string, rule locales.PluralRule, override bool) error + + // adds an ordinal plural translation for a particular language/locale + // {0} is the only replacement type accepted and only one variable is accepted as + // multiple cannot be used for a plural rule determination, unless it is a range; + // see AddRange below. + // eg. in locale 'en' one: '{0}st day of spring' other: '{0}nd day of spring' + // - 1st, 2nd, 3rd... + AddOrdinal(key interface{}, text string, rule locales.PluralRule, override bool) error + + // adds a range plural translation for a particular language/locale + // {0} and {1} are the only replacement types accepted and only these are accepted. + // eg. in locale 'nl' one: '{0}-{1} day left' other: '{0}-{1} days left' + AddRange(key interface{}, text string, rule locales.PluralRule, override bool) error + + // creates the translation for the locale given the 'key' and params passed in + T(key interface{}, params ...string) (string, error) + + // creates the cardinal translation for the locale given the 'key', 'num' and 'digit' arguments + // and param passed in + C(key interface{}, num float64, digits uint64, param string) (string, error) + + // creates the ordinal translation for the locale given the 'key', 'num' and 'digit' arguments + // and param passed in + O(key interface{}, num float64, digits uint64, param string) (string, error) + + // creates the range translation for the locale given the 'key', 'num1', 'digit1', 'num2' and + // 'digit2' arguments and 'param1' and 'param2' passed in + R(key interface{}, num1 float64, digits1 uint64, num2 float64, digits2 uint64, param1, param2 string) (string, error) + + // VerifyTranslations checks to ensures that no plural rules have been + // missed within the translations. + VerifyTranslations() error +} + +var _ Translator = new(translator) +var _ locales.Translator = new(translator) + +type translator struct { + locales.Translator + translations map[interface{}]*transText + cardinalTanslations map[interface{}][]*transText // array index is mapped to locales.PluralRule index + the locales.PluralRuleUnknown + ordinalTanslations map[interface{}][]*transText + rangeTanslations map[interface{}][]*transText +} + +type transText struct { + text string + indexes []int +} + +func newTranslator(trans locales.Translator) Translator { + return &translator{ + Translator: trans, + translations: make(map[interface{}]*transText), // translation text broken up by byte index + cardinalTanslations: make(map[interface{}][]*transText), + ordinalTanslations: make(map[interface{}][]*transText), + rangeTanslations: make(map[interface{}][]*transText), + } +} + +// Add adds a normal translation for a particular language/locale +// {#} is the only replacement type accepted and are ad infinitum +// eg. one: '{0} day left' other: '{0} days left' +func (t *translator) Add(key interface{}, text string, override bool) error { + + if _, ok := t.translations[key]; ok && !override { + return &ErrConflictingTranslation{locale: t.Locale(), key: key, text: text} + } + + lb := strings.Count(text, "{") + rb := strings.Count(text, "}") + + if lb != rb { + return &ErrMissingBracket{locale: t.Locale(), key: key, text: text} + } + + trans := &transText{ + text: text, + } + + var idx int + + for i := 0; i < lb; i++ { + s := "{" + strconv.Itoa(i) + "}" + idx = strings.Index(text, s) + if idx == -1 { + return &ErrBadParamSyntax{locale: t.Locale(), param: s, key: key, text: text} + } + + trans.indexes = append(trans.indexes, idx) + trans.indexes = append(trans.indexes, idx+len(s)) + } + + t.translations[key] = trans + + return nil +} + +// AddCardinal adds a cardinal plural translation for a particular language/locale +// {0} is the only replacement type accepted and only one variable is accepted as +// multiple cannot be used for a plural rule determination, unless it is a range; +// see AddRange below. +// eg. in locale 'en' one: '{0} day left' other: '{0} days left' +func (t *translator) AddCardinal(key interface{}, text string, rule locales.PluralRule, override bool) error { + + var verified bool + + // verify plural rule exists for locale + for _, pr := range t.PluralsCardinal() { + if pr == rule { + verified = true + break + } + } + + if !verified { + return &ErrCardinalTranslation{text: fmt.Sprintf("error: cardinal plural rule '%s' does not exist for locale '%s' key: '%v' text: '%s'", rule, t.Locale(), key, text)} + } + + tarr, ok := t.cardinalTanslations[key] + if ok { + // verify not adding a conflicting record + if len(tarr) > 0 && tarr[rule] != nil && !override { + return &ErrConflictingTranslation{locale: t.Locale(), key: key, rule: rule, text: text} + } + + } else { + tarr = make([]*transText, 7) + t.cardinalTanslations[key] = tarr + } + + trans := &transText{ + text: text, + indexes: make([]int, 2), + } + + tarr[rule] = trans + + idx := strings.Index(text, paramZero) + if idx == -1 { + tarr[rule] = nil + return &ErrCardinalTranslation{text: fmt.Sprintf("error: parameter '%s' not found, may want to use 'Add' instead of 'AddCardinal'. locale: '%s' key: '%v' text: '%s'", paramZero, t.Locale(), key, text)} + } + + trans.indexes[0] = idx + trans.indexes[1] = idx + len(paramZero) + + return nil +} + +// AddOrdinal adds an ordinal plural translation for a particular language/locale +// {0} is the only replacement type accepted and only one variable is accepted as +// multiple cannot be used for a plural rule determination, unless it is a range; +// see AddRange below. +// eg. in locale 'en' one: '{0}st day of spring' other: '{0}nd day of spring' - 1st, 2nd, 3rd... +func (t *translator) AddOrdinal(key interface{}, text string, rule locales.PluralRule, override bool) error { + + var verified bool + + // verify plural rule exists for locale + for _, pr := range t.PluralsOrdinal() { + if pr == rule { + verified = true + break + } + } + + if !verified { + return &ErrOrdinalTranslation{text: fmt.Sprintf("error: ordinal plural rule '%s' does not exist for locale '%s' key: '%v' text: '%s'", rule, t.Locale(), key, text)} + } + + tarr, ok := t.ordinalTanslations[key] + if ok { + // verify not adding a conflicting record + if len(tarr) > 0 && tarr[rule] != nil && !override { + return &ErrConflictingTranslation{locale: t.Locale(), key: key, rule: rule, text: text} + } + + } else { + tarr = make([]*transText, 7) + t.ordinalTanslations[key] = tarr + } + + trans := &transText{ + text: text, + indexes: make([]int, 2), + } + + tarr[rule] = trans + + idx := strings.Index(text, paramZero) + if idx == -1 { + tarr[rule] = nil + return &ErrOrdinalTranslation{text: fmt.Sprintf("error: parameter '%s' not found, may want to use 'Add' instead of 'AddOrdinal'. locale: '%s' key: '%v' text: '%s'", paramZero, t.Locale(), key, text)} + } + + trans.indexes[0] = idx + trans.indexes[1] = idx + len(paramZero) + + return nil +} + +// AddRange adds a range plural translation for a particular language/locale +// {0} and {1} are the only replacement types accepted and only these are accepted. +// eg. in locale 'nl' one: '{0}-{1} day left' other: '{0}-{1} days left' +func (t *translator) AddRange(key interface{}, text string, rule locales.PluralRule, override bool) error { + + var verified bool + + // verify plural rule exists for locale + for _, pr := range t.PluralsRange() { + if pr == rule { + verified = true + break + } + } + + if !verified { + return &ErrRangeTranslation{text: fmt.Sprintf("error: range plural rule '%s' does not exist for locale '%s' key: '%v' text: '%s'", rule, t.Locale(), key, text)} + } + + tarr, ok := t.rangeTanslations[key] + if ok { + // verify not adding a conflicting record + if len(tarr) > 0 && tarr[rule] != nil && !override { + return &ErrConflictingTranslation{locale: t.Locale(), key: key, rule: rule, text: text} + } + + } else { + tarr = make([]*transText, 7) + t.rangeTanslations[key] = tarr + } + + trans := &transText{ + text: text, + indexes: make([]int, 4), + } + + tarr[rule] = trans + + idx := strings.Index(text, paramZero) + if idx == -1 { + tarr[rule] = nil + return &ErrRangeTranslation{text: fmt.Sprintf("error: parameter '%s' not found, are you sure you're adding a Range Translation? locale: '%s' key: '%v' text: '%s'", paramZero, t.Locale(), key, text)} + } + + trans.indexes[0] = idx + trans.indexes[1] = idx + len(paramZero) + + idx = strings.Index(text, paramOne) + if idx == -1 { + tarr[rule] = nil + return &ErrRangeTranslation{text: fmt.Sprintf("error: parameter '%s' not found, a Range Translation requires two parameters. locale: '%s' key: '%v' text: '%s'", paramOne, t.Locale(), key, text)} + } + + trans.indexes[2] = idx + trans.indexes[3] = idx + len(paramOne) + + return nil +} + +// T creates the translation for the locale given the 'key' and params passed in +func (t *translator) T(key interface{}, params ...string) (string, error) { + + trans, ok := t.translations[key] + if !ok { + return unknownTranslation, ErrUnknowTranslation + } + + b := make([]byte, 0, 64) + + var start, end, count int + + for i := 0; i < len(trans.indexes); i++ { + end = trans.indexes[i] + b = append(b, trans.text[start:end]...) + b = append(b, params[count]...) + i++ + start = trans.indexes[i] + count++ + } + + b = append(b, trans.text[start:]...) + + return string(b), nil +} + +// C creates the cardinal translation for the locale given the 'key', 'num' and 'digit' arguments and param passed in +func (t *translator) C(key interface{}, num float64, digits uint64, param string) (string, error) { + + tarr, ok := t.cardinalTanslations[key] + if !ok { + return unknownTranslation, ErrUnknowTranslation + } + + rule := t.CardinalPluralRule(num, digits) + + trans := tarr[rule] + + b := make([]byte, 0, 64) + b = append(b, trans.text[:trans.indexes[0]]...) + b = append(b, param...) + b = append(b, trans.text[trans.indexes[1]:]...) + + return string(b), nil +} + +// O creates the ordinal translation for the locale given the 'key', 'num' and 'digit' arguments and param passed in +func (t *translator) O(key interface{}, num float64, digits uint64, param string) (string, error) { + + tarr, ok := t.ordinalTanslations[key] + if !ok { + return unknownTranslation, ErrUnknowTranslation + } + + rule := t.OrdinalPluralRule(num, digits) + + trans := tarr[rule] + + b := make([]byte, 0, 64) + b = append(b, trans.text[:trans.indexes[0]]...) + b = append(b, param...) + b = append(b, trans.text[trans.indexes[1]:]...) + + return string(b), nil +} + +// R creates the range translation for the locale given the 'key', 'num1', 'digit1', 'num2' and 'digit2' arguments +// and 'param1' and 'param2' passed in +func (t *translator) R(key interface{}, num1 float64, digits1 uint64, num2 float64, digits2 uint64, param1, param2 string) (string, error) { + + tarr, ok := t.rangeTanslations[key] + if !ok { + return unknownTranslation, ErrUnknowTranslation + } + + rule := t.RangePluralRule(num1, digits1, num2, digits2) + + trans := tarr[rule] + + b := make([]byte, 0, 64) + b = append(b, trans.text[:trans.indexes[0]]...) + b = append(b, param1...) + b = append(b, trans.text[trans.indexes[1]:trans.indexes[2]]...) + b = append(b, param2...) + b = append(b, trans.text[trans.indexes[3]:]...) + + return string(b), nil +} + +// VerifyTranslations checks to ensures that no plural rules have been +// missed within the translations. +func (t *translator) VerifyTranslations() error { + + for k, v := range t.cardinalTanslations { + + for _, rule := range t.PluralsCardinal() { + + if v[rule] == nil { + return &ErrMissingPluralTranslation{locale: t.Locale(), translationType: "plural", rule: rule, key: k} + } + } + } + + for k, v := range t.ordinalTanslations { + + for _, rule := range t.PluralsOrdinal() { + + if v[rule] == nil { + return &ErrMissingPluralTranslation{locale: t.Locale(), translationType: "ordinal", rule: rule, key: k} + } + } + } + + for k, v := range t.rangeTanslations { + + for _, rule := range t.PluralsRange() { + + if v[rule] == nil { + return &ErrMissingPluralTranslation{locale: t.Locale(), translationType: "range", rule: rule, key: k} + } + } + } + + return nil +} diff --git a/vendor/github.com/go-playground/universal-translator/universal_translator.go b/vendor/github.com/go-playground/universal-translator/universal_translator.go new file mode 100644 index 00000000..dbf707f5 --- /dev/null +++ b/vendor/github.com/go-playground/universal-translator/universal_translator.go @@ -0,0 +1,113 @@ +package ut + +import ( + "strings" + + "github.com/go-playground/locales" +) + +// UniversalTranslator holds all locale & translation data +type UniversalTranslator struct { + translators map[string]Translator + fallback Translator +} + +// New returns a new UniversalTranslator instance set with +// the fallback locale and locales it should support +func New(fallback locales.Translator, supportedLocales ...locales.Translator) *UniversalTranslator { + + t := &UniversalTranslator{ + translators: make(map[string]Translator), + } + + for _, v := range supportedLocales { + + trans := newTranslator(v) + t.translators[strings.ToLower(trans.Locale())] = trans + + if fallback.Locale() == v.Locale() { + t.fallback = trans + } + } + + if t.fallback == nil && fallback != nil { + t.fallback = newTranslator(fallback) + } + + return t +} + +// FindTranslator trys to find a Translator based on an array of locales +// and returns the first one it can find, otherwise returns the +// fallback translator. +func (t *UniversalTranslator) FindTranslator(locales ...string) (trans Translator, found bool) { + + for _, locale := range locales { + + if trans, found = t.translators[strings.ToLower(locale)]; found { + return + } + } + + return t.fallback, false +} + +// GetTranslator returns the specified translator for the given locale, +// or fallback if not found +func (t *UniversalTranslator) GetTranslator(locale string) (trans Translator, found bool) { + + if trans, found = t.translators[strings.ToLower(locale)]; found { + return + } + + return t.fallback, false +} + +// GetFallback returns the fallback locale +func (t *UniversalTranslator) GetFallback() Translator { + return t.fallback +} + +// AddTranslator adds the supplied translator, if it already exists the override param +// will be checked and if false an error will be returned, otherwise the translator will be +// overridden; if the fallback matches the supplied translator it will be overridden as well +// NOTE: this is normally only used when translator is embedded within a library +func (t *UniversalTranslator) AddTranslator(translator locales.Translator, override bool) error { + + lc := strings.ToLower(translator.Locale()) + _, ok := t.translators[lc] + if ok && !override { + return &ErrExistingTranslator{locale: translator.Locale()} + } + + trans := newTranslator(translator) + + if t.fallback.Locale() == translator.Locale() { + + // because it's optional to have a fallback, I don't impose that limitation + // don't know why you wouldn't but... + if !override { + return &ErrExistingTranslator{locale: translator.Locale()} + } + + t.fallback = trans + } + + t.translators[lc] = trans + + return nil +} + +// VerifyTranslations runs through all locales and identifies any issues +// eg. missing plural rules for a locale +func (t *UniversalTranslator) VerifyTranslations() (err error) { + + for _, trans := range t.translators { + err = trans.VerifyTranslations() + if err != nil { + return + } + } + + return +} diff --git a/vendor/github.com/go-playground/validator/v10/.gitignore b/vendor/github.com/go-playground/validator/v10/.gitignore new file mode 100644 index 00000000..6305e529 --- /dev/null +++ b/vendor/github.com/go-playground/validator/v10/.gitignore @@ -0,0 +1,32 @@ +# Compiled Object files, Static and Dynamic libs (Shared Objects) +*.o +*.a +*.so + +# Folders +_obj +_test +bin + +# Architecture specific extensions/prefixes +*.[568vq] +[568vq].out + +*.cgo1.go +*.cgo2.c +_cgo_defun.c +_cgo_gotypes.go +_cgo_export.* + +_testmain.go + +*.exe +*.test +*.prof +*.test +*.out +*.txt +/**/*.DS_Store +cover.html +README.html +.idea diff --git a/vendor/github.com/go-playground/validator/v10/.golangci.yaml b/vendor/github.com/go-playground/validator/v10/.golangci.yaml new file mode 100644 index 00000000..dd9c05cc --- /dev/null +++ b/vendor/github.com/go-playground/validator/v10/.golangci.yaml @@ -0,0 +1,54 @@ +version: "2" +linters: + default: all + disable: + - noinlineerr + - wsl_v5 + - copyloopvar + - cyclop + - depguard + - dogsled + - dupl + - dupword + - err113 + - errorlint + - exhaustive + - exhaustruct + - forbidigo + - forcetypeassert + - funlen + - gochecknoglobals + - gocognit + - goconst + - gocritic + - gocyclo + - godot + - gosec + - gosmopolitan + - interfacebloat + - intrange + - ireturn + - lll + - maintidx + - misspell + - mnd + - nakedret + - nestif + - nilnil + - nlreturn + - nonamedreturns + - paralleltest + - perfsprint + - prealloc + - recvcheck + - revive + - staticcheck + - tagalign + - tagliatelle + - testpackage + - thelper + - tparallel + - unparam + - varnamelen + - wrapcheck + - wsl diff --git a/vendor/github.com/go-playground/validator/v10/LICENSE b/vendor/github.com/go-playground/validator/v10/LICENSE new file mode 100644 index 00000000..6a2ae9aa --- /dev/null +++ b/vendor/github.com/go-playground/validator/v10/LICENSE @@ -0,0 +1,22 @@ +The MIT License (MIT) + +Copyright (c) 2015 Dean Karn + +Permission is hereby granted, free of charge, to any person obtaining a copy +of this software and associated documentation files (the "Software"), to deal +in the Software without restriction, including without limitation the rights +to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +copies of the Software, and to permit persons to whom the Software is +furnished to do so, subject to the following conditions: + +The above copyright notice and this permission notice shall be included in all +copies or substantial portions of the Software. + +THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE +SOFTWARE. + diff --git a/vendor/github.com/go-playground/validator/v10/MAINTAINERS.md b/vendor/github.com/go-playground/validator/v10/MAINTAINERS.md new file mode 100644 index 00000000..b809c4ce --- /dev/null +++ b/vendor/github.com/go-playground/validator/v10/MAINTAINERS.md @@ -0,0 +1,16 @@ +## Maintainers Guide + +### Semantic Versioning +Semantic versioning as defined [here](https://semver.org) must be strictly adhered to. + +### External Dependencies +Any new external dependencies MUST: +- Have a compatible LICENSE present. +- Be actively maintained. +- Be approved by @go-playground/admins + +### PR Merge Requirements +- Up-to-date branch. +- Passing tests and linting. +- CODEOWNERS approval. +- Tests that cover both the Happy and Unhappy paths. \ No newline at end of file diff --git a/vendor/github.com/go-playground/validator/v10/Makefile b/vendor/github.com/go-playground/validator/v10/Makefile new file mode 100644 index 00000000..e7caab7f --- /dev/null +++ b/vendor/github.com/go-playground/validator/v10/Makefile @@ -0,0 +1,18 @@ +GOCMD=go + +linters-install: + @golangci-lint --version >/dev/null 2>&1 || { \ + echo "installing linting tools..."; \ + curl -sfL https://raw.githubusercontent.com/golangci/golangci-lint/master/install.sh| sh -s v2.0.2; \ + } + +lint: linters-install + golangci-lint run + +test: + $(GOCMD) test -cover -race ./... + +bench: + $(GOCMD) test -run=NONE -bench=. -benchmem ./... + +.PHONY: test lint linters-install diff --git a/vendor/github.com/go-playground/validator/v10/README.md b/vendor/github.com/go-playground/validator/v10/README.md new file mode 100644 index 00000000..28f7e159 --- /dev/null +++ b/vendor/github.com/go-playground/validator/v10/README.md @@ -0,0 +1,381 @@ +Package validator +================= +[![GitHub release (latest SemVer)](https://img.shields.io/github/v/release/go-playground/validator)](https://github.com/go-playground/validator/releases) +[![Build Status](https://github.com/go-playground/validator/actions/workflows/workflow.yml/badge.svg)](https://github.com/go-playground/validator/actions) +[![Coverage Status](https://coveralls.io/repos/go-playground/validator/badge.svg?branch=master&service=github)](https://coveralls.io/github/go-playground/validator?branch=master) +[![Go Report Card](https://goreportcard.com/badge/github.com/go-playground/validator)](https://goreportcard.com/report/github.com/go-playground/validator) +[![GoDoc](https://godoc.org/github.com/go-playground/validator?status.svg)](https://pkg.go.dev/github.com/go-playground/validator/v10) +![License](https://img.shields.io/dub/l/vibe-d.svg) + +Package validator implements value validations for structs and individual fields based on tags. + +It has the following **unique** features: + +- Cross Field and Cross Struct validations by using validation tags or custom validators. +- Slice, Array and Map diving, which allows any or all levels of a multidimensional field to be validated. +- Ability to dive into both map keys and values for validation +- Handles type interface by determining it's underlying type prior to validation. +- Handles custom field types such as sql driver Valuer see [Valuer](https://golang.org/src/database/sql/driver/types.go?s=1210:1293#L29) +- Alias validation tags, which allows for mapping of several validations to a single tag for easier defining of validations on structs +- Extraction of custom defined Field Name e.g. can specify to extract the JSON name while validating and have it available in the resulting FieldError +- Customizable i18n aware error messages. +- Default validator for the [gin](https://github.com/gin-gonic/gin) web framework; upgrading from v8 to v9 in gin see [here](https://github.com/go-playground/validator/tree/master/_examples/gin-upgrading-overriding) + +A Call for Maintainers +---------------------- + +Please read the discussiong started [here](https://github.com/go-playground/validator/discussions/1330) if you are interested in contributing/helping maintain this package. + +Installation +------------ + +Use go get. + + go get github.com/go-playground/validator/v10 + +Then import the validator package into your own code. + + import "github.com/go-playground/validator/v10" + +Error Return Value +------- + +Validation functions return type error + +They return type error to avoid the issue discussed in the following, where err is always != nil: + +* http://stackoverflow.com/a/29138676/3158232 +* https://github.com/go-playground/validator/issues/134 + +Validator returns only InvalidValidationError for bad validation input, nil or ValidationErrors as type error; so, in your code all you need to do is check if the error returned is not nil, and if it's not check if error is InvalidValidationError ( if necessary, most of the time it isn't ) type cast it to type ValidationErrors like so: + +```go +err := validate.Struct(mystruct) +validationErrors := err.(validator.ValidationErrors) + ``` + +Usage and documentation +------ + +Please see https://pkg.go.dev/github.com/go-playground/validator/v10 for detailed usage docs. + +##### Examples: + +- [Simple](https://github.com/go-playground/validator/blob/master/_examples/simple/main.go) +- [Custom Field Types](https://github.com/go-playground/validator/blob/master/_examples/custom/main.go) +- [Struct Level](https://github.com/go-playground/validator/blob/master/_examples/struct-level/main.go) +- [Translations & Custom Errors](https://github.com/go-playground/validator/blob/master/_examples/translations/main.go) +- [Gin upgrade and/or override validator](https://github.com/go-playground/validator/tree/v9/_examples/gin-upgrading-overriding) +- [wash - an example application putting it all together](https://github.com/bluesuncorp/wash) + +Baked-in Validations +------ + +### Special Notes: +- If new to using validator it is highly recommended to initialize it using the `WithRequiredStructEnabled` option which is opt-in to new behaviour that will become the default behaviour in v11+. See documentation for more details. +```go +validate := validator.New(validator.WithRequiredStructEnabled()) +``` + +### Fields: + +| Tag | Description | +| - | - | +| eqcsfield | Field Equals Another Field (relative)| +| eqfield | Field Equals Another Field | +| fieldcontains | Check the indicated characters are present in the Field | +| fieldexcludes | Check the indicated characters are not present in the field | +| gtcsfield | Field Greater Than Another Relative Field | +| gtecsfield | Field Greater Than or Equal To Another Relative Field | +| gtefield | Field Greater Than or Equal To Another Field | +| gtfield | Field Greater Than Another Field | +| ltcsfield | Less Than Another Relative Field | +| ltecsfield | Less Than or Equal To Another Relative Field | +| ltefield | Less Than or Equal To Another Field | +| ltfield | Less Than Another Field | +| necsfield | Field Does Not Equal Another Field (relative) | +| nefield | Field Does Not Equal Another Field | + +### Network: + +| Tag | Description | +| - | - | +| cidr | Classless Inter-Domain Routing CIDR | +| cidrv4 | Classless Inter-Domain Routing CIDRv4 | +| cidrv6 | Classless Inter-Domain Routing CIDRv6 | +| datauri | Data URL | +| fqdn | Full Qualified Domain Name (FQDN) | +| hostname | Hostname RFC 952 | +| hostname_port | HostPort | +| hostname_rfc1123 | Hostname RFC 1123 | +| ip | Internet Protocol Address IP | +| ip4_addr | Internet Protocol Address IPv4 | +| ip6_addr | Internet Protocol Address IPv6 | +| ip_addr | Internet Protocol Address IP | +| ipv4 | Internet Protocol Address IPv4 | +| ipv6 | Internet Protocol Address IPv6 | +| mac | Media Access Control Address MAC | +| tcp4_addr | Transmission Control Protocol Address TCPv4 | +| tcp6_addr | Transmission Control Protocol Address TCPv6 | +| tcp_addr | Transmission Control Protocol Address TCP | +| udp4_addr | User Datagram Protocol Address UDPv4 | +| udp6_addr | User Datagram Protocol Address UDPv6 | +| udp_addr | User Datagram Protocol Address UDP | +| unix_addr | Unix domain socket end point Address | +| uri | URI String | +| url | URL String | +| http_url | HTTP URL String | +| url_encoded | URL Encoded | +| urn_rfc2141 | Urn RFC 2141 String | + +### Strings: + +| Tag | Description | +| - | - | +| alpha | Alpha Only | +| alphanum | Alphanumeric | +| alphanumunicode | Alphanumeric Unicode | +| alphaunicode | Alpha Unicode | +| ascii | ASCII | +| boolean | Boolean | +| contains | Contains | +| containsany | Contains Any | +| containsrune | Contains Rune | +| endsnotwith | Ends Not With | +| endswith | Ends With | +| excludes | Excludes | +| excludesall | Excludes All | +| excludesrune | Excludes Rune | +| lowercase | Lowercase | +| multibyte | Multi-Byte Characters | +| number | Number | +| numeric | Numeric | +| printascii | Printable ASCII | +| startsnotwith | Starts Not With | +| startswith | Starts With | +| uppercase | Uppercase | + +### Format: +| Tag | Description | +| - | - | +| base64 | Base64 String | +| base64url | Base64URL String | +| base64rawurl | Base64RawURL String | +| bic | Business Identifier Code (ISO 9362) | +| bcp47_language_tag | Language tag (BCP 47) | +| btc_addr | Bitcoin Address | +| btc_addr_bech32 | Bitcoin Bech32 Address (segwit) | +| credit_card | Credit Card Number | +| mongodb | MongoDB ObjectID | +| mongodb_connection_string | MongoDB Connection String | +| cron | Cron | +| spicedb | SpiceDb ObjectID/Permission/Type | +| datetime | Datetime | +| e164 | e164 formatted phone number | +| ein | U.S. Employeer Identification Number | +| email | E-mail String +| eth_addr | Ethereum Address | +| hexadecimal | Hexadecimal String | +| hexcolor | Hexcolor String | +| hsl | HSL String | +| hsla | HSLA String | +| html | HTML Tags | +| html_encoded | HTML Encoded | +| isbn | International Standard Book Number | +| isbn10 | International Standard Book Number 10 | +| isbn13 | International Standard Book Number 13 | +| issn | International Standard Serial Number | +| iso3166_1_alpha2 | Two-letter country code (ISO 3166-1 alpha-2) | +| iso3166_1_alpha3 | Three-letter country code (ISO 3166-1 alpha-3) | +| iso3166_1_alpha_numeric | Numeric country code (ISO 3166-1 numeric) | +| iso3166_2 | Country subdivision code (ISO 3166-2) | +| iso4217 | Currency code (ISO 4217) | +| json | JSON | +| jwt | JSON Web Token (JWT) | +| latitude | Latitude | +| longitude | Longitude | +| luhn_checksum | Luhn Algorithm Checksum (for strings and (u)int) | +| postcode_iso3166_alpha2 | Postcode | +| postcode_iso3166_alpha2_field | Postcode | +| rgb | RGB String | +| rgba | RGBA String | +| ssn | Social Security Number SSN | +| timezone | Timezone | +| uuid | Universally Unique Identifier UUID | +| uuid3 | Universally Unique Identifier UUID v3 | +| uuid3_rfc4122 | Universally Unique Identifier UUID v3 RFC4122 | +| uuid4 | Universally Unique Identifier UUID v4 | +| uuid4_rfc4122 | Universally Unique Identifier UUID v4 RFC4122 | +| uuid5 | Universally Unique Identifier UUID v5 | +| uuid5_rfc4122 | Universally Unique Identifier UUID v5 RFC4122 | +| uuid_rfc4122 | Universally Unique Identifier UUID RFC4122 | +| md4 | MD4 hash | +| md5 | MD5 hash | +| sha256 | SHA256 hash | +| sha384 | SHA384 hash | +| sha512 | SHA512 hash | +| ripemd128 | RIPEMD-128 hash | +| ripemd128 | RIPEMD-160 hash | +| tiger128 | TIGER128 hash | +| tiger160 | TIGER160 hash | +| tiger192 | TIGER192 hash | +| semver | Semantic Versioning 2.0.0 | +| ulid | Universally Unique Lexicographically Sortable Identifier ULID | +| cve | Common Vulnerabilities and Exposures Identifier (CVE id) | + +### Comparisons: +| Tag | Description | +| - | - | +| eq | Equals | +| eq_ignore_case | Equals ignoring case | +| gt | Greater than| +| gte | Greater than or equal | +| lt | Less Than | +| lte | Less Than or Equal | +| ne | Not Equal | +| ne_ignore_case | Not Equal ignoring case | + +### Other: +| Tag | Description | +| - | - | +| dir | Existing Directory | +| dirpath | Directory Path | +| file | Existing File | +| filepath | File Path | +| image | Image | +| isdefault | Is Default | +| len | Length | +| max | Maximum | +| min | Minimum | +| oneof | One Of | +| required | Required | +| required_if | Required If | +| required_unless | Required Unless | +| required_with | Required With | +| required_with_all | Required With All | +| required_without | Required Without | +| required_without_all | Required Without All | +| excluded_if | Excluded If | +| excluded_unless | Excluded Unless | +| excluded_with | Excluded With | +| excluded_with_all | Excluded With All | +| excluded_without | Excluded Without | +| excluded_without_all | Excluded Without All | +| unique | Unique | +| validateFn | Verify if the method `Validate() error` does not return an error (or any specified method) | + + +#### Aliases: +| Tag | Description | +| - | - | +| iscolor | hexcolor\|rgb\|rgba\|hsl\|hsla | +| country_code | iso3166_1_alpha2\|iso3166_1_alpha3\|iso3166_1_alpha_numeric | + +Benchmarks +------ +###### Run on MacBook Pro Max M3 +```go +go version go1.23.3 darwin/arm64 +goos: darwin +goarch: arm64 +cpu: Apple M3 Max +pkg: github.com/go-playground/validator/v10 +BenchmarkFieldSuccess-16 42461943 27.88 ns/op 0 B/op 0 allocs/op +BenchmarkFieldSuccessParallel-16 486632887 2.289 ns/op 0 B/op 0 allocs/op +BenchmarkFieldFailure-16 9566167 121.3 ns/op 200 B/op 4 allocs/op +BenchmarkFieldFailureParallel-16 17551471 83.68 ns/op 200 B/op 4 allocs/op +BenchmarkFieldArrayDiveSuccess-16 7602306 155.6 ns/op 97 B/op 5 allocs/op +BenchmarkFieldArrayDiveSuccessParallel-16 20664610 59.80 ns/op 97 B/op 5 allocs/op +BenchmarkFieldArrayDiveFailure-16 4659756 252.9 ns/op 301 B/op 10 allocs/op +BenchmarkFieldArrayDiveFailureParallel-16 8010116 152.9 ns/op 301 B/op 10 allocs/op +BenchmarkFieldMapDiveSuccess-16 2834575 421.2 ns/op 288 B/op 14 allocs/op +BenchmarkFieldMapDiveSuccessParallel-16 7179700 171.8 ns/op 288 B/op 14 allocs/op +BenchmarkFieldMapDiveFailure-16 3081728 384.4 ns/op 376 B/op 13 allocs/op +BenchmarkFieldMapDiveFailureParallel-16 6058137 204.0 ns/op 377 B/op 13 allocs/op +BenchmarkFieldMapDiveWithKeysSuccess-16 2544975 464.8 ns/op 288 B/op 14 allocs/op +BenchmarkFieldMapDiveWithKeysSuccessParallel-16 6661954 181.4 ns/op 288 B/op 14 allocs/op +BenchmarkFieldMapDiveWithKeysFailure-16 2435484 490.7 ns/op 553 B/op 16 allocs/op +BenchmarkFieldMapDiveWithKeysFailureParallel-16 4249617 282.0 ns/op 554 B/op 16 allocs/op +BenchmarkFieldCustomTypeSuccess-16 14943525 77.35 ns/op 32 B/op 2 allocs/op +BenchmarkFieldCustomTypeSuccessParallel-16 64051954 20.61 ns/op 32 B/op 2 allocs/op +BenchmarkFieldCustomTypeFailure-16 10721384 107.1 ns/op 184 B/op 3 allocs/op +BenchmarkFieldCustomTypeFailureParallel-16 18714495 69.77 ns/op 184 B/op 3 allocs/op +BenchmarkFieldOrTagSuccess-16 4063124 294.3 ns/op 16 B/op 1 allocs/op +BenchmarkFieldOrTagSuccessParallel-16 31903756 41.22 ns/op 18 B/op 1 allocs/op +BenchmarkFieldOrTagFailure-16 7748558 146.8 ns/op 216 B/op 5 allocs/op +BenchmarkFieldOrTagFailureParallel-16 13139854 92.05 ns/op 216 B/op 5 allocs/op +BenchmarkStructLevelValidationSuccess-16 16808389 70.25 ns/op 16 B/op 1 allocs/op +BenchmarkStructLevelValidationSuccessParallel-16 90686955 14.47 ns/op 16 B/op 1 allocs/op +BenchmarkStructLevelValidationFailure-16 5818791 200.2 ns/op 264 B/op 7 allocs/op +BenchmarkStructLevelValidationFailureParallel-16 11115874 107.5 ns/op 264 B/op 7 allocs/op +BenchmarkStructSimpleCustomTypeSuccess-16 7764956 151.9 ns/op 32 B/op 2 allocs/op +BenchmarkStructSimpleCustomTypeSuccessParallel-16 52316265 30.37 ns/op 32 B/op 2 allocs/op +BenchmarkStructSimpleCustomTypeFailure-16 4195429 277.2 ns/op 416 B/op 9 allocs/op +BenchmarkStructSimpleCustomTypeFailureParallel-16 7305661 164.6 ns/op 432 B/op 10 allocs/op +BenchmarkStructFilteredSuccess-16 6312625 186.1 ns/op 216 B/op 5 allocs/op +BenchmarkStructFilteredSuccessParallel-16 13684459 93.42 ns/op 216 B/op 5 allocs/op +BenchmarkStructFilteredFailure-16 6751482 171.2 ns/op 216 B/op 5 allocs/op +BenchmarkStructFilteredFailureParallel-16 14146070 86.93 ns/op 216 B/op 5 allocs/op +BenchmarkStructPartialSuccess-16 6544448 177.3 ns/op 224 B/op 4 allocs/op +BenchmarkStructPartialSuccessParallel-16 13951946 88.73 ns/op 224 B/op 4 allocs/op +BenchmarkStructPartialFailure-16 4075833 287.5 ns/op 440 B/op 9 allocs/op +BenchmarkStructPartialFailureParallel-16 7490805 161.3 ns/op 440 B/op 9 allocs/op +BenchmarkStructExceptSuccess-16 4107187 281.4 ns/op 424 B/op 8 allocs/op +BenchmarkStructExceptSuccessParallel-16 15979173 80.86 ns/op 208 B/op 3 allocs/op +BenchmarkStructExceptFailure-16 4434372 264.3 ns/op 424 B/op 8 allocs/op +BenchmarkStructExceptFailureParallel-16 8081367 154.1 ns/op 424 B/op 8 allocs/op +BenchmarkStructSimpleCrossFieldSuccess-16 6459542 183.4 ns/op 56 B/op 3 allocs/op +BenchmarkStructSimpleCrossFieldSuccessParallel-16 41013781 37.95 ns/op 56 B/op 3 allocs/op +BenchmarkStructSimpleCrossFieldFailure-16 4034998 292.1 ns/op 272 B/op 8 allocs/op +BenchmarkStructSimpleCrossFieldFailureParallel-16 11348446 115.3 ns/op 272 B/op 8 allocs/op +BenchmarkStructSimpleCrossStructCrossFieldSuccess-16 4448528 267.7 ns/op 64 B/op 4 allocs/op +BenchmarkStructSimpleCrossStructCrossFieldSuccessParallel-16 26813619 48.33 ns/op 64 B/op 4 allocs/op +BenchmarkStructSimpleCrossStructCrossFieldFailure-16 3090646 384.5 ns/op 288 B/op 9 allocs/op +BenchmarkStructSimpleCrossStructCrossFieldFailureParallel-16 9870906 129.5 ns/op 288 B/op 9 allocs/op +BenchmarkStructSimpleSuccess-16 10675562 109.5 ns/op 0 B/op 0 allocs/op +BenchmarkStructSimpleSuccessParallel-16 131159784 8.932 ns/op 0 B/op 0 allocs/op +BenchmarkStructSimpleFailure-16 4094979 286.6 ns/op 416 B/op 9 allocs/op +BenchmarkStructSimpleFailureParallel-16 7606663 157.9 ns/op 416 B/op 9 allocs/op +BenchmarkStructComplexSuccess-16 2073470 576.0 ns/op 224 B/op 5 allocs/op +BenchmarkStructComplexSuccessParallel-16 7821831 161.3 ns/op 224 B/op 5 allocs/op +BenchmarkStructComplexFailure-16 576358 2001 ns/op 3042 B/op 48 allocs/op +BenchmarkStructComplexFailureParallel-16 1000000 1171 ns/op 3041 B/op 48 allocs/op +BenchmarkOneof-16 22503973 52.82 ns/op 0 B/op 0 allocs/op +BenchmarkOneofParallel-16 8538474 140.4 ns/op 0 B/op 0 allocs/op +``` + +Complementary Software +---------------------- + +Here is a list of software that complements using this library either pre or post validation. + +* [form](https://github.com/go-playground/form) - Decodes url.Values into Go value(s) and Encodes Go value(s) into url.Values. Dual Array and Full map support. +* [mold](https://github.com/go-playground/mold) - A general library to help modify or set data within data structures and other objects + +How to Contribute +------ + +Make a pull request... + +Maintenance and support for SDK major versions +---------------------------------------------- + +See prior discussion [here](https://github.com/go-playground/validator/discussions/1342) for more details. + +This package is aligned with the [Go release policy](https://go.dev/doc/devel/release) in that support is guaranteed for +the two most recent major versions. + +This does not mean the package will not work with older versions of Go, only that we reserve the right to increase the +MSGV(Minimum Supported Go Version) when the need arises to address Security issues/patches, OS issues & support or newly +introduced functionality that would greatly benefit the maintenance and/or usage of this package. + +If and when the MSGV is increased it will be done so in a minimum of a `Minor` release bump. + +License +------- +Distributed under MIT License, please see license file within the code for more details. + +Maintainers +----------- +This project has grown large enough that more than one person is required to properly support the community. +If you are interested in becoming a maintainer please reach out to me https://github.com/deankarn diff --git a/vendor/github.com/go-playground/validator/v10/baked_in.go b/vendor/github.com/go-playground/validator/v10/baked_in.go new file mode 100644 index 00000000..c968ad4a --- /dev/null +++ b/vendor/github.com/go-playground/validator/v10/baked_in.go @@ -0,0 +1,3109 @@ +package validator + +import ( + "bytes" + "cmp" + "context" + "crypto/sha256" + "encoding/hex" + "encoding/json" + "errors" + "fmt" + "io/fs" + "net" + "net/mail" + "net/url" + "os" + "reflect" + "strconv" + "strings" + "sync" + "syscall" + "time" + "unicode/utf8" + + "golang.org/x/crypto/sha3" + "golang.org/x/text/language" + + "github.com/gabriel-vasile/mimetype" + urn "github.com/leodido/go-urn" +) + +// Func accepts a FieldLevel interface for all validation needs. The return +// value should be true when validation succeeds. +type Func func(fl FieldLevel) bool + +// FuncCtx accepts a context.Context and FieldLevel interface for all +// validation needs. The return value should be true when validation succeeds. +type FuncCtx func(ctx context.Context, fl FieldLevel) bool + +// wrapFunc wraps normal Func makes it compatible with FuncCtx +func wrapFunc(fn Func) FuncCtx { + if fn == nil { + return nil // be sure not to wrap a bad function. + } + return func(ctx context.Context, fl FieldLevel) bool { + return fn(fl) + } +} + +var ( + restrictedTags = map[string]struct{}{ + diveTag: {}, + keysTag: {}, + endKeysTag: {}, + structOnlyTag: {}, + omitzero: {}, + omitempty: {}, + omitnil: {}, + skipValidationTag: {}, + utf8HexComma: {}, + utf8Pipe: {}, + noStructLevelTag: {}, + requiredTag: {}, + isdefault: {}, + } + + // bakedInAliases is a default mapping of a single validation tag that + // defines a common or complex set of validation(s) to simplify + // adding validation to structs. + bakedInAliases = map[string]string{ + "iscolor": "hexcolor|rgb|rgba|hsl|hsla", + "country_code": "iso3166_1_alpha2|iso3166_1_alpha3|iso3166_1_alpha_numeric", + "eu_country_code": "iso3166_1_alpha2_eu|iso3166_1_alpha3_eu|iso3166_1_alpha_numeric_eu", + } + + // bakedInValidators is the default map of ValidationFunc + // you can add, remove or even replace items to suite your needs, + // or even disregard and use your own map if so desired. + bakedInValidators = map[string]Func{ + "required": hasValue, + "required_if": requiredIf, + "required_unless": requiredUnless, + "skip_unless": skipUnless, + "required_with": requiredWith, + "required_with_all": requiredWithAll, + "required_without": requiredWithout, + "required_without_all": requiredWithoutAll, + "excluded_if": excludedIf, + "excluded_unless": excludedUnless, + "excluded_with": excludedWith, + "excluded_with_all": excludedWithAll, + "excluded_without": excludedWithout, + "excluded_without_all": excludedWithoutAll, + "isdefault": isDefault, + "len": hasLengthOf, + "min": hasMinOf, + "max": hasMaxOf, + "eq": isEq, + "eq_ignore_case": isEqIgnoreCase, + "ne": isNe, + "ne_ignore_case": isNeIgnoreCase, + "lt": isLt, + "lte": isLte, + "gt": isGt, + "gte": isGte, + "eqfield": isEqField, + "eqcsfield": isEqCrossStructField, + "necsfield": isNeCrossStructField, + "gtcsfield": isGtCrossStructField, + "gtecsfield": isGteCrossStructField, + "ltcsfield": isLtCrossStructField, + "ltecsfield": isLteCrossStructField, + "nefield": isNeField, + "gtefield": isGteField, + "gtfield": isGtField, + "ltefield": isLteField, + "ltfield": isLtField, + "fieldcontains": fieldContains, + "fieldexcludes": fieldExcludes, + "alpha": isAlpha, + "alphanum": isAlphanum, + "alphaunicode": isAlphaUnicode, + "alphanumunicode": isAlphanumUnicode, + "boolean": isBoolean, + "numeric": isNumeric, + "number": isNumber, + "hexadecimal": isHexadecimal, + "hexcolor": isHEXColor, + "rgb": isRGB, + "rgba": isRGBA, + "hsl": isHSL, + "hsla": isHSLA, + "e164": isE164, + "email": isEmail, + "url": isURL, + "http_url": isHttpURL, + "uri": isURI, + "urn_rfc2141": isUrnRFC2141, // RFC 2141 + "file": isFile, + "filepath": isFilePath, + "base32": isBase32, + "base64": isBase64, + "base64url": isBase64URL, + "base64rawurl": isBase64RawURL, + "contains": contains, + "containsany": containsAny, + "containsrune": containsRune, + "excludes": excludes, + "excludesall": excludesAll, + "excludesrune": excludesRune, + "startswith": startsWith, + "endswith": endsWith, + "startsnotwith": startsNotWith, + "endsnotwith": endsNotWith, + "image": isImage, + "isbn": isISBN, + "isbn10": isISBN10, + "isbn13": isISBN13, + "issn": isISSN, + "eth_addr": isEthereumAddress, + "eth_addr_checksum": isEthereumAddressChecksum, + "btc_addr": isBitcoinAddress, + "btc_addr_bech32": isBitcoinBech32Address, + "uuid": isUUID, + "uuid3": isUUID3, + "uuid4": isUUID4, + "uuid5": isUUID5, + "uuid_rfc4122": isUUIDRFC4122, + "uuid3_rfc4122": isUUID3RFC4122, + "uuid4_rfc4122": isUUID4RFC4122, + "uuid5_rfc4122": isUUID5RFC4122, + "ulid": isULID, + "md4": isMD4, + "md5": isMD5, + "sha256": isSHA256, + "sha384": isSHA384, + "sha512": isSHA512, + "ripemd128": isRIPEMD128, + "ripemd160": isRIPEMD160, + "tiger128": isTIGER128, + "tiger160": isTIGER160, + "tiger192": isTIGER192, + "ascii": isASCII, + "printascii": isPrintableASCII, + "multibyte": hasMultiByteCharacter, + "datauri": isDataURI, + "latitude": isLatitude, + "longitude": isLongitude, + "ssn": isSSN, + "ipv4": isIPv4, + "ipv6": isIPv6, + "ip": isIP, + "cidrv4": isCIDRv4, + "cidrv6": isCIDRv6, + "cidr": isCIDR, + "tcp4_addr": isTCP4AddrResolvable, + "tcp6_addr": isTCP6AddrResolvable, + "tcp_addr": isTCPAddrResolvable, + "udp4_addr": isUDP4AddrResolvable, + "udp6_addr": isUDP6AddrResolvable, + "udp_addr": isUDPAddrResolvable, + "ip4_addr": isIP4AddrResolvable, + "ip6_addr": isIP6AddrResolvable, + "ip_addr": isIPAddrResolvable, + "unix_addr": isUnixAddrResolvable, + "mac": isMAC, + "hostname": isHostnameRFC952, // RFC 952 + "hostname_rfc1123": isHostnameRFC1123, // RFC 1123 + "fqdn": isFQDN, + "unique": isUnique, + "oneof": isOneOf, + "oneofci": isOneOfCI, + "html": isHTML, + "html_encoded": isHTMLEncoded, + "url_encoded": isURLEncoded, + "dir": isDir, + "dirpath": isDirPath, + "json": isJSON, + "jwt": isJWT, + "hostname_port": isHostnamePort, + "port": isPort, + "lowercase": isLowercase, + "uppercase": isUppercase, + "datetime": isDatetime, + "timezone": isTimeZone, + "iso3166_1_alpha2": isIso3166Alpha2, + "iso3166_1_alpha2_eu": isIso3166Alpha2EU, + "iso3166_1_alpha3": isIso3166Alpha3, + "iso3166_1_alpha3_eu": isIso3166Alpha3EU, + "iso3166_1_alpha_numeric": isIso3166AlphaNumeric, + "iso3166_1_alpha_numeric_eu": isIso3166AlphaNumericEU, + "iso3166_2": isIso31662, + "iso4217": isIso4217, + "iso4217_numeric": isIso4217Numeric, + "bcp47_language_tag": isBCP47LanguageTag, + "postcode_iso3166_alpha2": isPostcodeByIso3166Alpha2, + "postcode_iso3166_alpha2_field": isPostcodeByIso3166Alpha2Field, + "bic": isIsoBicFormat, + "semver": isSemverFormat, + "dns_rfc1035_label": isDnsRFC1035LabelFormat, + "credit_card": isCreditCard, + "cve": isCveFormat, + "luhn_checksum": hasLuhnChecksum, + "mongodb": isMongoDBObjectId, + "mongodb_connection_string": isMongoDBConnectionString, + "cron": isCron, + "spicedb": isSpiceDB, + "ein": isEIN, + "validateFn": isValidateFn, + } +) + +var ( + oneofValsCache = map[string][]string{} + oneofValsCacheRWLock = sync.RWMutex{} +) + +func parseOneOfParam2(s string) []string { + oneofValsCacheRWLock.RLock() + vals, ok := oneofValsCache[s] + oneofValsCacheRWLock.RUnlock() + if !ok { + oneofValsCacheRWLock.Lock() + vals = splitParamsRegex().FindAllString(s, -1) + for i := 0; i < len(vals); i++ { + vals[i] = strings.ReplaceAll(vals[i], "'", "") + } + oneofValsCache[s] = vals + oneofValsCacheRWLock.Unlock() + } + return vals +} + +func isURLEncoded(fl FieldLevel) bool { + return uRLEncodedRegex().MatchString(fl.Field().String()) +} + +func isHTMLEncoded(fl FieldLevel) bool { + return hTMLEncodedRegex().MatchString(fl.Field().String()) +} + +func isHTML(fl FieldLevel) bool { + return hTMLRegex().MatchString(fl.Field().String()) +} + +func isOneOf(fl FieldLevel) bool { + vals := parseOneOfParam2(fl.Param()) + + field := fl.Field() + + var v string + switch field.Kind() { + case reflect.String: + v = field.String() + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + v = strconv.FormatInt(field.Int(), 10) + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64: + v = strconv.FormatUint(field.Uint(), 10) + default: + panic(fmt.Sprintf("Bad field type %s", field.Type())) + } + for i := 0; i < len(vals); i++ { + if vals[i] == v { + return true + } + } + return false +} + +// isOneOfCI is the validation function for validating if the current field's value is one of the provided string values (case insensitive). +func isOneOfCI(fl FieldLevel) bool { + vals := parseOneOfParam2(fl.Param()) + field := fl.Field() + + if field.Kind() != reflect.String { + panic(fmt.Sprintf("Bad field type %s", field.Type())) + } + v := field.String() + for _, val := range vals { + if strings.EqualFold(val, v) { + return true + } + } + return false +} + +// isUnique is the validation function for validating if each array|slice|map value is unique +func isUnique(fl FieldLevel) bool { + field := fl.Field() + param := fl.Param() + v := reflect.ValueOf(struct{}{}) + + switch field.Kind() { + case reflect.Slice, reflect.Array: + elem := field.Type().Elem() + if elem.Kind() == reflect.Ptr { + elem = elem.Elem() + } + + if param == "" { + m := reflect.MakeMap(reflect.MapOf(elem, v.Type())) + + for i := 0; i < field.Len(); i++ { + m.SetMapIndex(reflect.Indirect(field.Index(i)), v) + } + return field.Len() == m.Len() + } + + sf, ok := elem.FieldByName(param) + if !ok { + panic(fmt.Sprintf("Bad field name %s", param)) + } + + sfTyp := sf.Type + if sfTyp.Kind() == reflect.Ptr { + sfTyp = sfTyp.Elem() + } + + m := reflect.MakeMap(reflect.MapOf(sfTyp, v.Type())) + var fieldlen int + for i := 0; i < field.Len(); i++ { + key := reflect.Indirect(reflect.Indirect(field.Index(i)).FieldByName(param)) + if key.IsValid() { + fieldlen++ + m.SetMapIndex(key, v) + } + } + return fieldlen == m.Len() + case reflect.Map: + var m reflect.Value + if field.Type().Elem().Kind() == reflect.Ptr { + m = reflect.MakeMap(reflect.MapOf(field.Type().Elem().Elem(), v.Type())) + } else { + m = reflect.MakeMap(reflect.MapOf(field.Type().Elem(), v.Type())) + } + + for _, k := range field.MapKeys() { + m.SetMapIndex(reflect.Indirect(field.MapIndex(k)), v) + } + + return field.Len() == m.Len() + default: + if parent := fl.Parent(); parent.Kind() == reflect.Struct { + uniqueField := parent.FieldByName(param) + if uniqueField == reflect.ValueOf(nil) { + panic(fmt.Sprintf("Bad field name provided %s", param)) + } + + if uniqueField.Kind() != field.Kind() { + panic(fmt.Sprintf("Bad field type %s:%s", field.Type(), uniqueField.Type())) + } + + return getValue(field) != getValue(uniqueField) + } + + panic(fmt.Sprintf("Bad field type %s", field.Type())) + } +} + +// isMAC is the validation function for validating if the field's value is a valid MAC address. +func isMAC(fl FieldLevel) bool { + _, err := net.ParseMAC(fl.Field().String()) + + return err == nil +} + +// isCIDRv4 is the validation function for validating if the field's value is a valid v4 CIDR address. +func isCIDRv4(fl FieldLevel) bool { + ip, net, err := net.ParseCIDR(fl.Field().String()) + + return err == nil && ip.To4() != nil && net.IP.Equal(ip) +} + +// isCIDRv6 is the validation function for validating if the field's value is a valid v6 CIDR address. +func isCIDRv6(fl FieldLevel) bool { + ip, _, err := net.ParseCIDR(fl.Field().String()) + + return err == nil && ip.To4() == nil +} + +// isCIDR is the validation function for validating if the field's value is a valid v4 or v6 CIDR address. +func isCIDR(fl FieldLevel) bool { + _, _, err := net.ParseCIDR(fl.Field().String()) + + return err == nil +} + +// isIPv4 is the validation function for validating if a value is a valid v4 IP address. +func isIPv4(fl FieldLevel) bool { + ip := net.ParseIP(fl.Field().String()) + + return ip != nil && ip.To4() != nil +} + +// isIPv6 is the validation function for validating if the field's value is a valid v6 IP address. +func isIPv6(fl FieldLevel) bool { + ip := net.ParseIP(fl.Field().String()) + + return ip != nil && ip.To4() == nil +} + +// isIP is the validation function for validating if the field's value is a valid v4 or v6 IP address. +func isIP(fl FieldLevel) bool { + ip := net.ParseIP(fl.Field().String()) + + return ip != nil +} + +// isSSN is the validation function for validating if the field's value is a valid SSN. +func isSSN(fl FieldLevel) bool { + field := fl.Field() + + if field.Len() != 11 { + return false + } + + return sSNRegex().MatchString(field.String()) +} + +// isLongitude is the validation function for validating if the field's value is a valid longitude coordinate. +func isLongitude(fl FieldLevel) bool { + field := fl.Field() + + var v string + switch field.Kind() { + case reflect.String: + v = field.String() + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + v = strconv.FormatInt(field.Int(), 10) + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64: + v = strconv.FormatUint(field.Uint(), 10) + case reflect.Float32: + v = strconv.FormatFloat(field.Float(), 'f', -1, 32) + case reflect.Float64: + v = strconv.FormatFloat(field.Float(), 'f', -1, 64) + default: + panic(fmt.Sprintf("Bad field type %s", field.Type())) + } + + return longitudeRegex().MatchString(v) +} + +// isLatitude is the validation function for validating if the field's value is a valid latitude coordinate. +func isLatitude(fl FieldLevel) bool { + field := fl.Field() + + var v string + switch field.Kind() { + case reflect.String: + v = field.String() + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + v = strconv.FormatInt(field.Int(), 10) + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64: + v = strconv.FormatUint(field.Uint(), 10) + case reflect.Float32: + v = strconv.FormatFloat(field.Float(), 'f', -1, 32) + case reflect.Float64: + v = strconv.FormatFloat(field.Float(), 'f', -1, 64) + default: + panic(fmt.Sprintf("Bad field type %s", field.Type())) + } + + return latitudeRegex().MatchString(v) +} + +// isDataURI is the validation function for validating if the field's value is a valid data URI. +func isDataURI(fl FieldLevel) bool { + uri := strings.SplitN(fl.Field().String(), ",", 2) + + if len(uri) != 2 { + return false + } + + if !dataURIRegex().MatchString(uri[0]) { + return false + } + + return base64Regex().MatchString(uri[1]) +} + +// hasMultiByteCharacter is the validation function for validating if the field's value has a multi byte character. +func hasMultiByteCharacter(fl FieldLevel) bool { + field := fl.Field() + + if field.Len() == 0 { + return true + } + + return multibyteRegex().MatchString(field.String()) +} + +// isPrintableASCII is the validation function for validating if the field's value is a valid printable ASCII character. +func isPrintableASCII(fl FieldLevel) bool { + return printableASCIIRegex().MatchString(fl.Field().String()) +} + +// isASCII is the validation function for validating if the field's value is a valid ASCII character. +func isASCII(fl FieldLevel) bool { + return aSCIIRegex().MatchString(fl.Field().String()) +} + +// isUUID5 is the validation function for validating if the field's value is a valid v5 UUID. +func isUUID5(fl FieldLevel) bool { + return fieldMatchesRegexByStringerValOrString(uUID5Regex, fl) +} + +// isUUID4 is the validation function for validating if the field's value is a valid v4 UUID. +func isUUID4(fl FieldLevel) bool { + return fieldMatchesRegexByStringerValOrString(uUID4Regex, fl) +} + +// isUUID3 is the validation function for validating if the field's value is a valid v3 UUID. +func isUUID3(fl FieldLevel) bool { + return fieldMatchesRegexByStringerValOrString(uUID3Regex, fl) +} + +// isUUID is the validation function for validating if the field's value is a valid UUID of any version. +func isUUID(fl FieldLevel) bool { + return fieldMatchesRegexByStringerValOrString(uUIDRegex, fl) +} + +// isUUID5RFC4122 is the validation function for validating if the field's value is a valid RFC4122 v5 UUID. +func isUUID5RFC4122(fl FieldLevel) bool { + return fieldMatchesRegexByStringerValOrString(uUID5RFC4122Regex, fl) +} + +// isUUID4RFC4122 is the validation function for validating if the field's value is a valid RFC4122 v4 UUID. +func isUUID4RFC4122(fl FieldLevel) bool { + return fieldMatchesRegexByStringerValOrString(uUID4RFC4122Regex, fl) +} + +// isUUID3RFC4122 is the validation function for validating if the field's value is a valid RFC4122 v3 UUID. +func isUUID3RFC4122(fl FieldLevel) bool { + return fieldMatchesRegexByStringerValOrString(uUID3RFC4122Regex, fl) +} + +// isUUIDRFC4122 is the validation function for validating if the field's value is a valid RFC4122 UUID of any version. +func isUUIDRFC4122(fl FieldLevel) bool { + return fieldMatchesRegexByStringerValOrString(uUIDRFC4122Regex, fl) +} + +// isULID is the validation function for validating if the field's value is a valid ULID. +func isULID(fl FieldLevel) bool { + return fieldMatchesRegexByStringerValOrString(uLIDRegex, fl) +} + +// isMD4 is the validation function for validating if the field's value is a valid MD4. +func isMD4(fl FieldLevel) bool { + return md4Regex().MatchString(fl.Field().String()) +} + +// isMD5 is the validation function for validating if the field's value is a valid MD5. +func isMD5(fl FieldLevel) bool { + return md5Regex().MatchString(fl.Field().String()) +} + +// isSHA256 is the validation function for validating if the field's value is a valid SHA256. +func isSHA256(fl FieldLevel) bool { + return sha256Regex().MatchString(fl.Field().String()) +} + +// isSHA384 is the validation function for validating if the field's value is a valid SHA384. +func isSHA384(fl FieldLevel) bool { + return sha384Regex().MatchString(fl.Field().String()) +} + +// isSHA512 is the validation function for validating if the field's value is a valid SHA512. +func isSHA512(fl FieldLevel) bool { + return sha512Regex().MatchString(fl.Field().String()) +} + +// isRIPEMD128 is the validation function for validating if the field's value is a valid PIPEMD128. +func isRIPEMD128(fl FieldLevel) bool { + return ripemd128Regex().MatchString(fl.Field().String()) +} + +// isRIPEMD160 is the validation function for validating if the field's value is a valid PIPEMD160. +func isRIPEMD160(fl FieldLevel) bool { + return ripemd160Regex().MatchString(fl.Field().String()) +} + +// isTIGER128 is the validation function for validating if the field's value is a valid TIGER128. +func isTIGER128(fl FieldLevel) bool { + return tiger128Regex().MatchString(fl.Field().String()) +} + +// isTIGER160 is the validation function for validating if the field's value is a valid TIGER160. +func isTIGER160(fl FieldLevel) bool { + return tiger160Regex().MatchString(fl.Field().String()) +} + +// isTIGER192 is the validation function for validating if the field's value is a valid isTIGER192. +func isTIGER192(fl FieldLevel) bool { + return tiger192Regex().MatchString(fl.Field().String()) +} + +// isISBN is the validation function for validating if the field's value is a valid v10 or v13 ISBN. +func isISBN(fl FieldLevel) bool { + return isISBN10(fl) || isISBN13(fl) +} + +// isISBN13 is the validation function for validating if the field's value is a valid v13 ISBN. +func isISBN13(fl FieldLevel) bool { + s := strings.Replace(strings.Replace(fl.Field().String(), "-", "", 4), " ", "", 4) + + if !iSBN13Regex().MatchString(s) { + return false + } + + var checksum int32 + var i int32 + + factor := []int32{1, 3} + + for i = 0; i < 12; i++ { + checksum += factor[i%2] * int32(s[i]-'0') + } + + return (int32(s[12]-'0'))-((10-(checksum%10))%10) == 0 +} + +// isISBN10 is the validation function for validating if the field's value is a valid v10 ISBN. +func isISBN10(fl FieldLevel) bool { + s := strings.Replace(strings.Replace(fl.Field().String(), "-", "", 3), " ", "", 3) + + if !iSBN10Regex().MatchString(s) { + return false + } + + var checksum int32 + var i int32 + + for i = 0; i < 9; i++ { + checksum += (i + 1) * int32(s[i]-'0') + } + + if s[9] == 'X' { + checksum += 10 * 10 + } else { + checksum += 10 * int32(s[9]-'0') + } + + return checksum%11 == 0 +} + +// isISSN is the validation function for validating if the field's value is a valid ISSN. +func isISSN(fl FieldLevel) bool { + s := fl.Field().String() + + if !iSSNRegex().MatchString(s) { + return false + } + s = strings.ReplaceAll(s, "-", "") + + pos := 8 + checksum := 0 + + for i := 0; i < 7; i++ { + checksum += pos * int(s[i]-'0') + pos-- + } + + if s[7] == 'X' { + checksum += 10 + } else { + checksum += int(s[7] - '0') + } + + return checksum%11 == 0 +} + +// isEthereumAddress is the validation function for validating if the field's value is a valid Ethereum address. +func isEthereumAddress(fl FieldLevel) bool { + address := fl.Field().String() + + return ethAddressRegex().MatchString(address) +} + +// isEthereumAddressChecksum is the validation function for validating if the field's value is a valid checksummed Ethereum address. +func isEthereumAddressChecksum(fl FieldLevel) bool { + address := fl.Field().String() + + if !ethAddressRegex().MatchString(address) { + return false + } + // Checksum validation. Reference: https://github.com/ethereum/EIPs/blob/master/EIPS/eip-55.md + address = address[2:] // Skip "0x" prefix. + h := sha3.NewLegacyKeccak256() + // hash.Hash's io.Writer implementation says it never returns an error. https://golang.org/pkg/hash/#Hash + _, _ = h.Write([]byte(strings.ToLower(address))) + hash := hex.EncodeToString(h.Sum(nil)) + + for i := 0; i < len(address); i++ { + if address[i] <= '9' { // Skip 0-9 digits: they don't have upper/lower-case. + continue + } + if hash[i] > '7' && address[i] >= 'a' || hash[i] <= '7' && address[i] <= 'F' { + return false + } + } + + return true +} + +// isBitcoinAddress is the validation function for validating if the field's value is a valid btc address +func isBitcoinAddress(fl FieldLevel) bool { + address := fl.Field().String() + + if !btcAddressRegex().MatchString(address) { + return false + } + + alphabet := []byte("123456789ABCDEFGHJKLMNPQRSTUVWXYZabcdefghijkmnopqrstuvwxyz") + + decode := [25]byte{} + + for _, n := range []byte(address) { + d := bytes.IndexByte(alphabet, n) + + for i := 24; i >= 0; i-- { + d += 58 * int(decode[i]) + decode[i] = byte(d % 256) + d /= 256 + } + } + + h := sha256.New() + _, _ = h.Write(decode[:21]) + d := h.Sum([]byte{}) + h = sha256.New() + _, _ = h.Write(d) + + validchecksum := [4]byte{} + computedchecksum := [4]byte{} + + copy(computedchecksum[:], h.Sum(d[:0])) + copy(validchecksum[:], decode[21:]) + + return validchecksum == computedchecksum +} + +// isBitcoinBech32Address is the validation function for validating if the field's value is a valid bech32 btc address +func isBitcoinBech32Address(fl FieldLevel) bool { + address := fl.Field().String() + + if !btcLowerAddressRegexBech32().MatchString(address) && !btcUpperAddressRegexBech32().MatchString(address) { + return false + } + + am := len(address) % 8 + + if am == 0 || am == 3 || am == 5 { + return false + } + + address = strings.ToLower(address) + + alphabet := "qpzry9x8gf2tvdw0s3jn54khce6mua7l" + + hr := []int{3, 3, 0, 2, 3} // the human readable part will always be bc + addr := address[3:] + dp := make([]int, 0, len(addr)) + + for _, c := range addr { + dp = append(dp, strings.IndexRune(alphabet, c)) + } + + ver := dp[0] + + if ver < 0 || ver > 16 { + return false + } + + if ver == 0 { + if len(address) != 42 && len(address) != 62 { + return false + } + } + + values := append(hr, dp...) + + GEN := []int{0x3b6a57b2, 0x26508e6d, 0x1ea119fa, 0x3d4233dd, 0x2a1462b3} + + p := 1 + + for _, v := range values { + b := p >> 25 + p = (p&0x1ffffff)<<5 ^ v + + for i := 0; i < 5; i++ { + if (b>>uint(i))&1 == 1 { + p ^= GEN[i] + } + } + } + + if p != 1 { + return false + } + + b := uint(0) + acc := 0 + mv := (1 << 5) - 1 + var sw []int + + for _, v := range dp[1 : len(dp)-6] { + acc = (acc << 5) | v + b += 5 + for b >= 8 { + b -= 8 + sw = append(sw, (acc>>b)&mv) + } + } + + if len(sw) < 2 || len(sw) > 40 { + return false + } + + return true +} + +// excludesRune is the validation function for validating that the field's value does not contain the rune specified within the param. +func excludesRune(fl FieldLevel) bool { + return !containsRune(fl) +} + +// excludesAll is the validation function for validating that the field's value does not contain any of the characters specified within the param. +func excludesAll(fl FieldLevel) bool { + return !containsAny(fl) +} + +// excludes is the validation function for validating that the field's value does not contain the text specified within the param. +func excludes(fl FieldLevel) bool { + return !contains(fl) +} + +// containsRune is the validation function for validating that the field's value contains the rune specified within the param. +func containsRune(fl FieldLevel) bool { + r, _ := utf8.DecodeRuneInString(fl.Param()) + + return strings.ContainsRune(fl.Field().String(), r) +} + +// containsAny is the validation function for validating that the field's value contains any of the characters specified within the param. +func containsAny(fl FieldLevel) bool { + return strings.ContainsAny(fl.Field().String(), fl.Param()) +} + +// contains is the validation function for validating that the field's value contains the text specified within the param. +func contains(fl FieldLevel) bool { + return strings.Contains(fl.Field().String(), fl.Param()) +} + +// startsWith is the validation function for validating that the field's value starts with the text specified within the param. +func startsWith(fl FieldLevel) bool { + return strings.HasPrefix(fl.Field().String(), fl.Param()) +} + +// endsWith is the validation function for validating that the field's value ends with the text specified within the param. +func endsWith(fl FieldLevel) bool { + return strings.HasSuffix(fl.Field().String(), fl.Param()) +} + +// startsNotWith is the validation function for validating that the field's value does not start with the text specified within the param. +func startsNotWith(fl FieldLevel) bool { + return !startsWith(fl) +} + +// endsNotWith is the validation function for validating that the field's value does not end with the text specified within the param. +func endsNotWith(fl FieldLevel) bool { + return !endsWith(fl) +} + +// fieldContains is the validation function for validating if the current field's value contains the field specified by the param's value. +func fieldContains(fl FieldLevel) bool { + field := fl.Field() + + currentField, _, ok := fl.GetStructFieldOK() + + if !ok { + return false + } + + return strings.Contains(field.String(), currentField.String()) +} + +// fieldExcludes is the validation function for validating if the current field's value excludes the field specified by the param's value. +func fieldExcludes(fl FieldLevel) bool { + field := fl.Field() + + currentField, _, ok := fl.GetStructFieldOK() + if !ok { + return true + } + + return !strings.Contains(field.String(), currentField.String()) +} + +// isNeField is the validation function for validating if the current field's value is not equal to the field specified by the param's value. +func isNeField(fl FieldLevel) bool { + field := fl.Field() + kind := field.Kind() + + currentField, currentKind, ok := fl.GetStructFieldOK() + + if !ok || currentKind != kind { + return true + } + + switch kind { + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + return field.Int() != currentField.Int() + + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: + return field.Uint() != currentField.Uint() + + case reflect.Float32, reflect.Float64: + return field.Float() != currentField.Float() + + case reflect.Slice, reflect.Map, reflect.Array: + return int64(field.Len()) != int64(currentField.Len()) + + case reflect.Bool: + return field.Bool() != currentField.Bool() + + case reflect.Struct: + + fieldType := field.Type() + + if fieldType.ConvertibleTo(timeType) && currentField.Type().ConvertibleTo(timeType) { + t := getValue(currentField).(time.Time) + fieldTime := getValue(field).(time.Time) + + return !fieldTime.Equal(t) + } + + // Not Same underlying type i.e. struct and time + if fieldType != currentField.Type() { + return true + } + } + + // default reflect.String: + return field.String() != currentField.String() +} + +// isNe is the validation function for validating that the field's value does not equal the provided param value. +func isNe(fl FieldLevel) bool { + return !isEq(fl) +} + +// isNeIgnoreCase is the validation function for validating that the field's string value does not equal the +// provided param value. The comparison is case-insensitive +func isNeIgnoreCase(fl FieldLevel) bool { + return !isEqIgnoreCase(fl) +} + +// isLteCrossStructField is the validation function for validating if the current field's value is less than or equal to the field, within a separate struct, specified by the param's value. +func isLteCrossStructField(fl FieldLevel) bool { + field := fl.Field() + kind := field.Kind() + + topField, topKind, ok := fl.GetStructFieldOK() + if !ok || topKind != kind { + return false + } + + switch kind { + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + return field.Int() <= topField.Int() + + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: + return field.Uint() <= topField.Uint() + + case reflect.Float32, reflect.Float64: + return field.Float() <= topField.Float() + + case reflect.Slice, reflect.Map, reflect.Array: + return int64(field.Len()) <= int64(topField.Len()) + + case reflect.Struct: + + fieldType := field.Type() + + if fieldType.ConvertibleTo(timeType) && topField.Type().ConvertibleTo(timeType) { + fieldTime := getValue(field.Convert(timeType)).(time.Time) + topTime := getValue(topField.Convert(timeType)).(time.Time) + + return fieldTime.Before(topTime) || fieldTime.Equal(topTime) + } + + // Not Same underlying type i.e. struct and time + if fieldType != topField.Type() { + return false + } + } + + // default reflect.String: + return field.String() <= topField.String() +} + +// isLtCrossStructField is the validation function for validating if the current field's value is less than the field, within a separate struct, specified by the param's value. +// NOTE: This is exposed for use within your own custom functions and not intended to be called directly. +func isLtCrossStructField(fl FieldLevel) bool { + field := fl.Field() + kind := field.Kind() + + topField, topKind, ok := fl.GetStructFieldOK() + if !ok || topKind != kind { + return false + } + + switch kind { + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + return field.Int() < topField.Int() + + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: + return field.Uint() < topField.Uint() + + case reflect.Float32, reflect.Float64: + return field.Float() < topField.Float() + + case reflect.Slice, reflect.Map, reflect.Array: + return int64(field.Len()) < int64(topField.Len()) + + case reflect.Struct: + + fieldType := field.Type() + + if fieldType.ConvertibleTo(timeType) && topField.Type().ConvertibleTo(timeType) { + fieldTime := getValue(field.Convert(timeType)).(time.Time) + topTime := getValue(topField.Convert(timeType)).(time.Time) + + return fieldTime.Before(topTime) + } + + // Not Same underlying type i.e. struct and time + if fieldType != topField.Type() { + return false + } + } + + // default reflect.String: + return field.String() < topField.String() +} + +// isGteCrossStructField is the validation function for validating if the current field's value is greater than or equal to the field, within a separate struct, specified by the param's value. +func isGteCrossStructField(fl FieldLevel) bool { + field := fl.Field() + kind := field.Kind() + + topField, topKind, ok := fl.GetStructFieldOK() + if !ok || topKind != kind { + return false + } + + switch kind { + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + return field.Int() >= topField.Int() + + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: + return field.Uint() >= topField.Uint() + + case reflect.Float32, reflect.Float64: + return field.Float() >= topField.Float() + + case reflect.Slice, reflect.Map, reflect.Array: + return int64(field.Len()) >= int64(topField.Len()) + + case reflect.Struct: + + fieldType := field.Type() + + if fieldType.ConvertibleTo(timeType) && topField.Type().ConvertibleTo(timeType) { + fieldTime := getValue(field.Convert(timeType)).(time.Time) + topTime := getValue(topField.Convert(timeType)).(time.Time) + + return fieldTime.After(topTime) || fieldTime.Equal(topTime) + } + + // Not Same underlying type i.e. struct and time + if fieldType != topField.Type() { + return false + } + } + + // default reflect.String: + return field.String() >= topField.String() +} + +// isGtCrossStructField is the validation function for validating if the current field's value is greater than the field, within a separate struct, specified by the param's value. +func isGtCrossStructField(fl FieldLevel) bool { + field := fl.Field() + kind := field.Kind() + + topField, topKind, ok := fl.GetStructFieldOK() + if !ok || topKind != kind { + return false + } + + switch kind { + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + return field.Int() > topField.Int() + + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: + return field.Uint() > topField.Uint() + + case reflect.Float32, reflect.Float64: + return field.Float() > topField.Float() + + case reflect.Slice, reflect.Map, reflect.Array: + return int64(field.Len()) > int64(topField.Len()) + + case reflect.Struct: + + fieldType := field.Type() + + if fieldType.ConvertibleTo(timeType) && topField.Type().ConvertibleTo(timeType) { + fieldTime := getValue(field.Convert(timeType)).(time.Time) + topTime := getValue(topField.Convert(timeType)).(time.Time) + + return fieldTime.After(topTime) + } + + // Not Same underlying type i.e. struct and time + if fieldType != topField.Type() { + return false + } + } + + // default reflect.String: + return field.String() > topField.String() +} + +// isNeCrossStructField is the validation function for validating that the current field's value is not equal to the field, within a separate struct, specified by the param's value. +func isNeCrossStructField(fl FieldLevel) bool { + field := fl.Field() + kind := field.Kind() + + topField, currentKind, ok := fl.GetStructFieldOK() + if !ok || currentKind != kind { + return true + } + + switch kind { + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + return topField.Int() != field.Int() + + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: + return topField.Uint() != field.Uint() + + case reflect.Float32, reflect.Float64: + return topField.Float() != field.Float() + + case reflect.Slice, reflect.Map, reflect.Array: + return int64(topField.Len()) != int64(field.Len()) + + case reflect.Bool: + return topField.Bool() != field.Bool() + + case reflect.Struct: + + fieldType := field.Type() + + if fieldType.ConvertibleTo(timeType) && topField.Type().ConvertibleTo(timeType) { + t := getValue(field.Convert(timeType)).(time.Time) + fieldTime := getValue(topField.Convert(timeType)).(time.Time) + + return !fieldTime.Equal(t) + } + + // Not Same underlying type i.e. struct and time + if fieldType != topField.Type() { + return true + } + } + + // default reflect.String: + return topField.String() != field.String() +} + +// isEqCrossStructField is the validation function for validating that the current field's value is equal to the field, within a separate struct, specified by the param's value. +func isEqCrossStructField(fl FieldLevel) bool { + field := fl.Field() + kind := field.Kind() + + topField, topKind, ok := fl.GetStructFieldOK() + if !ok || topKind != kind { + return false + } + + switch kind { + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + return topField.Int() == field.Int() + + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: + return topField.Uint() == field.Uint() + + case reflect.Float32, reflect.Float64: + return topField.Float() == field.Float() + + case reflect.Slice, reflect.Map, reflect.Array: + return int64(topField.Len()) == int64(field.Len()) + + case reflect.Bool: + return topField.Bool() == field.Bool() + + case reflect.Struct: + + fieldType := field.Type() + + if fieldType.ConvertibleTo(timeType) && topField.Type().ConvertibleTo(timeType) { + t := getValue(field.Convert(timeType)).(time.Time) + fieldTime := getValue(topField.Convert(timeType)).(time.Time) + + return fieldTime.Equal(t) + } + + // Not Same underlying type i.e. struct and time + if fieldType != topField.Type() { + return false + } + } + + // default reflect.String: + return topField.String() == field.String() +} + +// isEqField is the validation function for validating if the current field's value is equal to the field specified by the param's value. +func isEqField(fl FieldLevel) bool { + field := fl.Field() + kind := field.Kind() + + currentField, currentKind, ok := fl.GetStructFieldOK() + if !ok || currentKind != kind { + return false + } + + switch kind { + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + return field.Int() == currentField.Int() + + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: + return field.Uint() == currentField.Uint() + + case reflect.Float32, reflect.Float64: + return field.Float() == currentField.Float() + + case reflect.Slice, reflect.Map, reflect.Array: + return int64(field.Len()) == int64(currentField.Len()) + + case reflect.Bool: + return field.Bool() == currentField.Bool() + + case reflect.Struct: + + fieldType := field.Type() + + if fieldType.ConvertibleTo(timeType) && currentField.Type().ConvertibleTo(timeType) { + t := getValue(currentField.Convert(timeType)).(time.Time) + fieldTime := getValue(field.Convert(timeType)).(time.Time) + + return fieldTime.Equal(t) + } + + // Not Same underlying type i.e. struct and time + if fieldType != currentField.Type() { + return false + } + } + + // default reflect.String: + return field.String() == currentField.String() +} + +// isEq is the validation function for validating if the current field's value is equal to the param's value. +func isEq(fl FieldLevel) bool { + field := fl.Field() + param := fl.Param() + + switch field.Kind() { + case reflect.String: + return field.String() == param + + case reflect.Slice, reflect.Map, reflect.Array: + p := asInt(param) + + return int64(field.Len()) == p + + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + p := asIntFromType(field.Type(), param) + + return field.Int() == p + + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: + p := asUint(param) + + return field.Uint() == p + + case reflect.Float32: + p := asFloat32(param) + + return field.Float() == p + + case reflect.Float64: + p := asFloat64(param) + + return field.Float() == p + + case reflect.Bool: + p := asBool(param) + + return field.Bool() == p + } + + panic(fmt.Sprintf("Bad field type %s", field.Type())) +} + +// isEqIgnoreCase is the validation function for validating if the current field's string value is +// equal to the param's value. +// The comparison is case-insensitive. +func isEqIgnoreCase(fl FieldLevel) bool { + field := fl.Field() + param := fl.Param() + + switch field.Kind() { + case reflect.String: + return strings.EqualFold(field.String(), param) + } + + panic(fmt.Sprintf("Bad field type %s", field.Type())) +} + +// isPostcodeByIso3166Alpha2 validates by value which is country code in iso 3166 alpha 2 +// example: `postcode_iso3166_alpha2=US` +func isPostcodeByIso3166Alpha2(fl FieldLevel) bool { + field := fl.Field() + param := fl.Param() + + postcodeRegexInit.Do(initPostcodes) + reg, found := postCodeRegexDict[param] + if !found { + return false + } + + return reg.MatchString(field.String()) +} + +// isPostcodeByIso3166Alpha2Field validates by field which represents for a value of country code in iso 3166 alpha 2 +// example: `postcode_iso3166_alpha2_field=CountryCode` +func isPostcodeByIso3166Alpha2Field(fl FieldLevel) bool { + field := fl.Field() + params := parseOneOfParam2(fl.Param()) + + if len(params) != 1 { + return false + } + + currentField, kind, _, found := fl.GetStructFieldOKAdvanced2(fl.Parent(), params[0]) + if !found { + return false + } + + if kind != reflect.String { + panic(fmt.Sprintf("Bad field type %s", currentField.Type())) + } + + postcodeRegexInit.Do(initPostcodes) + reg, found := postCodeRegexDict[currentField.String()] + if !found { + return false + } + + return reg.MatchString(field.String()) +} + +// isBase32 is the validation function for validating if the current field's value is a valid base 32. +func isBase32(fl FieldLevel) bool { + return base32Regex().MatchString(fl.Field().String()) +} + +// isBase64 is the validation function for validating if the current field's value is a valid base 64. +func isBase64(fl FieldLevel) bool { + return base64Regex().MatchString(fl.Field().String()) +} + +// isBase64URL is the validation function for validating if the current field's value is a valid base64 URL safe string. +func isBase64URL(fl FieldLevel) bool { + return base64URLRegex().MatchString(fl.Field().String()) +} + +// isBase64RawURL is the validation function for validating if the current field's value is a valid base64 URL safe string without '=' padding. +func isBase64RawURL(fl FieldLevel) bool { + return base64RawURLRegex().MatchString(fl.Field().String()) +} + +// isURI is the validation function for validating if the current field's value is a valid URI. +func isURI(fl FieldLevel) bool { + field := fl.Field() + + switch field.Kind() { + case reflect.String: + + s := field.String() + + // checks needed as of Go 1.6 because of change https://github.com/golang/go/commit/617c93ce740c3c3cc28cdd1a0d712be183d0b328#diff-6c2d018290e298803c0c9419d8739885L195 + // emulate browser and strip the '#' suffix prior to validation. see issue-#237 + if i := strings.Index(s, "#"); i > -1 { + s = s[:i] + } + + if len(s) == 0 { + return false + } + + _, err := url.ParseRequestURI(s) + + return err == nil + } + + panic(fmt.Sprintf("Bad field type %s", field.Type())) +} + +// isURL is the validation function for validating if the current field's value is a valid URL. +func isURL(fl FieldLevel) bool { + field := fl.Field() + + switch field.Kind() { + case reflect.String: + + s := strings.ToLower(field.String()) + + if len(s) == 0 { + return false + } + + url, err := url.Parse(s) + if err != nil || url.Scheme == "" { + return false + } + isFileScheme := url.Scheme == "file" + + if (isFileScheme && (len(url.Path) == 0 || url.Path == "/")) || (!isFileScheme && len(url.Host) == 0 && len(url.Fragment) == 0 && len(url.Opaque) == 0) { + return false + } + + return true + } + + panic(fmt.Sprintf("Bad field type %s", field.Type())) +} + +// isHttpURL is the validation function for validating if the current field's value is a valid HTTP(s) URL. +func isHttpURL(fl FieldLevel) bool { + if !isURL(fl) { + return false + } + + field := fl.Field() + switch field.Kind() { + case reflect.String: + + s := strings.ToLower(field.String()) + + url, err := url.Parse(s) + if err != nil || url.Host == "" { + return false + } + + return url.Scheme == "http" || url.Scheme == "https" + } + + panic(fmt.Sprintf("Bad field type %s", field.Type())) +} + +// isUrnRFC2141 is the validation function for validating if the current field's value is a valid URN as per RFC 2141. +func isUrnRFC2141(fl FieldLevel) bool { + field := fl.Field() + + switch field.Kind() { + case reflect.String: + + str := field.String() + + _, match := urn.Parse([]byte(str)) + + return match + } + + panic(fmt.Sprintf("Bad field type %s", field.Type())) +} + +// isFile is the validation function for validating if the current field's value is a valid existing file path. +func isFile(fl FieldLevel) bool { + field := fl.Field() + + switch field.Kind() { + case reflect.String: + fileInfo, err := os.Stat(field.String()) + if err != nil { + return false + } + + return !fileInfo.IsDir() + } + + panic(fmt.Sprintf("Bad field type %s", field.Type())) +} + +// isImage is the validation function for validating if the current field's value contains the path to a valid image file +func isImage(fl FieldLevel) bool { + mimetypes := map[string]bool{ + "image/bmp": true, + "image/cis-cod": true, + "image/gif": true, + "image/ief": true, + "image/jpeg": true, + "image/jp2": true, + "image/jpx": true, + "image/jpm": true, + "image/pipeg": true, + "image/png": true, + "image/svg+xml": true, + "image/tiff": true, + "image/webp": true, + "image/x-cmu-raster": true, + "image/x-cmx": true, + "image/x-icon": true, + "image/x-portable-anymap": true, + "image/x-portable-bitmap": true, + "image/x-portable-graymap": true, + "image/x-portable-pixmap": true, + "image/x-rgb": true, + "image/x-xbitmap": true, + "image/x-xpixmap": true, + "image/x-xwindowdump": true, + } + field := fl.Field() + + switch field.Kind() { + case reflect.String: + filePath := field.String() + fileInfo, err := os.Stat(filePath) + if err != nil { + return false + } + + if fileInfo.IsDir() { + return false + } + + file, err := os.Open(filePath) + if err != nil { + return false + } + defer func() { + _ = file.Close() + }() + + mime, err := mimetype.DetectReader(file) + if err != nil { + return false + } + + if _, ok := mimetypes[mime.String()]; ok { + return true + } + } + + panic(fmt.Sprintf("Bad field type %s", field.Type())) +} + +// isFilePath is the validation function for validating if the current field's value is a valid file path. +func isFilePath(fl FieldLevel) bool { + var exists bool + var err error + + field := fl.Field() + + // Not valid if it is a directory. + if isDir(fl) { + return false + } + // If it exists, it obviously is valid. + // This is done first to avoid code duplication and unnecessary additional logic. + if exists = isFile(fl); exists { + return true + } + + // It does not exist but may still be a valid filepath. + switch field.Kind() { + case reflect.String: + // Every OS allows for whitespace, but none + // let you use a file with no filename (to my knowledge). + // Unless you're dealing with raw inodes, but I digress. + if strings.TrimSpace(field.String()) == "" { + return false + } + // We make sure it isn't a directory. + if strings.HasSuffix(field.String(), string(os.PathSeparator)) { + return false + } + if _, err = os.Stat(field.String()); err != nil { + switch t := err.(type) { + case *fs.PathError: + if t.Err == syscall.EINVAL { + // It's definitely an invalid character in the filepath. + return false + } + // It could be a permission error, a does-not-exist error, etc. + // Out-of-scope for this validation, though. + return true + default: + // Something went *seriously* wrong. + /* + Per https://pkg.go.dev/os#Stat: + "If there is an error, it will be of type *PathError." + */ + panic(err) + } + } + } + + panic(fmt.Sprintf("Bad field type %s", field.Type())) +} + +// isE164 is the validation function for validating if the current field's value is a valid e.164 formatted phone number. +func isE164(fl FieldLevel) bool { + return e164Regex().MatchString(fl.Field().String()) +} + +// isEmail is the validation function for validating if the current field's value is a valid email address. +func isEmail(fl FieldLevel) bool { + _, err := mail.ParseAddress(fl.Field().String()) + if err != nil { + return false + } + return emailRegex().MatchString(fl.Field().String()) +} + +// isHSLA is the validation function for validating if the current field's value is a valid HSLA color. +func isHSLA(fl FieldLevel) bool { + return hslaRegex().MatchString(fl.Field().String()) +} + +// isHSL is the validation function for validating if the current field's value is a valid HSL color. +func isHSL(fl FieldLevel) bool { + return hslRegex().MatchString(fl.Field().String()) +} + +// isRGBA is the validation function for validating if the current field's value is a valid RGBA color. +func isRGBA(fl FieldLevel) bool { + return rgbaRegex().MatchString(fl.Field().String()) +} + +// isRGB is the validation function for validating if the current field's value is a valid RGB color. +func isRGB(fl FieldLevel) bool { + return rgbRegex().MatchString(fl.Field().String()) +} + +// isHEXColor is the validation function for validating if the current field's value is a valid HEX color. +func isHEXColor(fl FieldLevel) bool { + return hexColorRegex().MatchString(fl.Field().String()) +} + +// isHexadecimal is the validation function for validating if the current field's value is a valid hexadecimal. +func isHexadecimal(fl FieldLevel) bool { + return hexadecimalRegex().MatchString(fl.Field().String()) +} + +// isNumber is the validation function for validating if the current field's value is a valid number. +func isNumber(fl FieldLevel) bool { + switch fl.Field().Kind() { + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64, reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr, reflect.Float32, reflect.Float64: + return true + default: + return numberRegex().MatchString(fl.Field().String()) + } +} + +// isNumeric is the validation function for validating if the current field's value is a valid numeric value. +func isNumeric(fl FieldLevel) bool { + switch fl.Field().Kind() { + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64, reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr, reflect.Float32, reflect.Float64: + return true + default: + return numericRegex().MatchString(fl.Field().String()) + } +} + +// isAlphanum is the validation function for validating if the current field's value is a valid alphanumeric value. +func isAlphanum(fl FieldLevel) bool { + return alphaNumericRegex().MatchString(fl.Field().String()) +} + +// isAlpha is the validation function for validating if the current field's value is a valid alpha value. +func isAlpha(fl FieldLevel) bool { + return alphaRegex().MatchString(fl.Field().String()) +} + +// isAlphanumUnicode is the validation function for validating if the current field's value is a valid alphanumeric unicode value. +func isAlphanumUnicode(fl FieldLevel) bool { + return alphaUnicodeNumericRegex().MatchString(fl.Field().String()) +} + +// isAlphaUnicode is the validation function for validating if the current field's value is a valid alpha unicode value. +func isAlphaUnicode(fl FieldLevel) bool { + return alphaUnicodeRegex().MatchString(fl.Field().String()) +} + +// isBoolean is the validation function for validating if the current field's value is a valid boolean value or can be safely converted to a boolean value. +func isBoolean(fl FieldLevel) bool { + switch fl.Field().Kind() { + case reflect.Bool: + return true + default: + _, err := strconv.ParseBool(fl.Field().String()) + return err == nil + } +} + +// isDefault is the opposite of required aka hasValue +func isDefault(fl FieldLevel) bool { + return !hasValue(fl) +} + +// hasValue is the validation function for validating if the current field's value is not the default static value. +func hasValue(fl FieldLevel) bool { + field := fl.Field() + switch field.Kind() { + case reflect.Slice, reflect.Map, reflect.Ptr, reflect.Interface, reflect.Chan, reflect.Func: + return !field.IsNil() + default: + if fl.(*validate).fldIsPointer && getValue(field) != nil { + return true + } + return field.IsValid() && !field.IsZero() + } +} + +// hasNotZeroValue is the validation function for validating if the current field's value is not the zero value for its type. +func hasNotZeroValue(fl FieldLevel) bool { + field := fl.Field() + switch field.Kind() { + case reflect.Slice, reflect.Map: + // For slices and maps, consider them "not zero" only if they're both non-nil AND have elements + return !field.IsNil() && field.Len() > 0 + case reflect.Ptr, reflect.Interface, reflect.Chan, reflect.Func: + return !field.IsNil() + default: + if fl.(*validate).fldIsPointer && getValue(field) != nil { + return !field.IsZero() + } + return field.IsValid() && !field.IsZero() + } +} + +// requireCheckFieldKind is a func for check field kind +func requireCheckFieldKind(fl FieldLevel, param string, defaultNotFoundValue bool) bool { + field := fl.Field() + kind := field.Kind() + var nullable, found bool + if len(param) > 0 { + field, kind, nullable, found = fl.GetStructFieldOKAdvanced2(fl.Parent(), param) + if !found { + return defaultNotFoundValue + } + } + switch kind { + case reflect.Invalid: + return defaultNotFoundValue + case reflect.Slice, reflect.Map, reflect.Ptr, reflect.Interface, reflect.Chan, reflect.Func: + return field.IsNil() + default: + if nullable && getValue(field) != nil { + return false + } + return field.IsValid() && field.IsZero() + } +} + +// requireCheckFieldValue is a func for check field value +func requireCheckFieldValue( + fl FieldLevel, param string, value string, defaultNotFoundValue bool, +) bool { + field, kind, _, found := fl.GetStructFieldOKAdvanced2(fl.Parent(), param) + if !found { + return defaultNotFoundValue + } + + switch kind { + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + return field.Int() == asInt(value) + + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: + return field.Uint() == asUint(value) + + case reflect.Float32: + return field.Float() == asFloat32(value) + + case reflect.Float64: + return field.Float() == asFloat64(value) + + case reflect.Slice, reflect.Map: + if value == "nil" { + return field.IsNil() + } + return int64(field.Len()) == asInt(value) + case reflect.Array: + // Arrays can't be nil, so only compare lengths + return int64(field.Len()) == asInt(value) + + case reflect.Bool: + return field.Bool() == (value == "true") + + case reflect.Ptr: + if field.IsNil() { + return value == "nil" + } + // Handle non-nil pointers + return requireCheckFieldValue(fl, param, value, defaultNotFoundValue) + } + + // default reflect.String: + return field.String() == value +} + +// requiredIf is the validation function +// The field under validation must be present and not empty only if all the other specified fields are equal to the value following with the specified field. +func requiredIf(fl FieldLevel) bool { + params := parseOneOfParam2(fl.Param()) + if len(params)%2 != 0 { + panic(fmt.Sprintf("Bad param number for required_if %s", fl.FieldName())) + } + for i := 0; i < len(params); i += 2 { + if !requireCheckFieldValue(fl, params[i], params[i+1], false) { + return true + } + } + return hasValue(fl) +} + +// excludedIf is the validation function +// The field under validation must not be present or is empty only if all the other specified fields are equal to the value following with the specified field. +func excludedIf(fl FieldLevel) bool { + params := parseOneOfParam2(fl.Param()) + if len(params)%2 != 0 { + panic(fmt.Sprintf("Bad param number for excluded_if %s", fl.FieldName())) + } + + for i := 0; i < len(params); i += 2 { + if !requireCheckFieldValue(fl, params[i], params[i+1], false) { + return true + } + } + return !hasValue(fl) +} + +// requiredUnless is the validation function +// The field under validation must be present and not empty only unless all the other specified fields are equal to the value following with the specified field. +func requiredUnless(fl FieldLevel) bool { + params := parseOneOfParam2(fl.Param()) + if len(params)%2 != 0 { + panic(fmt.Sprintf("Bad param number for required_unless %s", fl.FieldName())) + } + + for i := 0; i < len(params); i += 2 { + if requireCheckFieldValue(fl, params[i], params[i+1], false) { + return true + } + } + return hasValue(fl) +} + +// skipUnless is the validation function +// The field under validation must be present and not empty only unless all the other specified fields are equal to the value following with the specified field. +func skipUnless(fl FieldLevel) bool { + params := parseOneOfParam2(fl.Param()) + if len(params)%2 != 0 { + panic(fmt.Sprintf("Bad param number for skip_unless %s", fl.FieldName())) + } + for i := 0; i < len(params); i += 2 { + if !requireCheckFieldValue(fl, params[i], params[i+1], false) { + return true + } + } + return hasValue(fl) +} + +// excludedUnless is the validation function +// The field under validation must not be present or is empty unless all the other specified fields are equal to the value following with the specified field. +func excludedUnless(fl FieldLevel) bool { + params := parseOneOfParam2(fl.Param()) + if len(params)%2 != 0 { + panic(fmt.Sprintf("Bad param number for excluded_unless %s", fl.FieldName())) + } + for i := 0; i < len(params); i += 2 { + if !requireCheckFieldValue(fl, params[i], params[i+1], false) { + return !hasValue(fl) + } + } + return true +} + +// excludedWith is the validation function +// The field under validation must not be present or is empty if any of the other specified fields are present. +func excludedWith(fl FieldLevel) bool { + params := parseOneOfParam2(fl.Param()) + for _, param := range params { + if !requireCheckFieldKind(fl, param, true) { + return !hasValue(fl) + } + } + return true +} + +// requiredWith is the validation function +// The field under validation must be present and not empty only if any of the other specified fields are present. +func requiredWith(fl FieldLevel) bool { + params := parseOneOfParam2(fl.Param()) + for _, param := range params { + if !requireCheckFieldKind(fl, param, true) { + return hasValue(fl) + } + } + return true +} + +// excludedWithAll is the validation function +// The field under validation must not be present or is empty if all of the other specified fields are present. +func excludedWithAll(fl FieldLevel) bool { + params := parseOneOfParam2(fl.Param()) + for _, param := range params { + if requireCheckFieldKind(fl, param, true) { + return true + } + } + return !hasValue(fl) +} + +// requiredWithAll is the validation function +// The field under validation must be present and not empty only if all of the other specified fields are present. +func requiredWithAll(fl FieldLevel) bool { + params := parseOneOfParam2(fl.Param()) + for _, param := range params { + if requireCheckFieldKind(fl, param, true) { + return true + } + } + return hasValue(fl) +} + +// excludedWithout is the validation function +// The field under validation must not be present or is empty when any of the other specified fields are not present. +func excludedWithout(fl FieldLevel) bool { + if requireCheckFieldKind(fl, strings.TrimSpace(fl.Param()), true) { + return !hasValue(fl) + } + return true +} + +// requiredWithout is the validation function +// The field under validation must be present and not empty only when any of the other specified fields are not present. +func requiredWithout(fl FieldLevel) bool { + params := parseOneOfParam2(fl.Param()) + for _, param := range params { + if requireCheckFieldKind(fl, param, true) { + return hasValue(fl) + } + } + return true +} + +// excludedWithoutAll is the validation function +// The field under validation must not be present or is empty when all of the other specified fields are not present. +func excludedWithoutAll(fl FieldLevel) bool { + params := parseOneOfParam2(fl.Param()) + for _, param := range params { + if !requireCheckFieldKind(fl, param, true) { + return true + } + } + return !hasValue(fl) +} + +// requiredWithoutAll is the validation function +// The field under validation must be present and not empty only when all of the other specified fields are not present. +func requiredWithoutAll(fl FieldLevel) bool { + params := parseOneOfParam2(fl.Param()) + for _, param := range params { + if !requireCheckFieldKind(fl, param, true) { + return true + } + } + return hasValue(fl) +} + +// isGteField is the validation function for validating if the current field's value is greater than or equal to the field specified by the param's value. +func isGteField(fl FieldLevel) bool { + field := fl.Field() + kind := field.Kind() + + currentField, currentKind, ok := fl.GetStructFieldOK() + if !ok || currentKind != kind { + return false + } + + switch kind { + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + + return field.Int() >= currentField.Int() + + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: + + return field.Uint() >= currentField.Uint() + + case reflect.Float32, reflect.Float64: + + return field.Float() >= currentField.Float() + + case reflect.Struct: + + fieldType := field.Type() + + if fieldType.ConvertibleTo(timeType) && currentField.Type().ConvertibleTo(timeType) { + t := getValue(currentField.Convert(timeType)).(time.Time) + fieldTime := getValue(field.Convert(timeType)).(time.Time) + + return fieldTime.After(t) || fieldTime.Equal(t) + } + + // Not Same underlying type i.e. struct and time + if fieldType != currentField.Type() { + return false + } + } + + // default reflect.String + return len(field.String()) >= len(currentField.String()) +} + +// isGtField is the validation function for validating if the current field's value is greater than the field specified by the param's value. +func isGtField(fl FieldLevel) bool { + field := fl.Field() + kind := field.Kind() + + currentField, currentKind, ok := fl.GetStructFieldOK() + if !ok || currentKind != kind { + return false + } + + switch kind { + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + + return field.Int() > currentField.Int() + + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: + + return field.Uint() > currentField.Uint() + + case reflect.Float32, reflect.Float64: + + return field.Float() > currentField.Float() + + case reflect.Struct: + + fieldType := field.Type() + + if fieldType.ConvertibleTo(timeType) && currentField.Type().ConvertibleTo(timeType) { + t := getValue(currentField.Convert(timeType)).(time.Time) + fieldTime := getValue(field.Convert(timeType)).(time.Time) + + return fieldTime.After(t) + } + + // Not Same underlying type i.e. struct and time + if fieldType != currentField.Type() { + return false + } + } + + // default reflect.String + return len(field.String()) > len(currentField.String()) +} + +// isGte is the validation function for validating if the current field's value is greater than or equal to the param's value. +func isGte(fl FieldLevel) bool { + field := fl.Field() + param := fl.Param() + + switch field.Kind() { + case reflect.String: + p := asInt(param) + + return int64(utf8.RuneCountInString(field.String())) >= p + + case reflect.Slice, reflect.Map, reflect.Array: + p := asInt(param) + + return int64(field.Len()) >= p + + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + p := asIntFromType(field.Type(), param) + + return field.Int() >= p + + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: + p := asUint(param) + + return field.Uint() >= p + + case reflect.Float32: + p := asFloat32(param) + + return field.Float() >= p + + case reflect.Float64: + p := asFloat64(param) + + return field.Float() >= p + + case reflect.Struct: + + if field.Type().ConvertibleTo(timeType) { + now := time.Now().UTC() + t := getValue(field.Convert(timeType)).(time.Time) + + return t.After(now) || t.Equal(now) + } + } + + panic(fmt.Sprintf("Bad field type %s", field.Type())) +} + +// isGt is the validation function for validating if the current field's value is greater than the param's value. +func isGt(fl FieldLevel) bool { + field := fl.Field() + param := fl.Param() + + switch field.Kind() { + case reflect.String: + p := asInt(param) + + return int64(utf8.RuneCountInString(field.String())) > p + + case reflect.Slice, reflect.Map, reflect.Array: + p := asInt(param) + + return int64(field.Len()) > p + + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + p := asIntFromType(field.Type(), param) + + return field.Int() > p + + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: + p := asUint(param) + + return field.Uint() > p + + case reflect.Float32: + p := asFloat32(param) + + return field.Float() > p + + case reflect.Float64: + p := asFloat64(param) + + return field.Float() > p + + case reflect.Struct: + + if field.Type().ConvertibleTo(timeType) { + return getValue(field.Convert(timeType)).(time.Time).After(time.Now().UTC()) + } + } + + panic(fmt.Sprintf("Bad field type %s", field.Type())) +} + +// hasLengthOf is the validation function for validating if the current field's value is equal to the param's value. +func hasLengthOf(fl FieldLevel) bool { + field := fl.Field() + param := fl.Param() + + switch field.Kind() { + case reflect.String: + p := asInt(param) + + return int64(utf8.RuneCountInString(field.String())) == p + + case reflect.Slice, reflect.Map, reflect.Array: + p := asInt(param) + + return int64(field.Len()) == p + + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + p := asIntFromType(field.Type(), param) + + return field.Int() == p + + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: + p := asUint(param) + + return field.Uint() == p + + case reflect.Float32: + p := asFloat32(param) + + return field.Float() == p + + case reflect.Float64: + p := asFloat64(param) + + return field.Float() == p + } + + panic(fmt.Sprintf("Bad field type %s", field.Type())) +} + +// hasMinOf is the validation function for validating if the current field's value is greater than or equal to the param's value. +func hasMinOf(fl FieldLevel) bool { + return isGte(fl) +} + +// isLteField is the validation function for validating if the current field's value is less than or equal to the field specified by the param's value. +func isLteField(fl FieldLevel) bool { + field := fl.Field() + kind := field.Kind() + + currentField, currentKind, ok := fl.GetStructFieldOK() + if !ok || currentKind != kind { + return false + } + + switch kind { + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + + return field.Int() <= currentField.Int() + + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: + + return field.Uint() <= currentField.Uint() + + case reflect.Float32, reflect.Float64: + + return field.Float() <= currentField.Float() + + case reflect.Struct: + + fieldType := field.Type() + + if fieldType.ConvertibleTo(timeType) && currentField.Type().ConvertibleTo(timeType) { + t := getValue(currentField.Convert(timeType)).(time.Time) + fieldTime := getValue(field.Convert(timeType)).(time.Time) + + return fieldTime.Before(t) || fieldTime.Equal(t) + } + + // Not Same underlying type i.e. struct and time + if fieldType != currentField.Type() { + return false + } + } + + // default reflect.String + return len(field.String()) <= len(currentField.String()) +} + +// isLtField is the validation function for validating if the current field's value is less than the field specified by the param's value. +func isLtField(fl FieldLevel) bool { + field := fl.Field() + kind := field.Kind() + + currentField, currentKind, ok := fl.GetStructFieldOK() + if !ok || currentKind != kind { + return false + } + + switch kind { + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + + return field.Int() < currentField.Int() + + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: + + return field.Uint() < currentField.Uint() + + case reflect.Float32, reflect.Float64: + + return field.Float() < currentField.Float() + + case reflect.Struct: + + fieldType := field.Type() + + if fieldType.ConvertibleTo(timeType) && currentField.Type().ConvertibleTo(timeType) { + t := getValue(currentField.Convert(timeType)).(time.Time) + fieldTime := getValue(field.Convert(timeType)).(time.Time) + + return fieldTime.Before(t) + } + + // Not Same underlying type i.e. struct and time + if fieldType != currentField.Type() { + return false + } + } + + // default reflect.String + return len(field.String()) < len(currentField.String()) +} + +// isLte is the validation function for validating if the current field's value is less than or equal to the param's value. +func isLte(fl FieldLevel) bool { + field := fl.Field() + param := fl.Param() + + switch field.Kind() { + case reflect.String: + p := asInt(param) + + return int64(utf8.RuneCountInString(field.String())) <= p + + case reflect.Slice, reflect.Map, reflect.Array: + p := asInt(param) + + return int64(field.Len()) <= p + + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + p := asIntFromType(field.Type(), param) + + return field.Int() <= p + + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: + p := asUint(param) + + return field.Uint() <= p + + case reflect.Float32: + p := asFloat32(param) + + return field.Float() <= p + + case reflect.Float64: + p := asFloat64(param) + + return field.Float() <= p + + case reflect.Struct: + + if field.Type().ConvertibleTo(timeType) { + now := time.Now().UTC() + t := getValue(field.Convert(timeType)).(time.Time) + + return t.Before(now) || t.Equal(now) + } + } + + panic(fmt.Sprintf("Bad field type %s", field.Type())) +} + +// isLt is the validation function for validating if the current field's value is less than the param's value. +func isLt(fl FieldLevel) bool { + field := fl.Field() + param := fl.Param() + + switch field.Kind() { + case reflect.String: + p := asInt(param) + + return int64(utf8.RuneCountInString(field.String())) < p + + case reflect.Slice, reflect.Map, reflect.Array: + p := asInt(param) + + return int64(field.Len()) < p + + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + p := asIntFromType(field.Type(), param) + + return field.Int() < p + + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: + p := asUint(param) + + return field.Uint() < p + + case reflect.Float32: + p := asFloat32(param) + + return field.Float() < p + + case reflect.Float64: + p := asFloat64(param) + + return field.Float() < p + + case reflect.Struct: + + if field.Type().ConvertibleTo(timeType) { + return getValue(field.Convert(timeType)).(time.Time).Before(time.Now().UTC()) + } + } + + panic(fmt.Sprintf("Bad field type %s", field.Type())) +} + +// hasMaxOf is the validation function for validating if the current field's value is less than or equal to the param's value. +func hasMaxOf(fl FieldLevel) bool { + return isLte(fl) +} + +// isTCP4AddrResolvable is the validation function for validating if the field's value is a resolvable tcp4 address. +func isTCP4AddrResolvable(fl FieldLevel) bool { + if !isIP4Addr(fl) { + return false + } + + _, err := net.ResolveTCPAddr("tcp4", fl.Field().String()) + return err == nil +} + +// isTCP6AddrResolvable is the validation function for validating if the field's value is a resolvable tcp6 address. +func isTCP6AddrResolvable(fl FieldLevel) bool { + if !isIP6Addr(fl) { + return false + } + + _, err := net.ResolveTCPAddr("tcp6", fl.Field().String()) + + return err == nil +} + +// isTCPAddrResolvable is the validation function for validating if the field's value is a resolvable tcp address. +func isTCPAddrResolvable(fl FieldLevel) bool { + if !isIP4Addr(fl) && !isIP6Addr(fl) { + return false + } + + _, err := net.ResolveTCPAddr("tcp", fl.Field().String()) + + return err == nil +} + +// isUDP4AddrResolvable is the validation function for validating if the field's value is a resolvable udp4 address. +func isUDP4AddrResolvable(fl FieldLevel) bool { + if !isIP4Addr(fl) { + return false + } + + _, err := net.ResolveUDPAddr("udp4", fl.Field().String()) + + return err == nil +} + +// isUDP6AddrResolvable is the validation function for validating if the field's value is a resolvable udp6 address. +func isUDP6AddrResolvable(fl FieldLevel) bool { + if !isIP6Addr(fl) { + return false + } + + _, err := net.ResolveUDPAddr("udp6", fl.Field().String()) + + return err == nil +} + +// isUDPAddrResolvable is the validation function for validating if the field's value is a resolvable udp address. +func isUDPAddrResolvable(fl FieldLevel) bool { + if !isIP4Addr(fl) && !isIP6Addr(fl) { + return false + } + + _, err := net.ResolveUDPAddr("udp", fl.Field().String()) + + return err == nil +} + +// isIP4AddrResolvable is the validation function for validating if the field's value is a resolvable ip4 address. +func isIP4AddrResolvable(fl FieldLevel) bool { + if !isIPv4(fl) { + return false + } + + _, err := net.ResolveIPAddr("ip4", fl.Field().String()) + + return err == nil +} + +// isIP6AddrResolvable is the validation function for validating if the field's value is a resolvable ip6 address. +func isIP6AddrResolvable(fl FieldLevel) bool { + if !isIPv6(fl) { + return false + } + + _, err := net.ResolveIPAddr("ip6", fl.Field().String()) + + return err == nil +} + +// isIPAddrResolvable is the validation function for validating if the field's value is a resolvable ip address. +func isIPAddrResolvable(fl FieldLevel) bool { + if !isIP(fl) { + return false + } + + _, err := net.ResolveIPAddr("ip", fl.Field().String()) + + return err == nil +} + +// isUnixAddrResolvable is the validation function for validating if the field's value is a resolvable unix address. +func isUnixAddrResolvable(fl FieldLevel) bool { + _, err := net.ResolveUnixAddr("unix", fl.Field().String()) + + return err == nil +} + +func isIP4Addr(fl FieldLevel) bool { + val := fl.Field().String() + + if idx := strings.LastIndex(val, ":"); idx != -1 { + val = val[0:idx] + } + + ip := net.ParseIP(val) + + return ip != nil && ip.To4() != nil +} + +func isIP6Addr(fl FieldLevel) bool { + val := fl.Field().String() + + if idx := strings.LastIndex(val, ":"); idx != -1 { + if idx != 0 && val[idx-1:idx] == "]" { + val = val[1 : idx-1] + } + } + + ip := net.ParseIP(val) + + return ip != nil && ip.To4() == nil +} + +func isHostnameRFC952(fl FieldLevel) bool { + return hostnameRegexRFC952().MatchString(fl.Field().String()) +} + +func isHostnameRFC1123(fl FieldLevel) bool { + return hostnameRegexRFC1123().MatchString(fl.Field().String()) +} + +func isFQDN(fl FieldLevel) bool { + val := fl.Field().String() + + if val == "" { + return false + } + + return fqdnRegexRFC1123().MatchString(val) +} + +// isDir is the validation function for validating if the current field's value is a valid existing directory. +func isDir(fl FieldLevel) bool { + field := fl.Field() + + if field.Kind() == reflect.String { + fileInfo, err := os.Stat(field.String()) + if err != nil { + return false + } + + return fileInfo.IsDir() + } + + panic(fmt.Sprintf("Bad field type %s", field.Type())) +} + +// isDirPath is the validation function for validating if the current field's value is a valid directory. +func isDirPath(fl FieldLevel) bool { + var exists bool + var err error + + field := fl.Field() + + // If it exists, it obviously is valid. + // This is done first to avoid code duplication and unnecessary additional logic. + if exists = isDir(fl); exists { + return true + } + + // It does not exist but may still be a valid path. + switch field.Kind() { + case reflect.String: + // Every OS allows for whitespace, but none + // let you use a dir with no name (to my knowledge). + // Unless you're dealing with raw inodes, but I digress. + if strings.TrimSpace(field.String()) == "" { + return false + } + if _, err = os.Stat(field.String()); err != nil { + switch t := err.(type) { + case *fs.PathError: + if t.Err == syscall.EINVAL { + // It's definitely an invalid character in the path. + return false + } + // It could be a permission error, a does-not-exist error, etc. + // Out-of-scope for this validation, though. + // Lastly, we make sure it is a directory. + if strings.HasSuffix(field.String(), string(os.PathSeparator)) { + return true + } else { + return false + } + default: + // Something went *seriously* wrong. + /* + Per https://pkg.go.dev/os#Stat: + "If there is an error, it will be of type *PathError." + */ + panic(err) + } + } + // We repeat the check here to make sure it is an explicit directory in case the above os.Stat didn't trigger an error. + if strings.HasSuffix(field.String(), string(os.PathSeparator)) { + return true + } else { + return false + } + } + + panic(fmt.Sprintf("Bad field type %s", field.Type())) +} + +// isJSON is the validation function for validating if the current field's value is a valid json string. +func isJSON(fl FieldLevel) bool { + field := fl.Field() + + switch field.Kind() { + case reflect.String: + val := field.String() + return json.Valid([]byte(val)) + case reflect.Slice: + fieldType := field.Type() + + if fieldType.ConvertibleTo(byteSliceType) { + b := getValue(field.Convert(byteSliceType)).([]byte) + return json.Valid(b) + } + } + + panic(fmt.Sprintf("Bad field type %s", field.Type())) +} + +// isJWT is the validation function for validating if the current field's value is a valid JWT string. +func isJWT(fl FieldLevel) bool { + return jWTRegex().MatchString(fl.Field().String()) +} + +// isHostnamePort validates a : combination for fields typically used for socket address. +func isHostnamePort(fl FieldLevel) bool { + val := fl.Field().String() + host, port, err := net.SplitHostPort(val) + if err != nil { + return false + } + // Port must be a iny <= 65535. + if portNum, err := strconv.ParseInt( + port, 10, 32, + ); err != nil || portNum > 65535 || portNum < 1 { + return false + } + + // If host is specified, it should match a DNS name + if host != "" { + return hostnameRegexRFC1123().MatchString(host) + } + return true +} + +// IsPort validates if the current field's value represents a valid port +func isPort(fl FieldLevel) bool { + val := fl.Field().Uint() + + return val >= 1 && val <= 65535 +} + +// isLowercase is the validation function for validating if the current field's value is a lowercase string. +func isLowercase(fl FieldLevel) bool { + field := fl.Field() + + if field.Kind() == reflect.String { + if field.String() == "" { + return false + } + return field.String() == strings.ToLower(field.String()) + } + + panic(fmt.Sprintf("Bad field type %s", field.Type())) +} + +// isUppercase is the validation function for validating if the current field's value is an uppercase string. +func isUppercase(fl FieldLevel) bool { + field := fl.Field() + + if field.Kind() == reflect.String { + if field.String() == "" { + return false + } + return field.String() == strings.ToUpper(field.String()) + } + + panic(fmt.Sprintf("Bad field type %s", field.Type())) +} + +// isDatetime is the validation function for validating if the current field's value is a valid datetime string. +func isDatetime(fl FieldLevel) bool { + field := fl.Field() + param := fl.Param() + + if field.Kind() == reflect.String { + _, err := time.Parse(param, field.String()) + + return err == nil + } + + panic(fmt.Sprintf("Bad field type %s", field.Type())) +} + +// isTimeZone is the validation function for validating if the current field's value is a valid time zone string. +func isTimeZone(fl FieldLevel) bool { + field := fl.Field() + + if field.Kind() == reflect.String { + // empty value is converted to UTC by time.LoadLocation but disallow it as it is not a valid time zone name + if field.String() == "" { + return false + } + + // Local value is converted to the current system time zone by time.LoadLocation but disallow it as it is not a valid time zone name + if strings.ToLower(field.String()) == "local" { + return false + } + + _, err := time.LoadLocation(field.String()) + return err == nil + } + + panic(fmt.Sprintf("Bad field type %s", field.Type())) +} + +// isIso3166Alpha2 is the validation function for validating if the current field's value is a valid iso3166-1 alpha-2 country code. +func isIso3166Alpha2(fl FieldLevel) bool { + _, ok := iso3166_1_alpha2[fl.Field().String()] + return ok +} + +// isIso3166Alpha2EU is the validation function for validating if the current field's value is a valid iso3166-1 alpha-2 European Union country code. +func isIso3166Alpha2EU(fl FieldLevel) bool { + _, ok := iso3166_1_alpha2_eu[fl.Field().String()] + return ok +} + +// isIso3166Alpha3 is the validation function for validating if the current field's value is a valid iso3166-1 alpha-3 country code. +func isIso3166Alpha3(fl FieldLevel) bool { + _, ok := iso3166_1_alpha3[fl.Field().String()] + return ok +} + +// isIso3166Alpha3EU is the validation function for validating if the current field's value is a valid iso3166-1 alpha-3 European Union country code. +func isIso3166Alpha3EU(fl FieldLevel) bool { + _, ok := iso3166_1_alpha3_eu[fl.Field().String()] + return ok +} + +// isIso3166AlphaNumeric is the validation function for validating if the current field's value is a valid iso3166-1 alpha-numeric country code. +func isIso3166AlphaNumeric(fl FieldLevel) bool { + field := fl.Field() + + var code int + switch field.Kind() { + case reflect.String: + i, err := strconv.Atoi(field.String()) + if err != nil { + return false + } + code = i % 1000 + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + code = int(field.Int() % 1000) + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64: + code = int(field.Uint() % 1000) + default: + panic(fmt.Sprintf("Bad field type %s", field.Type())) + } + + _, ok := iso3166_1_alpha_numeric[code] + return ok +} + +// isIso3166AlphaNumericEU is the validation function for validating if the current field's value is a valid iso3166-1 alpha-numeric European Union country code. +func isIso3166AlphaNumericEU(fl FieldLevel) bool { + field := fl.Field() + + var code int + switch field.Kind() { + case reflect.String: + i, err := strconv.Atoi(field.String()) + if err != nil { + return false + } + code = i % 1000 + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + code = int(field.Int() % 1000) + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64: + code = int(field.Uint() % 1000) + default: + panic(fmt.Sprintf("Bad field type %s", field.Type())) + } + + _, ok := iso3166_1_alpha_numeric_eu[code] + return ok +} + +// isIso31662 is the validation function for validating if the current field's value is a valid iso3166-2 code. +func isIso31662(fl FieldLevel) bool { + _, ok := iso3166_2[fl.Field().String()] + return ok +} + +// isIso4217 is the validation function for validating if the current field's value is a valid iso4217 currency code. +func isIso4217(fl FieldLevel) bool { + _, ok := iso4217[fl.Field().String()] + return ok +} + +// isIso4217Numeric is the validation function for validating if the current field's value is a valid iso4217 numeric currency code. +func isIso4217Numeric(fl FieldLevel) bool { + field := fl.Field() + + var code int + switch field.Kind() { + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + code = int(field.Int()) + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64: + code = int(field.Uint()) + default: + panic(fmt.Sprintf("Bad field type %s", field.Type())) + } + + _, ok := iso4217_numeric[code] + return ok +} + +// isBCP47LanguageTag is the validation function for validating if the current field's value is a valid BCP 47 language tag, as parsed by language.Parse +func isBCP47LanguageTag(fl FieldLevel) bool { + field := fl.Field() + + if field.Kind() == reflect.String { + _, err := language.Parse(field.String()) + return err == nil + } + + panic(fmt.Sprintf("Bad field type %s", field.Type())) +} + +// isIsoBicFormat is the validation function for validating if the current field's value is a valid Business Identifier Code (SWIFT code), defined in ISO 9362 +func isIsoBicFormat(fl FieldLevel) bool { + bicString := fl.Field().String() + + return bicRegex().MatchString(bicString) +} + +// isSemverFormat is the validation function for validating if the current field's value is a valid semver version, defined in Semantic Versioning 2.0.0 +func isSemverFormat(fl FieldLevel) bool { + semverString := fl.Field().String() + + return semverRegex().MatchString(semverString) +} + +// isCveFormat is the validation function for validating if the current field's value is a valid cve id, defined in CVE mitre org +func isCveFormat(fl FieldLevel) bool { + cveString := fl.Field().String() + + return cveRegex().MatchString(cveString) +} + +// isDnsRFC1035LabelFormat is the validation function +// for validating if the current field's value is +// a valid dns RFC 1035 label, defined in RFC 1035. +func isDnsRFC1035LabelFormat(fl FieldLevel) bool { + val := fl.Field().String() + + size := len(val) + if size > 63 { + return false + } + + return dnsRegexRFC1035Label().MatchString(val) +} + +// digitsHaveLuhnChecksum returns true if and only if the last element of the given digits slice is the Luhn checksum of the previous elements +func digitsHaveLuhnChecksum(digits []string) bool { + size := len(digits) + sum := 0 + for i, digit := range digits { + value, err := strconv.Atoi(digit) + if err != nil { + return false + } + if size%2 == 0 && i%2 == 0 || size%2 == 1 && i%2 == 1 { + v := value * 2 + if v >= 10 { + sum += 1 + (v % 10) + } else { + sum += v + } + } else { + sum += value + } + } + return (sum % 10) == 0 +} + +// isMongoDBObjectId is the validation function for validating if the current field's value is valid MongoDB ObjectID +func isMongoDBObjectId(fl FieldLevel) bool { + val := fl.Field().String() + return mongodbIdRegex().MatchString(val) +} + +// isMongoDBConnectionString is the validation function for validating if the current field's value is valid MongoDB Connection String +func isMongoDBConnectionString(fl FieldLevel) bool { + val := fl.Field().String() + return mongodbConnectionRegex().MatchString(val) +} + +// isSpiceDB is the validation function for validating if the current field's value is valid for use with Authzed SpiceDB in the indicated way +func isSpiceDB(fl FieldLevel) bool { + val := fl.Field().String() + param := fl.Param() + + switch param { + case "permission": + return spicedbPermissionRegex().MatchString(val) + case "type": + return spicedbTypeRegex().MatchString(val) + case "id", "": + return spicedbIDRegex().MatchString(val) + } + + panic("Unrecognized parameter: " + param) +} + +// isCreditCard is the validation function for validating if the current field's value is a valid credit card number +func isCreditCard(fl FieldLevel) bool { + val := fl.Field().String() + var creditCard bytes.Buffer + segments := strings.Split(val, " ") + for _, segment := range segments { + if len(segment) < 3 { + return false + } + creditCard.WriteString(segment) + } + + ccDigits := strings.Split(creditCard.String(), "") + size := len(ccDigits) + if size < 12 || size > 19 { + return false + } + + return digitsHaveLuhnChecksum(ccDigits) +} + +// hasLuhnChecksum is the validation for validating if the current field's value has a valid Luhn checksum +func hasLuhnChecksum(fl FieldLevel) bool { + field := fl.Field() + var str string // convert to a string which will then be split into single digits; easier and more readable than shifting/extracting single digits from a number + switch field.Kind() { + case reflect.String: + str = field.String() + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + str = strconv.FormatInt(field.Int(), 10) + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64: + str = strconv.FormatUint(field.Uint(), 10) + default: + panic(fmt.Sprintf("Bad field type %s", field.Type())) + } + size := len(str) + if size < 2 { // there has to be at least one digit that carries a meaning + the checksum + return false + } + digits := strings.Split(str, "") + return digitsHaveLuhnChecksum(digits) +} + +// isCron is the validation function for validating if the current field's value is a valid cron expression +func isCron(fl FieldLevel) bool { + cronString := fl.Field().String() + return cronRegex().MatchString(cronString) +} + +// isEIN is the validation function for validating if the current field's value is a valid U.S. Employer Identification Number (EIN) +func isEIN(fl FieldLevel) bool { + field := fl.Field() + + if field.Len() != 10 { + return false + } + + return einRegex().MatchString(field.String()) +} + +func isValidateFn(fl FieldLevel) bool { + const defaultParam = `Validate` + + field := fl.Field() + validateFn := cmp.Or(fl.Param(), defaultParam) + + ok, err := tryCallValidateFn(field, validateFn) + if err != nil { + return false + } + + return ok +} + +var ( + errMethodNotFound = errors.New(`method not found`) + errMethodReturnNoValues = errors.New(`method return o values (void)`) + errMethodReturnInvalidType = errors.New(`method should return invalid type`) +) + +func tryCallValidateFn(field reflect.Value, validateFn string) (bool, error) { + method := field.MethodByName(validateFn) + if field.CanAddr() && !method.IsValid() { + method = field.Addr().MethodByName(validateFn) + } + + if !method.IsValid() { + return false, fmt.Errorf("unable to call %q on type %q: %w", + validateFn, field.Type().String(), errMethodNotFound) + } + + returnValues := method.Call([]reflect.Value{}) + if len(returnValues) == 0 { + return false, fmt.Errorf("unable to use result of method %q on type %q: %w", + validateFn, field.Type().String(), errMethodReturnNoValues) + } + + firstReturnValue := returnValues[0] + + switch firstReturnValue.Kind() { + case reflect.Bool: + return firstReturnValue.Bool(), nil + case reflect.Interface: + errorType := reflect.TypeOf((*error)(nil)).Elem() + + if firstReturnValue.Type().Implements(errorType) { + return firstReturnValue.IsNil(), nil + } + + return false, fmt.Errorf("unable to use result of method %q on type %q: %w (got interface %v expect error)", + validateFn, field.Type().String(), errMethodReturnInvalidType, firstReturnValue.Type().String()) + default: + return false, fmt.Errorf("unable to use result of method %q on type %q: %w (got %v expect error or bool)", + validateFn, field.Type().String(), errMethodReturnInvalidType, firstReturnValue.Type().String()) + } +} diff --git a/vendor/github.com/go-playground/validator/v10/cache.go b/vendor/github.com/go-playground/validator/v10/cache.go new file mode 100644 index 00000000..fb101b06 --- /dev/null +++ b/vendor/github.com/go-playground/validator/v10/cache.go @@ -0,0 +1,326 @@ +package validator + +import ( + "fmt" + "reflect" + "strings" + "sync" + "sync/atomic" +) + +type tagType uint8 + +const ( + typeDefault tagType = iota + typeOmitEmpty + typeIsDefault + typeNoStructLevel + typeStructOnly + typeDive + typeOr + typeKeys + typeEndKeys + typeOmitNil + typeOmitZero +) + +const ( + invalidValidation = "Invalid validation tag on field '%s'" + undefinedValidation = "Undefined validation function '%s' on field '%s'" + keysTagNotDefined = "'" + endKeysTag + "' tag encountered without a corresponding '" + keysTag + "' tag" +) + +type structCache struct { + lock sync.Mutex + m atomic.Value // map[reflect.Type]*cStruct +} + +func (sc *structCache) Get(key reflect.Type) (c *cStruct, found bool) { + c, found = sc.m.Load().(map[reflect.Type]*cStruct)[key] + return +} + +func (sc *structCache) Set(key reflect.Type, value *cStruct) { + m := sc.m.Load().(map[reflect.Type]*cStruct) + nm := make(map[reflect.Type]*cStruct, len(m)+1) + for k, v := range m { + nm[k] = v + } + nm[key] = value + sc.m.Store(nm) +} + +type tagCache struct { + lock sync.Mutex + m atomic.Value // map[string]*cTag +} + +func (tc *tagCache) Get(key string) (c *cTag, found bool) { + c, found = tc.m.Load().(map[string]*cTag)[key] + return +} + +func (tc *tagCache) Set(key string, value *cTag) { + m := tc.m.Load().(map[string]*cTag) + nm := make(map[string]*cTag, len(m)+1) + for k, v := range m { + nm[k] = v + } + nm[key] = value + tc.m.Store(nm) +} + +type cStruct struct { + name string + fields []*cField + fn StructLevelFuncCtx +} + +type cField struct { + idx int + name string + altName string + namesEqual bool + cTags *cTag +} + +type cTag struct { + tag string + aliasTag string + actualAliasTag string + param string + keys *cTag // only populated when using tag's 'keys' and 'endkeys' for map key validation + next *cTag + fn FuncCtx + typeof tagType + hasTag bool + hasAlias bool + hasParam bool // true if parameter used eg. eq= where the equal sign has been set + isBlockEnd bool // indicates the current tag represents the last validation in the block + runValidationWhenNil bool +} + +func (v *Validate) extractStructCache(current reflect.Value, sName string) *cStruct { + v.structCache.lock.Lock() + defer v.structCache.lock.Unlock() // leave as defer! because if inner panics, it will never get unlocked otherwise! + + typ := current.Type() + + // could have been multiple trying to access, but once first is done this ensures struct + // isn't parsed again. + cs, ok := v.structCache.Get(typ) + if ok { + return cs + } + + cs = &cStruct{name: sName, fields: make([]*cField, 0), fn: v.structLevelFuncs[typ]} + + numFields := current.NumField() + rules := v.rules[typ] + + var ctag *cTag + var fld reflect.StructField + var tag string + var customName string + + for i := 0; i < numFields; i++ { + fld = typ.Field(i) + + if !v.privateFieldValidation && !fld.Anonymous && len(fld.PkgPath) > 0 { + continue + } + + if rtag, ok := rules[fld.Name]; ok { + tag = rtag + } else { + tag = fld.Tag.Get(v.tagName) + } + + if tag == skipValidationTag { + continue + } + + customName = fld.Name + + if v.hasTagNameFunc { + name := v.tagNameFunc(fld) + if len(name) > 0 { + customName = name + } + } + + // NOTE: cannot use shared tag cache, because tags may be equal, but things like alias may be different + // and so only struct level caching can be used instead of combined with Field tag caching + + if len(tag) > 0 { + ctag, _ = v.parseFieldTagsRecursive(tag, fld.Name, "", false) + } else { + // even if field doesn't have validations need cTag for traversing to potential inner/nested + // elements of the field. + ctag = new(cTag) + } + + cs.fields = append(cs.fields, &cField{ + idx: i, + name: fld.Name, + altName: customName, + cTags: ctag, + namesEqual: fld.Name == customName, + }) + } + v.structCache.Set(typ, cs) + return cs +} + +func (v *Validate) parseFieldTagsRecursive(tag string, fieldName string, alias string, hasAlias bool) (firstCtag *cTag, current *cTag) { + var t string + noAlias := len(alias) == 0 + tags := strings.Split(tag, tagSeparator) + + for i := 0; i < len(tags); i++ { + t = tags[i] + if noAlias { + alias = t + } + + // check map for alias and process new tags, otherwise process as usual + if tagsVal, found := v.aliases[t]; found { + if i == 0 { + firstCtag, current = v.parseFieldTagsRecursive(tagsVal, fieldName, t, true) + } else { + next, curr := v.parseFieldTagsRecursive(tagsVal, fieldName, t, true) + current.next, current = next, curr + } + continue + } + + var prevTag tagType + + if i == 0 { + current = &cTag{aliasTag: alias, hasAlias: hasAlias, hasTag: true, typeof: typeDefault} + firstCtag = current + } else { + prevTag = current.typeof + current.next = &cTag{aliasTag: alias, hasAlias: hasAlias, hasTag: true} + current = current.next + } + + switch t { + case diveTag: + current.typeof = typeDive + + case keysTag: + current.typeof = typeKeys + + if i == 0 || prevTag != typeDive { + panic(fmt.Sprintf("'%s' tag must be immediately preceded by the '%s' tag", keysTag, diveTag)) + } + + // need to pass along only keys tag + // need to increment i to skip over the keys tags + b := make([]byte, 0, 64) + + i++ + + for ; i < len(tags); i++ { + b = append(b, tags[i]...) + b = append(b, ',') + + if tags[i] == endKeysTag { + break + } + } + + current.keys, _ = v.parseFieldTagsRecursive(string(b[:len(b)-1]), fieldName, "", false) + + case endKeysTag: + current.typeof = typeEndKeys + + // if there are more in tags then there was no keysTag defined + // and an error should be thrown + if i != len(tags)-1 { + panic(keysTagNotDefined) + } + return + + case omitzero: + current.typeof = typeOmitZero + continue + + case omitempty: + current.typeof = typeOmitEmpty + + case omitnil: + current.typeof = typeOmitNil + + case structOnlyTag: + current.typeof = typeStructOnly + + case noStructLevelTag: + current.typeof = typeNoStructLevel + + default: + if t == isdefault { + current.typeof = typeIsDefault + } + // if a pipe character is needed within the param you must use the utf8Pipe representation "0x7C" + orVals := strings.Split(t, orSeparator) + + for j := 0; j < len(orVals); j++ { + vals := strings.SplitN(orVals[j], tagKeySeparator, 2) + if noAlias { + alias = vals[0] + current.aliasTag = alias + } else { + current.actualAliasTag = t + } + + if j > 0 { + current.next = &cTag{aliasTag: alias, actualAliasTag: current.actualAliasTag, hasAlias: hasAlias, hasTag: true} + current = current.next + } + current.hasParam = len(vals) > 1 + + current.tag = vals[0] + if len(current.tag) == 0 { + panic(strings.TrimSpace(fmt.Sprintf(invalidValidation, fieldName))) + } + + if wrapper, ok := v.validations[current.tag]; ok { + current.fn = wrapper.fn + current.runValidationWhenNil = wrapper.runValidationOnNil + } else { + panic(strings.TrimSpace(fmt.Sprintf(undefinedValidation, current.tag, fieldName))) + } + + if len(orVals) > 1 { + current.typeof = typeOr + } + + if len(vals) > 1 { + current.param = strings.ReplaceAll(strings.ReplaceAll(vals[1], utf8HexComma, ","), utf8Pipe, "|") + } + } + current.isBlockEnd = true + } + } + return +} + +func (v *Validate) fetchCacheTag(tag string) *cTag { + // find cached tag + ctag, found := v.tagCache.Get(tag) + if !found { + v.tagCache.lock.Lock() + defer v.tagCache.lock.Unlock() + + // could have been multiple trying to access, but once first is done this ensures tag + // isn't parsed again. + ctag, found = v.tagCache.Get(tag) + if !found { + ctag, _ = v.parseFieldTagsRecursive(tag, "", "", false) + v.tagCache.Set(tag, ctag) + } + } + return ctag +} diff --git a/vendor/github.com/go-playground/validator/v10/country_codes.go b/vendor/github.com/go-playground/validator/v10/country_codes.go new file mode 100644 index 00000000..b5f10d3c --- /dev/null +++ b/vendor/github.com/go-playground/validator/v10/country_codes.go @@ -0,0 +1,1177 @@ +package validator + +var iso3166_1_alpha2 = map[string]struct{}{ + // see: https://www.iso.org/iso-3166-country-codes.html + "AF": {}, "AX": {}, "AL": {}, "DZ": {}, "AS": {}, + "AD": {}, "AO": {}, "AI": {}, "AQ": {}, "AG": {}, + "AR": {}, "AM": {}, "AW": {}, "AU": {}, "AT": {}, + "AZ": {}, "BS": {}, "BH": {}, "BD": {}, "BB": {}, + "BY": {}, "BE": {}, "BZ": {}, "BJ": {}, "BM": {}, + "BT": {}, "BO": {}, "BQ": {}, "BA": {}, "BW": {}, + "BV": {}, "BR": {}, "IO": {}, "BN": {}, "BG": {}, + "BF": {}, "BI": {}, "KH": {}, "CM": {}, "CA": {}, + "CV": {}, "KY": {}, "CF": {}, "TD": {}, "CL": {}, + "CN": {}, "CX": {}, "CC": {}, "CO": {}, "KM": {}, + "CG": {}, "CD": {}, "CK": {}, "CR": {}, "CI": {}, + "HR": {}, "CU": {}, "CW": {}, "CY": {}, "CZ": {}, + "DK": {}, "DJ": {}, "DM": {}, "DO": {}, "EC": {}, + "EG": {}, "SV": {}, "GQ": {}, "ER": {}, "EE": {}, + "ET": {}, "FK": {}, "FO": {}, "FJ": {}, "FI": {}, + "FR": {}, "GF": {}, "PF": {}, "TF": {}, "GA": {}, + "GM": {}, "GE": {}, "DE": {}, "GH": {}, "GI": {}, + "GR": {}, "GL": {}, "GD": {}, "GP": {}, "GU": {}, + "GT": {}, "GG": {}, "GN": {}, "GW": {}, "GY": {}, + "HT": {}, "HM": {}, "VA": {}, "HN": {}, "HK": {}, + "HU": {}, "IS": {}, "IN": {}, "ID": {}, "IR": {}, + "IQ": {}, "IE": {}, "IM": {}, "IL": {}, "IT": {}, + "JM": {}, "JP": {}, "JE": {}, "JO": {}, "KZ": {}, + "KE": {}, "KI": {}, "KP": {}, "KR": {}, "KW": {}, + "KG": {}, "LA": {}, "LV": {}, "LB": {}, "LS": {}, + "LR": {}, "LY": {}, "LI": {}, "LT": {}, "LU": {}, + "MO": {}, "MK": {}, "MG": {}, "MW": {}, "MY": {}, + "MV": {}, "ML": {}, "MT": {}, "MH": {}, "MQ": {}, + "MR": {}, "MU": {}, "YT": {}, "MX": {}, "FM": {}, + "MD": {}, "MC": {}, "MN": {}, "ME": {}, "MS": {}, + "MA": {}, "MZ": {}, "MM": {}, "NA": {}, "NR": {}, + "NP": {}, "NL": {}, "NC": {}, "NZ": {}, "NI": {}, + "NE": {}, "NG": {}, "NU": {}, "NF": {}, "MP": {}, + "NO": {}, "OM": {}, "PK": {}, "PW": {}, "PS": {}, + "PA": {}, "PG": {}, "PY": {}, "PE": {}, "PH": {}, + "PN": {}, "PL": {}, "PT": {}, "PR": {}, "QA": {}, + "RE": {}, "RO": {}, "RU": {}, "RW": {}, "BL": {}, + "SH": {}, "KN": {}, "LC": {}, "MF": {}, "PM": {}, + "VC": {}, "WS": {}, "SM": {}, "ST": {}, "SA": {}, + "SN": {}, "RS": {}, "SC": {}, "SL": {}, "SG": {}, + "SX": {}, "SK": {}, "SI": {}, "SB": {}, "SO": {}, + "ZA": {}, "GS": {}, "SS": {}, "ES": {}, "LK": {}, + "SD": {}, "SR": {}, "SJ": {}, "SZ": {}, "SE": {}, + "CH": {}, "SY": {}, "TW": {}, "TJ": {}, "TZ": {}, + "TH": {}, "TL": {}, "TG": {}, "TK": {}, "TO": {}, + "TT": {}, "TN": {}, "TR": {}, "TM": {}, "TC": {}, + "TV": {}, "UG": {}, "UA": {}, "AE": {}, "GB": {}, + "US": {}, "UM": {}, "UY": {}, "UZ": {}, "VU": {}, + "VE": {}, "VN": {}, "VG": {}, "VI": {}, "WF": {}, + "EH": {}, "YE": {}, "ZM": {}, "ZW": {}, "XK": {}, +} + +var iso3166_1_alpha2_eu = map[string]struct{}{ + "AT": {}, "BE": {}, "BG": {}, "HR": {}, "CY": {}, + "CZ": {}, "DK": {}, "EE": {}, "FI": {}, "FR": {}, + "DE": {}, "GR": {}, "HU": {}, "IE": {}, "IT": {}, + "LV": {}, "LT": {}, "LU": {}, "MT": {}, "NL": {}, + "PL": {}, "PT": {}, "RO": {}, "SK": {}, "SI": {}, + "ES": {}, "SE": {}, +} + +var iso3166_1_alpha3 = map[string]struct{}{ + // see: https://www.iso.org/iso-3166-country-codes.html + "AFG": {}, "ALB": {}, "DZA": {}, "ASM": {}, "AND": {}, + "AGO": {}, "AIA": {}, "ATA": {}, "ATG": {}, "ARG": {}, + "ARM": {}, "ABW": {}, "AUS": {}, "AUT": {}, "AZE": {}, + "BHS": {}, "BHR": {}, "BGD": {}, "BRB": {}, "BLR": {}, + "BEL": {}, "BLZ": {}, "BEN": {}, "BMU": {}, "BTN": {}, + "BOL": {}, "BES": {}, "BIH": {}, "BWA": {}, "BVT": {}, + "BRA": {}, "IOT": {}, "BRN": {}, "BGR": {}, "BFA": {}, + "BDI": {}, "CPV": {}, "KHM": {}, "CMR": {}, "CAN": {}, + "CYM": {}, "CAF": {}, "TCD": {}, "CHL": {}, "CHN": {}, + "CXR": {}, "CCK": {}, "COL": {}, "COM": {}, "COD": {}, + "COG": {}, "COK": {}, "CRI": {}, "HRV": {}, "CUB": {}, + "CUW": {}, "CYP": {}, "CZE": {}, "CIV": {}, "DNK": {}, + "DJI": {}, "DMA": {}, "DOM": {}, "ECU": {}, "EGY": {}, + "SLV": {}, "GNQ": {}, "ERI": {}, "EST": {}, "SWZ": {}, + "ETH": {}, "FLK": {}, "FRO": {}, "FJI": {}, "FIN": {}, + "FRA": {}, "GUF": {}, "PYF": {}, "ATF": {}, "GAB": {}, + "GMB": {}, "GEO": {}, "DEU": {}, "GHA": {}, "GIB": {}, + "GRC": {}, "GRL": {}, "GRD": {}, "GLP": {}, "GUM": {}, + "GTM": {}, "GGY": {}, "GIN": {}, "GNB": {}, "GUY": {}, + "HTI": {}, "HMD": {}, "VAT": {}, "HND": {}, "HKG": {}, + "HUN": {}, "ISL": {}, "IND": {}, "IDN": {}, "IRN": {}, + "IRQ": {}, "IRL": {}, "IMN": {}, "ISR": {}, "ITA": {}, + "JAM": {}, "JPN": {}, "JEY": {}, "JOR": {}, "KAZ": {}, + "KEN": {}, "KIR": {}, "PRK": {}, "KOR": {}, "KWT": {}, + "KGZ": {}, "LAO": {}, "LVA": {}, "LBN": {}, "LSO": {}, + "LBR": {}, "LBY": {}, "LIE": {}, "LTU": {}, "LUX": {}, + "MAC": {}, "MDG": {}, "MWI": {}, "MYS": {}, "MDV": {}, + "MLI": {}, "MLT": {}, "MHL": {}, "MTQ": {}, "MRT": {}, + "MUS": {}, "MYT": {}, "MEX": {}, "FSM": {}, "MDA": {}, + "MCO": {}, "MNG": {}, "MNE": {}, "MSR": {}, "MAR": {}, + "MOZ": {}, "MMR": {}, "NAM": {}, "NRU": {}, "NPL": {}, + "NLD": {}, "NCL": {}, "NZL": {}, "NIC": {}, "NER": {}, + "NGA": {}, "NIU": {}, "NFK": {}, "MKD": {}, "MNP": {}, + "NOR": {}, "OMN": {}, "PAK": {}, "PLW": {}, "PSE": {}, + "PAN": {}, "PNG": {}, "PRY": {}, "PER": {}, "PHL": {}, + "PCN": {}, "POL": {}, "PRT": {}, "PRI": {}, "QAT": {}, + "ROU": {}, "RUS": {}, "RWA": {}, "REU": {}, "BLM": {}, + "SHN": {}, "KNA": {}, "LCA": {}, "MAF": {}, "SPM": {}, + "VCT": {}, "WSM": {}, "SMR": {}, "STP": {}, "SAU": {}, + "SEN": {}, "SRB": {}, "SYC": {}, "SLE": {}, "SGP": {}, + "SXM": {}, "SVK": {}, "SVN": {}, "SLB": {}, "SOM": {}, + "ZAF": {}, "SGS": {}, "SSD": {}, "ESP": {}, "LKA": {}, + "SDN": {}, "SUR": {}, "SJM": {}, "SWE": {}, "CHE": {}, + "SYR": {}, "TWN": {}, "TJK": {}, "TZA": {}, "THA": {}, + "TLS": {}, "TGO": {}, "TKL": {}, "TON": {}, "TTO": {}, + "TUN": {}, "TUR": {}, "TKM": {}, "TCA": {}, "TUV": {}, + "UGA": {}, "UKR": {}, "ARE": {}, "GBR": {}, "UMI": {}, + "USA": {}, "URY": {}, "UZB": {}, "VUT": {}, "VEN": {}, + "VNM": {}, "VGB": {}, "VIR": {}, "WLF": {}, "ESH": {}, + "YEM": {}, "ZMB": {}, "ZWE": {}, "ALA": {}, "UNK": {}, +} + +var iso3166_1_alpha3_eu = map[string]struct{}{ + "AUT": {}, "BEL": {}, "BGR": {}, "HRV": {}, "CYP": {}, + "CZE": {}, "DNK": {}, "EST": {}, "FIN": {}, "FRA": {}, + "DEU": {}, "GRC": {}, "HUN": {}, "IRL": {}, "ITA": {}, + "LVA": {}, "LTU": {}, "LUX": {}, "MLT": {}, "NLD": {}, + "POL": {}, "PRT": {}, "ROU": {}, "SVK": {}, "SVN": {}, + "ESP": {}, "SWE": {}, +} +var iso3166_1_alpha_numeric = map[int]struct{}{ + // see: https://www.iso.org/iso-3166-country-codes.html + 4: {}, 8: {}, 12: {}, 16: {}, 20: {}, + 24: {}, 660: {}, 10: {}, 28: {}, 32: {}, + 51: {}, 533: {}, 36: {}, 40: {}, 31: {}, + 44: {}, 48: {}, 50: {}, 52: {}, 112: {}, + 56: {}, 84: {}, 204: {}, 60: {}, 64: {}, + 68: {}, 535: {}, 70: {}, 72: {}, 74: {}, + 76: {}, 86: {}, 96: {}, 100: {}, 854: {}, + 108: {}, 132: {}, 116: {}, 120: {}, 124: {}, + 136: {}, 140: {}, 148: {}, 152: {}, 156: {}, + 162: {}, 166: {}, 170: {}, 174: {}, 180: {}, + 178: {}, 184: {}, 188: {}, 191: {}, 192: {}, + 531: {}, 196: {}, 203: {}, 384: {}, 208: {}, + 262: {}, 212: {}, 214: {}, 218: {}, 818: {}, + 222: {}, 226: {}, 232: {}, 233: {}, 748: {}, + 231: {}, 238: {}, 234: {}, 242: {}, 246: {}, + 250: {}, 254: {}, 258: {}, 260: {}, 266: {}, + 270: {}, 268: {}, 276: {}, 288: {}, 292: {}, + 300: {}, 304: {}, 308: {}, 312: {}, 316: {}, + 320: {}, 831: {}, 324: {}, 624: {}, 328: {}, + 332: {}, 334: {}, 336: {}, 340: {}, 344: {}, + 348: {}, 352: {}, 356: {}, 360: {}, 364: {}, + 368: {}, 372: {}, 833: {}, 376: {}, 380: {}, + 388: {}, 392: {}, 832: {}, 400: {}, 398: {}, + 404: {}, 296: {}, 408: {}, 410: {}, 414: {}, + 417: {}, 418: {}, 428: {}, 422: {}, 426: {}, + 430: {}, 434: {}, 438: {}, 440: {}, 442: {}, + 446: {}, 450: {}, 454: {}, 458: {}, 462: {}, + 466: {}, 470: {}, 584: {}, 474: {}, 478: {}, + 480: {}, 175: {}, 484: {}, 583: {}, 498: {}, + 492: {}, 496: {}, 499: {}, 500: {}, 504: {}, + 508: {}, 104: {}, 516: {}, 520: {}, 524: {}, + 528: {}, 540: {}, 554: {}, 558: {}, 562: {}, + 566: {}, 570: {}, 574: {}, 807: {}, 580: {}, + 578: {}, 512: {}, 586: {}, 585: {}, 275: {}, + 591: {}, 598: {}, 600: {}, 604: {}, 608: {}, + 612: {}, 616: {}, 620: {}, 630: {}, 634: {}, + 642: {}, 643: {}, 646: {}, 638: {}, 652: {}, + 654: {}, 659: {}, 662: {}, 663: {}, 666: {}, + 670: {}, 882: {}, 674: {}, 678: {}, 682: {}, + 686: {}, 688: {}, 690: {}, 694: {}, 702: {}, + 534: {}, 703: {}, 705: {}, 90: {}, 706: {}, + 710: {}, 239: {}, 728: {}, 724: {}, 144: {}, + 729: {}, 740: {}, 744: {}, 752: {}, 756: {}, + 760: {}, 158: {}, 762: {}, 834: {}, 764: {}, + 626: {}, 768: {}, 772: {}, 776: {}, 780: {}, + 788: {}, 792: {}, 795: {}, 796: {}, 798: {}, + 800: {}, 804: {}, 784: {}, 826: {}, 581: {}, + 840: {}, 858: {}, 860: {}, 548: {}, 862: {}, + 704: {}, 92: {}, 850: {}, 876: {}, 732: {}, + 887: {}, 894: {}, 716: {}, 248: {}, 153: {}, +} + +var iso3166_1_alpha_numeric_eu = map[int]struct{}{ + 40: {}, 56: {}, 100: {}, 191: {}, 196: {}, + 200: {}, 208: {}, 233: {}, 246: {}, 250: {}, + 276: {}, 300: {}, 348: {}, 372: {}, 380: {}, + 428: {}, 440: {}, 442: {}, 470: {}, 528: {}, + 616: {}, 620: {}, 642: {}, 703: {}, 705: {}, + 724: {}, 752: {}, +} + +var iso3166_2 = map[string]struct{}{ + "AD-02": {}, "AD-03": {}, "AD-04": {}, "AD-05": {}, "AD-06": {}, + "AD-07": {}, "AD-08": {}, "AE-AJ": {}, "AE-AZ": {}, "AE-DU": {}, + "AE-FU": {}, "AE-RK": {}, "AE-SH": {}, "AE-UQ": {}, "AF-BAL": {}, + "AF-BAM": {}, "AF-BDG": {}, "AF-BDS": {}, "AF-BGL": {}, "AF-DAY": {}, + "AF-FRA": {}, "AF-FYB": {}, "AF-GHA": {}, "AF-GHO": {}, "AF-HEL": {}, + "AF-HER": {}, "AF-JOW": {}, "AF-KAB": {}, "AF-KAN": {}, "AF-KAP": {}, + "AF-KDZ": {}, "AF-KHO": {}, "AF-KNR": {}, "AF-LAG": {}, "AF-LOG": {}, + "AF-NAN": {}, "AF-NIM": {}, "AF-NUR": {}, "AF-PAN": {}, "AF-PAR": {}, + "AF-PIA": {}, "AF-PKA": {}, "AF-SAM": {}, "AF-SAR": {}, "AF-TAK": {}, + "AF-URU": {}, "AF-WAR": {}, "AF-ZAB": {}, "AG-03": {}, "AG-04": {}, + "AG-05": {}, "AG-06": {}, "AG-07": {}, "AG-08": {}, "AG-10": {}, + "AG-11": {}, "AL-01": {}, "AL-02": {}, "AL-03": {}, "AL-04": {}, + "AL-05": {}, "AL-06": {}, "AL-07": {}, "AL-08": {}, "AL-09": {}, + "AL-10": {}, "AL-11": {}, "AL-12": {}, "AL-BR": {}, "AL-BU": {}, + "AL-DI": {}, "AL-DL": {}, "AL-DR": {}, "AL-DV": {}, "AL-EL": {}, + "AL-ER": {}, "AL-FR": {}, "AL-GJ": {}, "AL-GR": {}, "AL-HA": {}, + "AL-KA": {}, "AL-KB": {}, "AL-KC": {}, "AL-KO": {}, "AL-KR": {}, + "AL-KU": {}, "AL-LB": {}, "AL-LE": {}, "AL-LU": {}, "AL-MK": {}, + "AL-MM": {}, "AL-MR": {}, "AL-MT": {}, "AL-PG": {}, "AL-PQ": {}, + "AL-PR": {}, "AL-PU": {}, "AL-SH": {}, "AL-SK": {}, "AL-SR": {}, + "AL-TE": {}, "AL-TP": {}, "AL-TR": {}, "AL-VL": {}, "AM-AG": {}, + "AM-AR": {}, "AM-AV": {}, "AM-ER": {}, "AM-GR": {}, "AM-KT": {}, + "AM-LO": {}, "AM-SH": {}, "AM-SU": {}, "AM-TV": {}, "AM-VD": {}, + "AO-BGO": {}, "AO-BGU": {}, "AO-BIE": {}, "AO-CAB": {}, "AO-CCU": {}, + "AO-CNN": {}, "AO-CNO": {}, "AO-CUS": {}, "AO-HUA": {}, "AO-HUI": {}, + "AO-LNO": {}, "AO-LSU": {}, "AO-LUA": {}, "AO-MAL": {}, "AO-MOX": {}, + "AO-NAM": {}, "AO-UIG": {}, "AO-ZAI": {}, "AR-A": {}, "AR-B": {}, + "AR-C": {}, "AR-D": {}, "AR-E": {}, "AR-F": {}, "AR-G": {}, "AR-H": {}, + "AR-J": {}, "AR-K": {}, "AR-L": {}, "AR-M": {}, "AR-N": {}, + "AR-P": {}, "AR-Q": {}, "AR-R": {}, "AR-S": {}, "AR-T": {}, + "AR-U": {}, "AR-V": {}, "AR-W": {}, "AR-X": {}, "AR-Y": {}, + "AR-Z": {}, "AT-1": {}, "AT-2": {}, "AT-3": {}, "AT-4": {}, + "AT-5": {}, "AT-6": {}, "AT-7": {}, "AT-8": {}, "AT-9": {}, + "AU-ACT": {}, "AU-NSW": {}, "AU-NT": {}, "AU-QLD": {}, "AU-SA": {}, + "AU-TAS": {}, "AU-VIC": {}, "AU-WA": {}, "AZ-ABS": {}, "AZ-AGA": {}, + "AZ-AGC": {}, "AZ-AGM": {}, "AZ-AGS": {}, "AZ-AGU": {}, "AZ-AST": {}, + "AZ-BA": {}, "AZ-BAB": {}, "AZ-BAL": {}, "AZ-BAR": {}, "AZ-BEY": {}, + "AZ-BIL": {}, "AZ-CAB": {}, "AZ-CAL": {}, "AZ-CUL": {}, "AZ-DAS": {}, + "AZ-FUZ": {}, "AZ-GA": {}, "AZ-GAD": {}, "AZ-GOR": {}, "AZ-GOY": {}, + "AZ-GYG": {}, "AZ-HAC": {}, "AZ-IMI": {}, "AZ-ISM": {}, "AZ-KAL": {}, + "AZ-KAN": {}, "AZ-KUR": {}, "AZ-LA": {}, "AZ-LAC": {}, "AZ-LAN": {}, + "AZ-LER": {}, "AZ-MAS": {}, "AZ-MI": {}, "AZ-NA": {}, "AZ-NEF": {}, + "AZ-NV": {}, "AZ-NX": {}, "AZ-OGU": {}, "AZ-ORD": {}, "AZ-QAB": {}, + "AZ-QAX": {}, "AZ-QAZ": {}, "AZ-QBA": {}, "AZ-QBI": {}, "AZ-QOB": {}, + "AZ-QUS": {}, "AZ-SA": {}, "AZ-SAB": {}, "AZ-SAD": {}, "AZ-SAH": {}, + "AZ-SAK": {}, "AZ-SAL": {}, "AZ-SAR": {}, "AZ-SAT": {}, "AZ-SBN": {}, + "AZ-SIY": {}, "AZ-SKR": {}, "AZ-SM": {}, "AZ-SMI": {}, "AZ-SMX": {}, + "AZ-SR": {}, "AZ-SUS": {}, "AZ-TAR": {}, "AZ-TOV": {}, "AZ-UCA": {}, + "AZ-XA": {}, "AZ-XAC": {}, "AZ-XCI": {}, "AZ-XIZ": {}, "AZ-XVD": {}, + "AZ-YAR": {}, "AZ-YE": {}, "AZ-YEV": {}, "AZ-ZAN": {}, "AZ-ZAQ": {}, + "AZ-ZAR": {}, "BA-01": {}, "BA-02": {}, "BA-03": {}, "BA-04": {}, + "BA-05": {}, "BA-06": {}, "BA-07": {}, "BA-08": {}, "BA-09": {}, + "BA-10": {}, "BA-BIH": {}, "BA-BRC": {}, "BA-SRP": {}, "BB-01": {}, + "BB-02": {}, "BB-03": {}, "BB-04": {}, "BB-05": {}, "BB-06": {}, + "BB-07": {}, "BB-08": {}, "BB-09": {}, "BB-10": {}, "BB-11": {}, + "BD-01": {}, "BD-02": {}, "BD-03": {}, "BD-04": {}, "BD-05": {}, + "BD-06": {}, "BD-07": {}, "BD-08": {}, "BD-09": {}, "BD-10": {}, + "BD-11": {}, "BD-12": {}, "BD-13": {}, "BD-14": {}, "BD-15": {}, + "BD-16": {}, "BD-17": {}, "BD-18": {}, "BD-19": {}, "BD-20": {}, + "BD-21": {}, "BD-22": {}, "BD-23": {}, "BD-24": {}, "BD-25": {}, + "BD-26": {}, "BD-27": {}, "BD-28": {}, "BD-29": {}, "BD-30": {}, + "BD-31": {}, "BD-32": {}, "BD-33": {}, "BD-34": {}, "BD-35": {}, + "BD-36": {}, "BD-37": {}, "BD-38": {}, "BD-39": {}, "BD-40": {}, + "BD-41": {}, "BD-42": {}, "BD-43": {}, "BD-44": {}, "BD-45": {}, + "BD-46": {}, "BD-47": {}, "BD-48": {}, "BD-49": {}, "BD-50": {}, + "BD-51": {}, "BD-52": {}, "BD-53": {}, "BD-54": {}, "BD-55": {}, + "BD-56": {}, "BD-57": {}, "BD-58": {}, "BD-59": {}, "BD-60": {}, + "BD-61": {}, "BD-62": {}, "BD-63": {}, "BD-64": {}, "BD-A": {}, + "BD-B": {}, "BD-C": {}, "BD-D": {}, "BD-E": {}, "BD-F": {}, + "BD-G": {}, "BE-BRU": {}, "BE-VAN": {}, "BE-VBR": {}, "BE-VLG": {}, + "BE-VLI": {}, "BE-VOV": {}, "BE-VWV": {}, "BE-WAL": {}, "BE-WBR": {}, + "BE-WHT": {}, "BE-WLG": {}, "BE-WLX": {}, "BE-WNA": {}, "BF-01": {}, + "BF-02": {}, "BF-03": {}, "BF-04": {}, "BF-05": {}, "BF-06": {}, + "BF-07": {}, "BF-08": {}, "BF-09": {}, "BF-10": {}, "BF-11": {}, + "BF-12": {}, "BF-13": {}, "BF-BAL": {}, "BF-BAM": {}, "BF-BAN": {}, + "BF-BAZ": {}, "BF-BGR": {}, "BF-BLG": {}, "BF-BLK": {}, "BF-COM": {}, + "BF-GAN": {}, "BF-GNA": {}, "BF-GOU": {}, "BF-HOU": {}, "BF-IOB": {}, + "BF-KAD": {}, "BF-KEN": {}, "BF-KMD": {}, "BF-KMP": {}, "BF-KOP": {}, + "BF-KOS": {}, "BF-KOT": {}, "BF-KOW": {}, "BF-LER": {}, "BF-LOR": {}, + "BF-MOU": {}, "BF-NAM": {}, "BF-NAO": {}, "BF-NAY": {}, "BF-NOU": {}, + "BF-OUB": {}, "BF-OUD": {}, "BF-PAS": {}, "BF-PON": {}, "BF-SEN": {}, + "BF-SIS": {}, "BF-SMT": {}, "BF-SNG": {}, "BF-SOM": {}, "BF-SOR": {}, + "BF-TAP": {}, "BF-TUI": {}, "BF-YAG": {}, "BF-YAT": {}, "BF-ZIR": {}, + "BF-ZON": {}, "BF-ZOU": {}, "BG-01": {}, "BG-02": {}, "BG-03": {}, + "BG-04": {}, "BG-05": {}, "BG-06": {}, "BG-07": {}, "BG-08": {}, + "BG-09": {}, "BG-10": {}, "BG-11": {}, "BG-12": {}, "BG-13": {}, + "BG-14": {}, "BG-15": {}, "BG-16": {}, "BG-17": {}, "BG-18": {}, + "BG-19": {}, "BG-20": {}, "BG-21": {}, "BG-22": {}, "BG-23": {}, + "BG-24": {}, "BG-25": {}, "BG-26": {}, "BG-27": {}, "BG-28": {}, + "BH-13": {}, "BH-14": {}, "BH-15": {}, "BH-16": {}, "BH-17": {}, + "BI-BB": {}, "BI-BL": {}, "BI-BM": {}, "BI-BR": {}, "BI-CA": {}, + "BI-CI": {}, "BI-GI": {}, "BI-KI": {}, "BI-KR": {}, "BI-KY": {}, + "BI-MA": {}, "BI-MU": {}, "BI-MW": {}, "BI-NG": {}, "BI-RM": {}, "BI-RT": {}, + "BI-RY": {}, "BJ-AK": {}, "BJ-AL": {}, "BJ-AQ": {}, "BJ-BO": {}, + "BJ-CO": {}, "BJ-DO": {}, "BJ-KO": {}, "BJ-LI": {}, "BJ-MO": {}, + "BJ-OU": {}, "BJ-PL": {}, "BJ-ZO": {}, "BN-BE": {}, "BN-BM": {}, + "BN-TE": {}, "BN-TU": {}, "BO-B": {}, "BO-C": {}, "BO-H": {}, + "BO-L": {}, "BO-N": {}, "BO-O": {}, "BO-P": {}, "BO-S": {}, + "BO-T": {}, "BQ-BO": {}, "BQ-SA": {}, "BQ-SE": {}, "BR-AC": {}, + "BR-AL": {}, "BR-AM": {}, "BR-AP": {}, "BR-BA": {}, "BR-CE": {}, + "BR-DF": {}, "BR-ES": {}, "BR-FN": {}, "BR-GO": {}, "BR-MA": {}, + "BR-MG": {}, "BR-MS": {}, "BR-MT": {}, "BR-PA": {}, "BR-PB": {}, + "BR-PE": {}, "BR-PI": {}, "BR-PR": {}, "BR-RJ": {}, "BR-RN": {}, + "BR-RO": {}, "BR-RR": {}, "BR-RS": {}, "BR-SC": {}, "BR-SE": {}, + "BR-SP": {}, "BR-TO": {}, "BS-AK": {}, "BS-BI": {}, "BS-BP": {}, + "BS-BY": {}, "BS-CE": {}, "BS-CI": {}, "BS-CK": {}, "BS-CO": {}, + "BS-CS": {}, "BS-EG": {}, "BS-EX": {}, "BS-FP": {}, "BS-GC": {}, + "BS-HI": {}, "BS-HT": {}, "BS-IN": {}, "BS-LI": {}, "BS-MC": {}, + "BS-MG": {}, "BS-MI": {}, "BS-NE": {}, "BS-NO": {}, "BS-NP": {}, "BS-NS": {}, + "BS-RC": {}, "BS-RI": {}, "BS-SA": {}, "BS-SE": {}, "BS-SO": {}, + "BS-SS": {}, "BS-SW": {}, "BS-WG": {}, "BT-11": {}, "BT-12": {}, + "BT-13": {}, "BT-14": {}, "BT-15": {}, "BT-21": {}, "BT-22": {}, + "BT-23": {}, "BT-24": {}, "BT-31": {}, "BT-32": {}, "BT-33": {}, + "BT-34": {}, "BT-41": {}, "BT-42": {}, "BT-43": {}, "BT-44": {}, + "BT-45": {}, "BT-GA": {}, "BT-TY": {}, "BW-CE": {}, "BW-CH": {}, "BW-GH": {}, + "BW-KG": {}, "BW-KL": {}, "BW-KW": {}, "BW-NE": {}, "BW-NW": {}, + "BW-SE": {}, "BW-SO": {}, "BY-BR": {}, "BY-HM": {}, "BY-HO": {}, + "BY-HR": {}, "BY-MA": {}, "BY-MI": {}, "BY-VI": {}, "BZ-BZ": {}, + "BZ-CY": {}, "BZ-CZL": {}, "BZ-OW": {}, "BZ-SC": {}, "BZ-TOL": {}, + "CA-AB": {}, "CA-BC": {}, "CA-MB": {}, "CA-NB": {}, "CA-NL": {}, + "CA-NS": {}, "CA-NT": {}, "CA-NU": {}, "CA-ON": {}, "CA-PE": {}, + "CA-QC": {}, "CA-SK": {}, "CA-YT": {}, "CD-BC": {}, "CD-BN": {}, + "CD-EQ": {}, "CD-HK": {}, "CD-IT": {}, "CD-KA": {}, "CD-KC": {}, "CD-KE": {}, "CD-KG": {}, "CD-KN": {}, + "CD-KW": {}, "CD-KS": {}, "CD-LU": {}, "CD-MA": {}, "CD-NK": {}, "CD-OR": {}, "CD-SA": {}, "CD-SK": {}, + "CD-TA": {}, "CD-TO": {}, "CF-AC": {}, "CF-BB": {}, "CF-BGF": {}, "CF-BK": {}, "CF-HK": {}, "CF-HM": {}, + "CF-HS": {}, "CF-KB": {}, "CF-KG": {}, "CF-LB": {}, "CF-MB": {}, + "CF-MP": {}, "CF-NM": {}, "CF-OP": {}, "CF-SE": {}, "CF-UK": {}, + "CF-VK": {}, "CG-11": {}, "CG-12": {}, "CG-13": {}, "CG-14": {}, + "CG-15": {}, "CG-16": {}, "CG-2": {}, "CG-5": {}, "CG-7": {}, "CG-8": {}, + "CG-9": {}, "CG-BZV": {}, "CH-AG": {}, "CH-AI": {}, "CH-AR": {}, + "CH-BE": {}, "CH-BL": {}, "CH-BS": {}, "CH-FR": {}, "CH-GE": {}, + "CH-GL": {}, "CH-GR": {}, "CH-JU": {}, "CH-LU": {}, "CH-NE": {}, + "CH-NW": {}, "CH-OW": {}, "CH-SG": {}, "CH-SH": {}, "CH-SO": {}, + "CH-SZ": {}, "CH-TG": {}, "CH-TI": {}, "CH-UR": {}, "CH-VD": {}, + "CH-VS": {}, "CH-ZG": {}, "CH-ZH": {}, "CI-AB": {}, "CI-BS": {}, + "CI-CM": {}, "CI-DN": {}, "CI-GD": {}, "CI-LC": {}, "CI-LG": {}, + "CI-MG": {}, "CI-SM": {}, "CI-SV": {}, "CI-VB": {}, "CI-WR": {}, + "CI-YM": {}, "CI-ZZ": {}, "CL-AI": {}, "CL-AN": {}, "CL-AP": {}, + "CL-AR": {}, "CL-AT": {}, "CL-BI": {}, "CL-CO": {}, "CL-LI": {}, + "CL-LL": {}, "CL-LR": {}, "CL-MA": {}, "CL-ML": {}, "CL-NB": {}, "CL-RM": {}, + "CL-TA": {}, "CL-VS": {}, "CM-AD": {}, "CM-CE": {}, "CM-EN": {}, + "CM-ES": {}, "CM-LT": {}, "CM-NO": {}, "CM-NW": {}, "CM-OU": {}, + "CM-SU": {}, "CM-SW": {}, "CN-AH": {}, "CN-BJ": {}, "CN-CQ": {}, + "CN-FJ": {}, "CN-GS": {}, "CN-GD": {}, "CN-GX": {}, "CN-GZ": {}, + "CN-HI": {}, "CN-HE": {}, "CN-HL": {}, "CN-HA": {}, "CN-HB": {}, + "CN-HN": {}, "CN-JS": {}, "CN-JX": {}, "CN-JL": {}, "CN-LN": {}, + "CN-NM": {}, "CN-NX": {}, "CN-QH": {}, "CN-SN": {}, "CN-SD": {}, "CN-SH": {}, + "CN-SX": {}, "CN-SC": {}, "CN-TJ": {}, "CN-XJ": {}, "CN-XZ": {}, "CN-YN": {}, + "CN-ZJ": {}, "CO-AMA": {}, "CO-ANT": {}, "CO-ARA": {}, "CO-ATL": {}, + "CO-BOL": {}, "CO-BOY": {}, "CO-CAL": {}, "CO-CAQ": {}, "CO-CAS": {}, + "CO-CAU": {}, "CO-CES": {}, "CO-CHO": {}, "CO-COR": {}, "CO-CUN": {}, + "CO-DC": {}, "CO-GUA": {}, "CO-GUV": {}, "CO-HUI": {}, "CO-LAG": {}, + "CO-MAG": {}, "CO-MET": {}, "CO-NAR": {}, "CO-NSA": {}, "CO-PUT": {}, + "CO-QUI": {}, "CO-RIS": {}, "CO-SAN": {}, "CO-SAP": {}, "CO-SUC": {}, + "CO-TOL": {}, "CO-VAC": {}, "CO-VAU": {}, "CO-VID": {}, "CR-A": {}, + "CR-C": {}, "CR-G": {}, "CR-H": {}, "CR-L": {}, "CR-P": {}, + "CR-SJ": {}, "CU-01": {}, "CU-02": {}, "CU-03": {}, "CU-04": {}, + "CU-05": {}, "CU-06": {}, "CU-07": {}, "CU-08": {}, "CU-09": {}, + "CU-10": {}, "CU-11": {}, "CU-12": {}, "CU-13": {}, "CU-14": {}, "CU-15": {}, + "CU-16": {}, "CU-99": {}, "CV-B": {}, "CV-BR": {}, "CV-BV": {}, "CV-CA": {}, + "CV-CF": {}, "CV-CR": {}, "CV-MA": {}, "CV-MO": {}, "CV-PA": {}, + "CV-PN": {}, "CV-PR": {}, "CV-RB": {}, "CV-RG": {}, "CV-RS": {}, + "CV-S": {}, "CV-SD": {}, "CV-SF": {}, "CV-SL": {}, "CV-SM": {}, + "CV-SO": {}, "CV-SS": {}, "CV-SV": {}, "CV-TA": {}, "CV-TS": {}, + "CY-01": {}, "CY-02": {}, "CY-03": {}, "CY-04": {}, "CY-05": {}, + "CY-06": {}, "CZ-10": {}, "CZ-101": {}, "CZ-102": {}, "CZ-103": {}, + "CZ-104": {}, "CZ-105": {}, "CZ-106": {}, "CZ-107": {}, "CZ-108": {}, + "CZ-109": {}, "CZ-110": {}, "CZ-111": {}, "CZ-112": {}, "CZ-113": {}, + "CZ-114": {}, "CZ-115": {}, "CZ-116": {}, "CZ-117": {}, "CZ-118": {}, + "CZ-119": {}, "CZ-120": {}, "CZ-121": {}, "CZ-122": {}, "CZ-20": {}, + "CZ-201": {}, "CZ-202": {}, "CZ-203": {}, "CZ-204": {}, "CZ-205": {}, + "CZ-206": {}, "CZ-207": {}, "CZ-208": {}, "CZ-209": {}, "CZ-20A": {}, + "CZ-20B": {}, "CZ-20C": {}, "CZ-31": {}, "CZ-311": {}, "CZ-312": {}, + "CZ-313": {}, "CZ-314": {}, "CZ-315": {}, "CZ-316": {}, "CZ-317": {}, + "CZ-32": {}, "CZ-321": {}, "CZ-322": {}, "CZ-323": {}, "CZ-324": {}, + "CZ-325": {}, "CZ-326": {}, "CZ-327": {}, "CZ-41": {}, "CZ-411": {}, + "CZ-412": {}, "CZ-413": {}, "CZ-42": {}, "CZ-421": {}, "CZ-422": {}, + "CZ-423": {}, "CZ-424": {}, "CZ-425": {}, "CZ-426": {}, "CZ-427": {}, + "CZ-51": {}, "CZ-511": {}, "CZ-512": {}, "CZ-513": {}, "CZ-514": {}, + "CZ-52": {}, "CZ-521": {}, "CZ-522": {}, "CZ-523": {}, "CZ-524": {}, + "CZ-525": {}, "CZ-53": {}, "CZ-531": {}, "CZ-532": {}, "CZ-533": {}, + "CZ-534": {}, "CZ-63": {}, "CZ-631": {}, "CZ-632": {}, "CZ-633": {}, + "CZ-634": {}, "CZ-635": {}, "CZ-64": {}, "CZ-641": {}, "CZ-642": {}, + "CZ-643": {}, "CZ-644": {}, "CZ-645": {}, "CZ-646": {}, "CZ-647": {}, + "CZ-71": {}, "CZ-711": {}, "CZ-712": {}, "CZ-713": {}, "CZ-714": {}, + "CZ-715": {}, "CZ-72": {}, "CZ-721": {}, "CZ-722": {}, "CZ-723": {}, + "CZ-724": {}, "CZ-80": {}, "CZ-801": {}, "CZ-802": {}, "CZ-803": {}, + "CZ-804": {}, "CZ-805": {}, "CZ-806": {}, "DE-BB": {}, "DE-BE": {}, + "DE-BW": {}, "DE-BY": {}, "DE-HB": {}, "DE-HE": {}, "DE-HH": {}, + "DE-MV": {}, "DE-NI": {}, "DE-NW": {}, "DE-RP": {}, "DE-SH": {}, + "DE-SL": {}, "DE-SN": {}, "DE-ST": {}, "DE-TH": {}, "DJ-AR": {}, + "DJ-AS": {}, "DJ-DI": {}, "DJ-DJ": {}, "DJ-OB": {}, "DJ-TA": {}, + "DK-81": {}, "DK-82": {}, "DK-83": {}, "DK-84": {}, "DK-85": {}, + "DM-01": {}, "DM-02": {}, "DM-03": {}, "DM-04": {}, "DM-05": {}, + "DM-06": {}, "DM-07": {}, "DM-08": {}, "DM-09": {}, "DM-10": {}, + "DO-01": {}, "DO-02": {}, "DO-03": {}, "DO-04": {}, "DO-05": {}, + "DO-06": {}, "DO-07": {}, "DO-08": {}, "DO-09": {}, "DO-10": {}, + "DO-11": {}, "DO-12": {}, "DO-13": {}, "DO-14": {}, "DO-15": {}, + "DO-16": {}, "DO-17": {}, "DO-18": {}, "DO-19": {}, "DO-20": {}, + "DO-21": {}, "DO-22": {}, "DO-23": {}, "DO-24": {}, "DO-25": {}, + "DO-26": {}, "DO-27": {}, "DO-28": {}, "DO-29": {}, "DO-30": {}, "DO-31": {}, + "DZ-01": {}, "DZ-02": {}, "DZ-03": {}, "DZ-04": {}, "DZ-05": {}, + "DZ-06": {}, "DZ-07": {}, "DZ-08": {}, "DZ-09": {}, "DZ-10": {}, + "DZ-11": {}, "DZ-12": {}, "DZ-13": {}, "DZ-14": {}, "DZ-15": {}, + "DZ-16": {}, "DZ-17": {}, "DZ-18": {}, "DZ-19": {}, "DZ-20": {}, + "DZ-21": {}, "DZ-22": {}, "DZ-23": {}, "DZ-24": {}, "DZ-25": {}, + "DZ-26": {}, "DZ-27": {}, "DZ-28": {}, "DZ-29": {}, "DZ-30": {}, + "DZ-31": {}, "DZ-32": {}, "DZ-33": {}, "DZ-34": {}, "DZ-35": {}, + "DZ-36": {}, "DZ-37": {}, "DZ-38": {}, "DZ-39": {}, "DZ-40": {}, + "DZ-41": {}, "DZ-42": {}, "DZ-43": {}, "DZ-44": {}, "DZ-45": {}, + "DZ-46": {}, "DZ-47": {}, "DZ-48": {}, "DZ-49": {}, "DZ-51": {}, + "DZ-53": {}, "DZ-55": {}, "DZ-56": {}, "DZ-57": {}, "EC-A": {}, "EC-B": {}, + "EC-C": {}, "EC-D": {}, "EC-E": {}, "EC-F": {}, "EC-G": {}, + "EC-H": {}, "EC-I": {}, "EC-L": {}, "EC-M": {}, "EC-N": {}, + "EC-O": {}, "EC-P": {}, "EC-R": {}, "EC-S": {}, "EC-SD": {}, + "EC-SE": {}, "EC-T": {}, "EC-U": {}, "EC-W": {}, "EC-X": {}, + "EC-Y": {}, "EC-Z": {}, "EE-37": {}, "EE-39": {}, "EE-44": {}, "EE-45": {}, + "EE-49": {}, "EE-50": {}, "EE-51": {}, "EE-52": {}, "EE-56": {}, "EE-57": {}, + "EE-59": {}, "EE-60": {}, "EE-64": {}, "EE-65": {}, "EE-67": {}, "EE-68": {}, + "EE-70": {}, "EE-71": {}, "EE-74": {}, "EE-78": {}, "EE-79": {}, "EE-81": {}, "EE-82": {}, + "EE-84": {}, "EE-86": {}, "EE-87": {}, "EG-ALX": {}, "EG-ASN": {}, "EG-AST": {}, + "EG-BA": {}, "EG-BH": {}, "EG-BNS": {}, "EG-C": {}, "EG-DK": {}, + "EG-DT": {}, "EG-FYM": {}, "EG-GH": {}, "EG-GZ": {}, "EG-HU": {}, + "EG-IS": {}, "EG-JS": {}, "EG-KB": {}, "EG-KFS": {}, "EG-KN": {}, + "EG-LX": {}, "EG-MN": {}, "EG-MNF": {}, "EG-MT": {}, "EG-PTS": {}, "EG-SHG": {}, + "EG-SHR": {}, "EG-SIN": {}, "EG-SU": {}, "EG-SUZ": {}, "EG-WAD": {}, + "ER-AN": {}, "ER-DK": {}, "ER-DU": {}, "ER-GB": {}, "ER-MA": {}, + "ER-SK": {}, "ES-A": {}, "ES-AB": {}, "ES-AL": {}, "ES-AN": {}, + "ES-AR": {}, "ES-AS": {}, "ES-AV": {}, "ES-B": {}, "ES-BA": {}, + "ES-BI": {}, "ES-BU": {}, "ES-C": {}, "ES-CA": {}, "ES-CB": {}, + "ES-CC": {}, "ES-CE": {}, "ES-CL": {}, "ES-CM": {}, "ES-CN": {}, + "ES-CO": {}, "ES-CR": {}, "ES-CS": {}, "ES-CT": {}, "ES-CU": {}, + "ES-EX": {}, "ES-GA": {}, "ES-GC": {}, "ES-GI": {}, "ES-GR": {}, + "ES-GU": {}, "ES-H": {}, "ES-HU": {}, "ES-IB": {}, "ES-J": {}, + "ES-L": {}, "ES-LE": {}, "ES-LO": {}, "ES-LU": {}, "ES-M": {}, + "ES-MA": {}, "ES-MC": {}, "ES-MD": {}, "ES-ML": {}, "ES-MU": {}, + "ES-NA": {}, "ES-NC": {}, "ES-O": {}, "ES-OR": {}, "ES-P": {}, + "ES-PM": {}, "ES-PO": {}, "ES-PV": {}, "ES-RI": {}, "ES-S": {}, + "ES-SA": {}, "ES-SE": {}, "ES-SG": {}, "ES-SO": {}, "ES-SS": {}, + "ES-T": {}, "ES-TE": {}, "ES-TF": {}, "ES-TO": {}, "ES-V": {}, + "ES-VA": {}, "ES-VC": {}, "ES-VI": {}, "ES-Z": {}, "ES-ZA": {}, + "ET-AA": {}, "ET-AF": {}, "ET-AM": {}, "ET-BE": {}, "ET-DD": {}, + "ET-GA": {}, "ET-HA": {}, "ET-OR": {}, "ET-SN": {}, "ET-SO": {}, + "ET-TI": {}, "FI-01": {}, "FI-02": {}, "FI-03": {}, "FI-04": {}, + "FI-05": {}, "FI-06": {}, "FI-07": {}, "FI-08": {}, "FI-09": {}, + "FI-10": {}, "FI-11": {}, "FI-12": {}, "FI-13": {}, "FI-14": {}, + "FI-15": {}, "FI-16": {}, "FI-17": {}, "FI-18": {}, "FI-19": {}, + "FJ-C": {}, "FJ-E": {}, "FJ-N": {}, "FJ-R": {}, "FJ-W": {}, + "FM-KSA": {}, "FM-PNI": {}, "FM-TRK": {}, "FM-YAP": {}, "FR-01": {}, + "FR-02": {}, "FR-03": {}, "FR-04": {}, "FR-05": {}, "FR-06": {}, + "FR-07": {}, "FR-08": {}, "FR-09": {}, "FR-10": {}, "FR-11": {}, + "FR-12": {}, "FR-13": {}, "FR-14": {}, "FR-15": {}, "FR-16": {}, + "FR-17": {}, "FR-18": {}, "FR-19": {}, "FR-20R": {}, "FR-21": {}, "FR-22": {}, + "FR-23": {}, "FR-24": {}, "FR-25": {}, "FR-26": {}, "FR-27": {}, + "FR-28": {}, "FR-29": {}, "FR-2A": {}, "FR-2B": {}, "FR-30": {}, + "FR-31": {}, "FR-32": {}, "FR-33": {}, "FR-34": {}, "FR-35": {}, + "FR-36": {}, "FR-37": {}, "FR-38": {}, "FR-39": {}, "FR-40": {}, + "FR-41": {}, "FR-42": {}, "FR-43": {}, "FR-44": {}, "FR-45": {}, + "FR-46": {}, "FR-47": {}, "FR-48": {}, "FR-49": {}, "FR-50": {}, + "FR-51": {}, "FR-52": {}, "FR-53": {}, "FR-54": {}, "FR-55": {}, + "FR-56": {}, "FR-57": {}, "FR-58": {}, "FR-59": {}, "FR-60": {}, + "FR-61": {}, "FR-62": {}, "FR-63": {}, "FR-64": {}, "FR-65": {}, + "FR-66": {}, "FR-67": {}, "FR-68": {}, "FR-69": {}, "FR-70": {}, + "FR-71": {}, "FR-72": {}, "FR-73": {}, "FR-74": {}, "FR-75": {}, + "FR-76": {}, "FR-77": {}, "FR-78": {}, "FR-79": {}, "FR-80": {}, + "FR-81": {}, "FR-82": {}, "FR-83": {}, "FR-84": {}, "FR-85": {}, + "FR-86": {}, "FR-87": {}, "FR-88": {}, "FR-89": {}, "FR-90": {}, + "FR-91": {}, "FR-92": {}, "FR-93": {}, "FR-94": {}, "FR-95": {}, + "FR-ARA": {}, "FR-BFC": {}, "FR-BL": {}, "FR-BRE": {}, "FR-COR": {}, + "FR-CP": {}, "FR-CVL": {}, "FR-GES": {}, "FR-GF": {}, "FR-GP": {}, + "FR-GUA": {}, "FR-HDF": {}, "FR-IDF": {}, "FR-LRE": {}, "FR-MAY": {}, + "FR-MF": {}, "FR-MQ": {}, "FR-NAQ": {}, "FR-NC": {}, "FR-NOR": {}, + "FR-OCC": {}, "FR-PAC": {}, "FR-PDL": {}, "FR-PF": {}, "FR-PM": {}, + "FR-RE": {}, "FR-TF": {}, "FR-WF": {}, "FR-YT": {}, "GA-1": {}, + "GA-2": {}, "GA-3": {}, "GA-4": {}, "GA-5": {}, "GA-6": {}, + "GA-7": {}, "GA-8": {}, "GA-9": {}, "GB-ABC": {}, "GB-ABD": {}, + "GB-ABE": {}, "GB-AGB": {}, "GB-AGY": {}, "GB-AND": {}, "GB-ANN": {}, + "GB-ANS": {}, "GB-BAS": {}, "GB-BBD": {}, "GB-BDF": {}, "GB-BDG": {}, + "GB-BEN": {}, "GB-BEX": {}, "GB-BFS": {}, "GB-BGE": {}, "GB-BGW": {}, + "GB-BIR": {}, "GB-BKM": {}, "GB-BMH": {}, "GB-BNE": {}, "GB-BNH": {}, + "GB-BNS": {}, "GB-BOL": {}, "GB-BPL": {}, "GB-BRC": {}, "GB-BRD": {}, + "GB-BRY": {}, "GB-BST": {}, "GB-BUR": {}, "GB-CAM": {}, "GB-CAY": {}, + "GB-CBF": {}, "GB-CCG": {}, "GB-CGN": {}, "GB-CHE": {}, "GB-CHW": {}, + "GB-CLD": {}, "GB-CLK": {}, "GB-CMA": {}, "GB-CMD": {}, "GB-CMN": {}, + "GB-CON": {}, "GB-COV": {}, "GB-CRF": {}, "GB-CRY": {}, "GB-CWY": {}, + "GB-DAL": {}, "GB-DBY": {}, "GB-DEN": {}, "GB-DER": {}, "GB-DEV": {}, + "GB-DGY": {}, "GB-DNC": {}, "GB-DND": {}, "GB-DOR": {}, "GB-DRS": {}, + "GB-DUD": {}, "GB-DUR": {}, "GB-EAL": {}, "GB-EAW": {}, "GB-EAY": {}, + "GB-EDH": {}, "GB-EDU": {}, "GB-ELN": {}, "GB-ELS": {}, "GB-ENF": {}, + "GB-ENG": {}, "GB-ERW": {}, "GB-ERY": {}, "GB-ESS": {}, "GB-ESX": {}, + "GB-FAL": {}, "GB-FIF": {}, "GB-FLN": {}, "GB-FMO": {}, "GB-GAT": {}, + "GB-GBN": {}, "GB-GLG": {}, "GB-GLS": {}, "GB-GRE": {}, "GB-GWN": {}, + "GB-HAL": {}, "GB-HAM": {}, "GB-HAV": {}, "GB-HCK": {}, "GB-HEF": {}, + "GB-HIL": {}, "GB-HLD": {}, "GB-HMF": {}, "GB-HNS": {}, "GB-HPL": {}, + "GB-HRT": {}, "GB-HRW": {}, "GB-HRY": {}, "GB-IOS": {}, "GB-IOW": {}, + "GB-ISL": {}, "GB-IVC": {}, "GB-KEC": {}, "GB-KEN": {}, "GB-KHL": {}, + "GB-KIR": {}, "GB-KTT": {}, "GB-KWL": {}, "GB-LAN": {}, "GB-LBC": {}, + "GB-LBH": {}, "GB-LCE": {}, "GB-LDS": {}, "GB-LEC": {}, "GB-LEW": {}, + "GB-LIN": {}, "GB-LIV": {}, "GB-LND": {}, "GB-LUT": {}, "GB-MAN": {}, + "GB-MDB": {}, "GB-MDW": {}, "GB-MEA": {}, "GB-MIK": {}, "GD-01": {}, + "GB-MLN": {}, "GB-MON": {}, "GB-MRT": {}, "GB-MRY": {}, "GB-MTY": {}, + "GB-MUL": {}, "GB-NAY": {}, "GB-NBL": {}, "GB-NEL": {}, "GB-NET": {}, + "GB-NFK": {}, "GB-NGM": {}, "GB-NIR": {}, "GB-NLK": {}, "GB-NLN": {}, + "GB-NMD": {}, "GB-NSM": {}, "GB-NTH": {}, "GB-NTL": {}, "GB-NTT": {}, + "GB-NTY": {}, "GB-NWM": {}, "GB-NWP": {}, "GB-NYK": {}, "GB-OLD": {}, + "GB-ORK": {}, "GB-OXF": {}, "GB-PEM": {}, "GB-PKN": {}, "GB-PLY": {}, + "GB-POL": {}, "GB-POR": {}, "GB-POW": {}, "GB-PTE": {}, "GB-RCC": {}, + "GB-RCH": {}, "GB-RCT": {}, "GB-RDB": {}, "GB-RDG": {}, "GB-RFW": {}, + "GB-RIC": {}, "GB-ROT": {}, "GB-RUT": {}, "GB-SAW": {}, "GB-SAY": {}, + "GB-SCB": {}, "GB-SCT": {}, "GB-SFK": {}, "GB-SFT": {}, "GB-SGC": {}, + "GB-SHF": {}, "GB-SHN": {}, "GB-SHR": {}, "GB-SKP": {}, "GB-SLF": {}, + "GB-SLG": {}, "GB-SLK": {}, "GB-SND": {}, "GB-SOL": {}, "GB-SOM": {}, + "GB-SOS": {}, "GB-SRY": {}, "GB-STE": {}, "GB-STG": {}, "GB-STH": {}, + "GB-STN": {}, "GB-STS": {}, "GB-STT": {}, "GB-STY": {}, "GB-SWA": {}, + "GB-SWD": {}, "GB-SWK": {}, "GB-TAM": {}, "GB-TFW": {}, "GB-THR": {}, + "GB-TOB": {}, "GB-TOF": {}, "GB-TRF": {}, "GB-TWH": {}, "GB-UKM": {}, + "GB-VGL": {}, "GB-WAR": {}, "GB-WBK": {}, "GB-WDU": {}, "GB-WFT": {}, + "GB-WGN": {}, "GB-WIL": {}, "GB-WKF": {}, "GB-WLL": {}, "GB-WLN": {}, + "GB-WLS": {}, "GB-WLV": {}, "GB-WND": {}, "GB-WNM": {}, "GB-WOK": {}, + "GB-WOR": {}, "GB-WRL": {}, "GB-WRT": {}, "GB-WRX": {}, "GB-WSM": {}, + "GB-WSX": {}, "GB-YOR": {}, "GB-ZET": {}, "GD-02": {}, "GD-03": {}, + "GD-04": {}, "GD-05": {}, "GD-06": {}, "GD-10": {}, "GE-AB": {}, + "GE-AJ": {}, "GE-GU": {}, "GE-IM": {}, "GE-KA": {}, "GE-KK": {}, + "GE-MM": {}, "GE-RL": {}, "GE-SJ": {}, "GE-SK": {}, "GE-SZ": {}, + "GE-TB": {}, "GH-AA": {}, "GH-AH": {}, "GH-AF": {}, "GH-BA": {}, "GH-BO": {}, "GH-BE": {}, "GH-CP": {}, + "GH-EP": {}, "GH-NP": {}, "GH-TV": {}, "GH-UE": {}, "GH-UW": {}, + "GH-WP": {}, "GL-AV": {}, "GL-KU": {}, "GL-QA": {}, "GL-QT": {}, "GL-QE": {}, "GL-SM": {}, + "GM-B": {}, "GM-L": {}, "GM-M": {}, "GM-N": {}, "GM-U": {}, + "GM-W": {}, "GN-B": {}, "GN-BE": {}, "GN-BF": {}, "GN-BK": {}, + "GN-C": {}, "GN-CO": {}, "GN-D": {}, "GN-DB": {}, "GN-DI": {}, + "GN-DL": {}, "GN-DU": {}, "GN-F": {}, "GN-FA": {}, "GN-FO": {}, + "GN-FR": {}, "GN-GA": {}, "GN-GU": {}, "GN-K": {}, "GN-KA": {}, + "GN-KB": {}, "GN-KD": {}, "GN-KE": {}, "GN-KN": {}, "GN-KO": {}, + "GN-KS": {}, "GN-L": {}, "GN-LA": {}, "GN-LE": {}, "GN-LO": {}, + "GN-M": {}, "GN-MC": {}, "GN-MD": {}, "GN-ML": {}, "GN-MM": {}, + "GN-N": {}, "GN-NZ": {}, "GN-PI": {}, "GN-SI": {}, "GN-TE": {}, + "GN-TO": {}, "GN-YO": {}, "GQ-AN": {}, "GQ-BN": {}, "GQ-BS": {}, + "GQ-C": {}, "GQ-CS": {}, "GQ-I": {}, "GQ-KN": {}, "GQ-LI": {}, + "GQ-WN": {}, "GR-01": {}, "GR-03": {}, "GR-04": {}, "GR-05": {}, + "GR-06": {}, "GR-07": {}, "GR-11": {}, "GR-12": {}, "GR-13": {}, + "GR-14": {}, "GR-15": {}, "GR-16": {}, "GR-17": {}, "GR-21": {}, + "GR-22": {}, "GR-23": {}, "GR-24": {}, "GR-31": {}, "GR-32": {}, + "GR-33": {}, "GR-34": {}, "GR-41": {}, "GR-42": {}, "GR-43": {}, + "GR-44": {}, "GR-51": {}, "GR-52": {}, "GR-53": {}, "GR-54": {}, + "GR-55": {}, "GR-56": {}, "GR-57": {}, "GR-58": {}, "GR-59": {}, + "GR-61": {}, "GR-62": {}, "GR-63": {}, "GR-64": {}, "GR-69": {}, + "GR-71": {}, "GR-72": {}, "GR-73": {}, "GR-81": {}, "GR-82": {}, + "GR-83": {}, "GR-84": {}, "GR-85": {}, "GR-91": {}, "GR-92": {}, + "GR-93": {}, "GR-94": {}, "GR-A": {}, "GR-A1": {}, "GR-B": {}, + "GR-C": {}, "GR-D": {}, "GR-E": {}, "GR-F": {}, "GR-G": {}, + "GR-H": {}, "GR-I": {}, "GR-J": {}, "GR-K": {}, "GR-L": {}, + "GR-M": {}, "GT-01": {}, "GT-02": {}, "GT-03": {}, "GT-04": {}, + "GT-05": {}, "GT-06": {}, "GT-07": {}, "GT-08": {}, "GT-09": {}, + "GT-10": {}, "GT-11": {}, "GT-12": {}, "GT-13": {}, "GT-14": {}, + "GT-15": {}, "GT-16": {}, "GT-17": {}, "GT-18": {}, "GT-19": {}, + "GT-20": {}, "GT-21": {}, "GT-22": {}, "GW-BA": {}, "GW-BL": {}, + "GW-BM": {}, "GW-BS": {}, "GW-CA": {}, "GW-GA": {}, "GW-L": {}, + "GW-N": {}, "GW-OI": {}, "GW-QU": {}, "GW-S": {}, "GW-TO": {}, + "GY-BA": {}, "GY-CU": {}, "GY-DE": {}, "GY-EB": {}, "GY-ES": {}, + "GY-MA": {}, "GY-PM": {}, "GY-PT": {}, "GY-UD": {}, "GY-UT": {}, + "HN-AT": {}, "HN-CH": {}, "HN-CL": {}, "HN-CM": {}, "HN-CP": {}, + "HN-CR": {}, "HN-EP": {}, "HN-FM": {}, "HN-GD": {}, "HN-IB": {}, + "HN-IN": {}, "HN-LE": {}, "HN-LP": {}, "HN-OC": {}, "HN-OL": {}, + "HN-SB": {}, "HN-VA": {}, "HN-YO": {}, "HR-01": {}, "HR-02": {}, + "HR-03": {}, "HR-04": {}, "HR-05": {}, "HR-06": {}, "HR-07": {}, + "HR-08": {}, "HR-09": {}, "HR-10": {}, "HR-11": {}, "HR-12": {}, + "HR-13": {}, "HR-14": {}, "HR-15": {}, "HR-16": {}, "HR-17": {}, + "HR-18": {}, "HR-19": {}, "HR-20": {}, "HR-21": {}, "HT-AR": {}, + "HT-CE": {}, "HT-GA": {}, "HT-ND": {}, "HT-NE": {}, "HT-NO": {}, "HT-NI": {}, + "HT-OU": {}, "HT-SD": {}, "HT-SE": {}, "HU-BA": {}, "HU-BC": {}, + "HU-BE": {}, "HU-BK": {}, "HU-BU": {}, "HU-BZ": {}, "HU-CS": {}, + "HU-DE": {}, "HU-DU": {}, "HU-EG": {}, "HU-ER": {}, "HU-FE": {}, + "HU-GS": {}, "HU-GY": {}, "HU-HB": {}, "HU-HE": {}, "HU-HV": {}, + "HU-JN": {}, "HU-KE": {}, "HU-KM": {}, "HU-KV": {}, "HU-MI": {}, + "HU-NK": {}, "HU-NO": {}, "HU-NY": {}, "HU-PE": {}, "HU-PS": {}, + "HU-SD": {}, "HU-SF": {}, "HU-SH": {}, "HU-SK": {}, "HU-SN": {}, + "HU-SO": {}, "HU-SS": {}, "HU-ST": {}, "HU-SZ": {}, "HU-TB": {}, + "HU-TO": {}, "HU-VA": {}, "HU-VE": {}, "HU-VM": {}, "HU-ZA": {}, + "HU-ZE": {}, "ID-AC": {}, "ID-BA": {}, "ID-BB": {}, "ID-BE": {}, + "ID-BT": {}, "ID-GO": {}, "ID-IJ": {}, "ID-JA": {}, "ID-JB": {}, + "ID-JI": {}, "ID-JK": {}, "ID-JT": {}, "ID-JW": {}, "ID-KA": {}, + "ID-KB": {}, "ID-KI": {}, "ID-KU": {}, "ID-KR": {}, "ID-KS": {}, + "ID-KT": {}, "ID-LA": {}, "ID-MA": {}, "ID-ML": {}, "ID-MU": {}, + "ID-NB": {}, "ID-NT": {}, "ID-NU": {}, "ID-PA": {}, "ID-PB": {}, + "ID-PE": {}, "ID-PP": {}, "ID-PS": {}, "ID-PT": {}, "ID-RI": {}, + "ID-SA": {}, "ID-SB": {}, "ID-SG": {}, "ID-SL": {}, "ID-SM": {}, + "ID-SN": {}, "ID-SR": {}, "ID-SS": {}, "ID-ST": {}, "ID-SU": {}, + "ID-YO": {}, "IE-C": {}, "IE-CE": {}, "IE-CN": {}, "IE-CO": {}, + "IE-CW": {}, "IE-D": {}, "IE-DL": {}, "IE-G": {}, "IE-KE": {}, + "IE-KK": {}, "IE-KY": {}, "IE-L": {}, "IE-LD": {}, "IE-LH": {}, + "IE-LK": {}, "IE-LM": {}, "IE-LS": {}, "IE-M": {}, "IE-MH": {}, + "IE-MN": {}, "IE-MO": {}, "IE-OY": {}, "IE-RN": {}, "IE-SO": {}, + "IE-TA": {}, "IE-U": {}, "IE-WD": {}, "IE-WH": {}, "IE-WW": {}, + "IE-WX": {}, "IL-D": {}, "IL-HA": {}, "IL-JM": {}, "IL-M": {}, + "IL-TA": {}, "IL-Z": {}, "IN-AN": {}, "IN-AP": {}, "IN-AR": {}, + "IN-AS": {}, "IN-BR": {}, "IN-CH": {}, "IN-CT": {}, "IN-DH": {}, + "IN-DL": {}, "IN-DN": {}, "IN-GA": {}, "IN-GJ": {}, "IN-HP": {}, + "IN-HR": {}, "IN-JH": {}, "IN-JK": {}, "IN-KA": {}, "IN-KL": {}, + "IN-LD": {}, "IN-MH": {}, "IN-ML": {}, "IN-MN": {}, "IN-MP": {}, + "IN-MZ": {}, "IN-NL": {}, "IN-TG": {}, "IN-OR": {}, "IN-PB": {}, "IN-PY": {}, + "IN-RJ": {}, "IN-SK": {}, "IN-TN": {}, "IN-TR": {}, "IN-UP": {}, + "IN-UT": {}, "IN-WB": {}, "IQ-AN": {}, "IQ-AR": {}, "IQ-BA": {}, + "IQ-BB": {}, "IQ-BG": {}, "IQ-DA": {}, "IQ-DI": {}, "IQ-DQ": {}, + "IQ-KA": {}, "IQ-KI": {}, "IQ-MA": {}, "IQ-MU": {}, "IQ-NA": {}, "IQ-NI": {}, + "IQ-QA": {}, "IQ-SD": {}, "IQ-SW": {}, "IQ-SU": {}, "IQ-TS": {}, "IQ-WA": {}, + "IR-00": {}, "IR-01": {}, "IR-02": {}, "IR-03": {}, "IR-04": {}, "IR-05": {}, + "IR-06": {}, "IR-07": {}, "IR-08": {}, "IR-09": {}, "IR-10": {}, "IR-11": {}, + "IR-12": {}, "IR-13": {}, "IR-14": {}, "IR-15": {}, "IR-16": {}, + "IR-17": {}, "IR-18": {}, "IR-19": {}, "IR-20": {}, "IR-21": {}, + "IR-22": {}, "IR-23": {}, "IR-24": {}, "IR-25": {}, "IR-26": {}, + "IR-27": {}, "IR-28": {}, "IR-29": {}, "IR-30": {}, "IR-31": {}, + "IS-0": {}, "IS-1": {}, "IS-2": {}, "IS-3": {}, "IS-4": {}, + "IS-5": {}, "IS-6": {}, "IS-7": {}, "IS-8": {}, "IT-21": {}, + "IT-23": {}, "IT-25": {}, "IT-32": {}, "IT-34": {}, "IT-36": {}, + "IT-42": {}, "IT-45": {}, "IT-52": {}, "IT-55": {}, "IT-57": {}, + "IT-62": {}, "IT-65": {}, "IT-67": {}, "IT-72": {}, "IT-75": {}, + "IT-77": {}, "IT-78": {}, "IT-82": {}, "IT-88": {}, "IT-AG": {}, + "IT-AL": {}, "IT-AN": {}, "IT-AO": {}, "IT-AP": {}, "IT-AQ": {}, + "IT-AR": {}, "IT-AT": {}, "IT-AV": {}, "IT-BA": {}, "IT-BG": {}, + "IT-BI": {}, "IT-BL": {}, "IT-BN": {}, "IT-BO": {}, "IT-BR": {}, + "IT-BS": {}, "IT-BT": {}, "IT-BZ": {}, "IT-CA": {}, "IT-CB": {}, + "IT-CE": {}, "IT-CH": {}, "IT-CI": {}, "IT-CL": {}, "IT-CN": {}, + "IT-CO": {}, "IT-CR": {}, "IT-CS": {}, "IT-CT": {}, "IT-CZ": {}, + "IT-EN": {}, "IT-FC": {}, "IT-FE": {}, "IT-FG": {}, "IT-FI": {}, + "IT-FM": {}, "IT-FR": {}, "IT-GE": {}, "IT-GO": {}, "IT-GR": {}, + "IT-IM": {}, "IT-IS": {}, "IT-KR": {}, "IT-LC": {}, "IT-LE": {}, + "IT-LI": {}, "IT-LO": {}, "IT-LT": {}, "IT-LU": {}, "IT-MB": {}, + "IT-MC": {}, "IT-ME": {}, "IT-MI": {}, "IT-MN": {}, "IT-MO": {}, + "IT-MS": {}, "IT-MT": {}, "IT-NA": {}, "IT-NO": {}, "IT-NU": {}, + "IT-OG": {}, "IT-OR": {}, "IT-OT": {}, "IT-PA": {}, "IT-PC": {}, + "IT-PD": {}, "IT-PE": {}, "IT-PG": {}, "IT-PI": {}, "IT-PN": {}, + "IT-PO": {}, "IT-PR": {}, "IT-PT": {}, "IT-PU": {}, "IT-PV": {}, + "IT-PZ": {}, "IT-RA": {}, "IT-RC": {}, "IT-RE": {}, "IT-RG": {}, + "IT-RI": {}, "IT-RM": {}, "IT-RN": {}, "IT-RO": {}, "IT-SA": {}, + "IT-SI": {}, "IT-SO": {}, "IT-SP": {}, "IT-SR": {}, "IT-SS": {}, + "IT-SV": {}, "IT-TA": {}, "IT-TE": {}, "IT-TN": {}, "IT-TO": {}, + "IT-TP": {}, "IT-TR": {}, "IT-TS": {}, "IT-TV": {}, "IT-UD": {}, + "IT-VA": {}, "IT-VB": {}, "IT-VC": {}, "IT-VE": {}, "IT-VI": {}, + "IT-VR": {}, "IT-VS": {}, "IT-VT": {}, "IT-VV": {}, "JM-01": {}, + "JM-02": {}, "JM-03": {}, "JM-04": {}, "JM-05": {}, "JM-06": {}, + "JM-07": {}, "JM-08": {}, "JM-09": {}, "JM-10": {}, "JM-11": {}, + "JM-12": {}, "JM-13": {}, "JM-14": {}, "JO-AJ": {}, "JO-AM": {}, + "JO-AQ": {}, "JO-AT": {}, "JO-AZ": {}, "JO-BA": {}, "JO-IR": {}, + "JO-JA": {}, "JO-KA": {}, "JO-MA": {}, "JO-MD": {}, "JO-MN": {}, + "JP-01": {}, "JP-02": {}, "JP-03": {}, "JP-04": {}, "JP-05": {}, + "JP-06": {}, "JP-07": {}, "JP-08": {}, "JP-09": {}, "JP-10": {}, + "JP-11": {}, "JP-12": {}, "JP-13": {}, "JP-14": {}, "JP-15": {}, + "JP-16": {}, "JP-17": {}, "JP-18": {}, "JP-19": {}, "JP-20": {}, + "JP-21": {}, "JP-22": {}, "JP-23": {}, "JP-24": {}, "JP-25": {}, + "JP-26": {}, "JP-27": {}, "JP-28": {}, "JP-29": {}, "JP-30": {}, + "JP-31": {}, "JP-32": {}, "JP-33": {}, "JP-34": {}, "JP-35": {}, + "JP-36": {}, "JP-37": {}, "JP-38": {}, "JP-39": {}, "JP-40": {}, + "JP-41": {}, "JP-42": {}, "JP-43": {}, "JP-44": {}, "JP-45": {}, + "JP-46": {}, "JP-47": {}, "KE-01": {}, "KE-02": {}, "KE-03": {}, + "KE-04": {}, "KE-05": {}, "KE-06": {}, "KE-07": {}, "KE-08": {}, + "KE-09": {}, "KE-10": {}, "KE-11": {}, "KE-12": {}, "KE-13": {}, + "KE-14": {}, "KE-15": {}, "KE-16": {}, "KE-17": {}, "KE-18": {}, + "KE-19": {}, "KE-20": {}, "KE-21": {}, "KE-22": {}, "KE-23": {}, + "KE-24": {}, "KE-25": {}, "KE-26": {}, "KE-27": {}, "KE-28": {}, + "KE-29": {}, "KE-30": {}, "KE-31": {}, "KE-32": {}, "KE-33": {}, + "KE-34": {}, "KE-35": {}, "KE-36": {}, "KE-37": {}, "KE-38": {}, + "KE-39": {}, "KE-40": {}, "KE-41": {}, "KE-42": {}, "KE-43": {}, + "KE-44": {}, "KE-45": {}, "KE-46": {}, "KE-47": {}, "KG-B": {}, + "KG-C": {}, "KG-GB": {}, "KG-GO": {}, "KG-J": {}, "KG-N": {}, "KG-O": {}, + "KG-T": {}, "KG-Y": {}, "KH-1": {}, "KH-10": {}, "KH-11": {}, + "KH-12": {}, "KH-13": {}, "KH-14": {}, "KH-15": {}, "KH-16": {}, + "KH-17": {}, "KH-18": {}, "KH-19": {}, "KH-2": {}, "KH-20": {}, + "KH-21": {}, "KH-22": {}, "KH-23": {}, "KH-24": {}, "KH-3": {}, + "KH-4": {}, "KH-5": {}, "KH-6": {}, "KH-7": {}, "KH-8": {}, + "KH-9": {}, "KI-G": {}, "KI-L": {}, "KI-P": {}, "KM-A": {}, + "KM-G": {}, "KM-M": {}, "KN-01": {}, "KN-02": {}, "KN-03": {}, + "KN-04": {}, "KN-05": {}, "KN-06": {}, "KN-07": {}, "KN-08": {}, + "KN-09": {}, "KN-10": {}, "KN-11": {}, "KN-12": {}, "KN-13": {}, + "KN-15": {}, "KN-K": {}, "KN-N": {}, "KP-01": {}, "KP-02": {}, + "KP-03": {}, "KP-04": {}, "KP-05": {}, "KP-06": {}, "KP-07": {}, + "KP-08": {}, "KP-09": {}, "KP-10": {}, "KP-13": {}, "KR-11": {}, + "KR-26": {}, "KR-27": {}, "KR-28": {}, "KR-29": {}, "KR-30": {}, + "KR-31": {}, "KR-41": {}, "KR-42": {}, "KR-43": {}, "KR-44": {}, + "KR-45": {}, "KR-46": {}, "KR-47": {}, "KR-48": {}, "KR-49": {}, + "KW-AH": {}, "KW-FA": {}, "KW-HA": {}, "KW-JA": {}, "KW-KU": {}, + "KW-MU": {}, "KZ-10": {}, "KZ-75": {}, "KZ-19": {}, "KZ-11": {}, + "KZ-15": {}, "KZ-71": {}, "KZ-23": {}, "KZ-27": {}, "KZ-47": {}, + "KZ-55": {}, "KZ-35": {}, "KZ-39": {}, "KZ-43": {}, "KZ-63": {}, + "KZ-79": {}, "KZ-59": {}, "KZ-61": {}, "KZ-62": {}, "KZ-31": {}, + "KZ-33": {}, "LA-AT": {}, "LA-BK": {}, "LA-BL": {}, + "LA-CH": {}, "LA-HO": {}, "LA-KH": {}, "LA-LM": {}, "LA-LP": {}, + "LA-OU": {}, "LA-PH": {}, "LA-SL": {}, "LA-SV": {}, "LA-VI": {}, + "LA-VT": {}, "LA-XA": {}, "LA-XE": {}, "LA-XI": {}, "LA-XS": {}, + "LB-AK": {}, "LB-AS": {}, "LB-BA": {}, "LB-BH": {}, "LB-BI": {}, + "LB-JA": {}, "LB-JL": {}, "LB-NA": {}, "LC-01": {}, "LC-02": {}, + "LC-03": {}, "LC-05": {}, "LC-06": {}, "LC-07": {}, "LC-08": {}, + "LC-10": {}, "LC-11": {}, "LI-01": {}, "LI-02": {}, + "LI-03": {}, "LI-04": {}, "LI-05": {}, "LI-06": {}, "LI-07": {}, + "LI-08": {}, "LI-09": {}, "LI-10": {}, "LI-11": {}, "LK-1": {}, + "LK-11": {}, "LK-12": {}, "LK-13": {}, "LK-2": {}, "LK-21": {}, + "LK-22": {}, "LK-23": {}, "LK-3": {}, "LK-31": {}, "LK-32": {}, + "LK-33": {}, "LK-4": {}, "LK-41": {}, "LK-42": {}, "LK-43": {}, + "LK-44": {}, "LK-45": {}, "LK-5": {}, "LK-51": {}, "LK-52": {}, + "LK-53": {}, "LK-6": {}, "LK-61": {}, "LK-62": {}, "LK-7": {}, + "LK-71": {}, "LK-72": {}, "LK-8": {}, "LK-81": {}, "LK-82": {}, + "LK-9": {}, "LK-91": {}, "LK-92": {}, "LR-BG": {}, "LR-BM": {}, + "LR-CM": {}, "LR-GB": {}, "LR-GG": {}, "LR-GK": {}, "LR-LO": {}, + "LR-MG": {}, "LR-MO": {}, "LR-MY": {}, "LR-NI": {}, "LR-RI": {}, + "LR-SI": {}, "LS-A": {}, "LS-B": {}, "LS-C": {}, "LS-D": {}, + "LS-E": {}, "LS-F": {}, "LS-G": {}, "LS-H": {}, "LS-J": {}, + "LS-K": {}, "LT-AL": {}, "LT-KL": {}, "LT-KU": {}, "LT-MR": {}, + "LT-PN": {}, "LT-SA": {}, "LT-TA": {}, "LT-TE": {}, "LT-UT": {}, + "LT-VL": {}, "LU-CA": {}, "LU-CL": {}, "LU-DI": {}, "LU-EC": {}, + "LU-ES": {}, "LU-GR": {}, "LU-LU": {}, "LU-ME": {}, "LU-RD": {}, + "LU-RM": {}, "LU-VD": {}, "LU-WI": {}, "LU-D": {}, "LU-G": {}, "LU-L": {}, + "LV-001": {}, "LV-111": {}, "LV-112": {}, "LV-113": {}, + "LV-002": {}, "LV-003": {}, "LV-004": {}, "LV-005": {}, "LV-006": {}, + "LV-007": {}, "LV-008": {}, "LV-009": {}, "LV-010": {}, "LV-011": {}, + "LV-012": {}, "LV-013": {}, "LV-014": {}, "LV-015": {}, "LV-016": {}, + "LV-017": {}, "LV-018": {}, "LV-019": {}, "LV-020": {}, "LV-021": {}, + "LV-022": {}, "LV-023": {}, "LV-024": {}, "LV-025": {}, "LV-026": {}, + "LV-027": {}, "LV-028": {}, "LV-029": {}, "LV-030": {}, "LV-031": {}, + "LV-032": {}, "LV-033": {}, "LV-034": {}, "LV-035": {}, "LV-036": {}, + "LV-037": {}, "LV-038": {}, "LV-039": {}, "LV-040": {}, "LV-041": {}, + "LV-042": {}, "LV-043": {}, "LV-044": {}, "LV-045": {}, "LV-046": {}, + "LV-047": {}, "LV-048": {}, "LV-049": {}, "LV-050": {}, "LV-051": {}, + "LV-052": {}, "LV-053": {}, "LV-054": {}, "LV-055": {}, "LV-056": {}, + "LV-057": {}, "LV-058": {}, "LV-059": {}, "LV-060": {}, "LV-061": {}, + "LV-062": {}, "LV-063": {}, "LV-064": {}, "LV-065": {}, "LV-066": {}, + "LV-067": {}, "LV-068": {}, "LV-069": {}, "LV-070": {}, "LV-071": {}, + "LV-072": {}, "LV-073": {}, "LV-074": {}, "LV-075": {}, "LV-076": {}, + "LV-077": {}, "LV-078": {}, "LV-079": {}, "LV-080": {}, "LV-081": {}, + "LV-082": {}, "LV-083": {}, "LV-084": {}, "LV-085": {}, "LV-086": {}, + "LV-087": {}, "LV-088": {}, "LV-089": {}, "LV-090": {}, "LV-091": {}, + "LV-092": {}, "LV-093": {}, "LV-094": {}, "LV-095": {}, "LV-096": {}, + "LV-097": {}, "LV-098": {}, "LV-099": {}, "LV-100": {}, "LV-101": {}, + "LV-102": {}, "LV-103": {}, "LV-104": {}, "LV-105": {}, "LV-106": {}, + "LV-107": {}, "LV-108": {}, "LV-109": {}, "LV-110": {}, "LV-DGV": {}, + "LV-JEL": {}, "LV-JKB": {}, "LV-JUR": {}, "LV-LPX": {}, "LV-REZ": {}, + "LV-RIX": {}, "LV-VEN": {}, "LV-VMR": {}, "LY-BA": {}, "LY-BU": {}, + "LY-DR": {}, "LY-GT": {}, "LY-JA": {}, "LY-JB": {}, "LY-JG": {}, + "LY-JI": {}, "LY-JU": {}, "LY-KF": {}, "LY-MB": {}, "LY-MI": {}, + "LY-MJ": {}, "LY-MQ": {}, "LY-NL": {}, "LY-NQ": {}, "LY-SB": {}, + "LY-SR": {}, "LY-TB": {}, "LY-WA": {}, "LY-WD": {}, "LY-WS": {}, + "LY-ZA": {}, "MA-01": {}, "MA-02": {}, "MA-03": {}, "MA-04": {}, + "MA-05": {}, "MA-06": {}, "MA-07": {}, "MA-08": {}, "MA-09": {}, + "MA-10": {}, "MA-11": {}, "MA-12": {}, "MA-13": {}, "MA-14": {}, + "MA-15": {}, "MA-16": {}, "MA-AGD": {}, "MA-AOU": {}, "MA-ASZ": {}, + "MA-AZI": {}, "MA-BEM": {}, "MA-BER": {}, "MA-BES": {}, "MA-BOD": {}, + "MA-BOM": {}, "MA-CAS": {}, "MA-CHE": {}, "MA-CHI": {}, "MA-CHT": {}, + "MA-ERR": {}, "MA-ESI": {}, "MA-ESM": {}, "MA-FAH": {}, "MA-FES": {}, + "MA-FIG": {}, "MA-GUE": {}, "MA-HAJ": {}, "MA-HAO": {}, "MA-HOC": {}, + "MA-IFR": {}, "MA-INE": {}, "MA-JDI": {}, "MA-JRA": {}, "MA-KEN": {}, + "MA-KES": {}, "MA-KHE": {}, "MA-KHN": {}, "MA-KHO": {}, "MA-LAA": {}, + "MA-LAR": {}, "MA-MED": {}, "MA-MEK": {}, "MA-MMD": {}, "MA-MMN": {}, + "MA-MOH": {}, "MA-MOU": {}, "MA-NAD": {}, "MA-NOU": {}, "MA-OUA": {}, + "MA-OUD": {}, "MA-OUJ": {}, "MA-RAB": {}, "MA-SAF": {}, "MA-SAL": {}, + "MA-SEF": {}, "MA-SET": {}, "MA-SIK": {}, "MA-SKH": {}, "MA-SYB": {}, + "MA-TAI": {}, "MA-TAO": {}, "MA-TAR": {}, "MA-TAT": {}, "MA-TAZ": {}, + "MA-TET": {}, "MA-TIZ": {}, "MA-TNG": {}, "MA-TNT": {}, "MA-ZAG": {}, + "MC-CL": {}, "MC-CO": {}, "MC-FO": {}, "MC-GA": {}, "MC-JE": {}, + "MC-LA": {}, "MC-MA": {}, "MC-MC": {}, "MC-MG": {}, "MC-MO": {}, + "MC-MU": {}, "MC-PH": {}, "MC-SD": {}, "MC-SO": {}, "MC-SP": {}, + "MC-SR": {}, "MC-VR": {}, "MD-AN": {}, "MD-BA": {}, "MD-BD": {}, + "MD-BR": {}, "MD-BS": {}, "MD-CA": {}, "MD-CL": {}, "MD-CM": {}, + "MD-CR": {}, "MD-CS": {}, "MD-CT": {}, "MD-CU": {}, "MD-DO": {}, + "MD-DR": {}, "MD-DU": {}, "MD-ED": {}, "MD-FA": {}, "MD-FL": {}, + "MD-GA": {}, "MD-GL": {}, "MD-HI": {}, "MD-IA": {}, "MD-LE": {}, + "MD-NI": {}, "MD-OC": {}, "MD-OR": {}, "MD-RE": {}, "MD-RI": {}, + "MD-SD": {}, "MD-SI": {}, "MD-SN": {}, "MD-SO": {}, "MD-ST": {}, + "MD-SV": {}, "MD-TA": {}, "MD-TE": {}, "MD-UN": {}, "ME-01": {}, + "ME-02": {}, "ME-03": {}, "ME-04": {}, "ME-05": {}, "ME-06": {}, + "ME-07": {}, "ME-08": {}, "ME-09": {}, "ME-10": {}, "ME-11": {}, + "ME-12": {}, "ME-13": {}, "ME-14": {}, "ME-15": {}, "ME-16": {}, + "ME-17": {}, "ME-18": {}, "ME-19": {}, "ME-20": {}, "ME-21": {}, "ME-24": {}, + "MG-A": {}, "MG-D": {}, "MG-F": {}, "MG-M": {}, "MG-T": {}, + "MG-U": {}, "MH-ALK": {}, "MH-ALL": {}, "MH-ARN": {}, "MH-AUR": {}, + "MH-EBO": {}, "MH-ENI": {}, "MH-JAB": {}, "MH-JAL": {}, "MH-KIL": {}, + "MH-KWA": {}, "MH-L": {}, "MH-LAE": {}, "MH-LIB": {}, "MH-LIK": {}, + "MH-MAJ": {}, "MH-MAL": {}, "MH-MEJ": {}, "MH-MIL": {}, "MH-NMK": {}, + "MH-NMU": {}, "MH-RON": {}, "MH-T": {}, "MH-UJA": {}, "MH-UTI": {}, + "MH-WTJ": {}, "MH-WTN": {}, "MK-101": {}, "MK-102": {}, "MK-103": {}, + "MK-104": {}, "MK-105": {}, + "MK-106": {}, "MK-107": {}, "MK-108": {}, "MK-109": {}, "MK-201": {}, + "MK-202": {}, "MK-205": {}, "MK-206": {}, "MK-207": {}, "MK-208": {}, + "MK-209": {}, "MK-210": {}, "MK-211": {}, "MK-301": {}, "MK-303": {}, + "MK-307": {}, "MK-308": {}, "MK-310": {}, "MK-311": {}, "MK-312": {}, + "MK-401": {}, "MK-402": {}, "MK-403": {}, "MK-404": {}, "MK-405": {}, + "MK-406": {}, "MK-408": {}, "MK-409": {}, "MK-410": {}, "MK-501": {}, + "MK-502": {}, "MK-503": {}, "MK-505": {}, "MK-506": {}, "MK-507": {}, + "MK-508": {}, "MK-509": {}, "MK-601": {}, "MK-602": {}, "MK-604": {}, + "MK-605": {}, "MK-606": {}, "MK-607": {}, "MK-608": {}, "MK-609": {}, + "MK-701": {}, "MK-702": {}, "MK-703": {}, "MK-704": {}, "MK-705": {}, + "MK-803": {}, "MK-804": {}, "MK-806": {}, "MK-807": {}, "MK-809": {}, + "MK-810": {}, "MK-811": {}, "MK-812": {}, "MK-813": {}, "MK-814": {}, + "MK-816": {}, "ML-1": {}, "ML-2": {}, "ML-3": {}, "ML-4": {}, + "ML-5": {}, "ML-6": {}, "ML-7": {}, "ML-8": {}, "ML-BKO": {}, + "MM-01": {}, "MM-02": {}, "MM-03": {}, "MM-04": {}, "MM-05": {}, + "MM-06": {}, "MM-07": {}, "MM-11": {}, "MM-12": {}, "MM-13": {}, + "MM-14": {}, "MM-15": {}, "MM-16": {}, "MM-17": {}, "MM-18": {}, "MN-035": {}, + "MN-037": {}, "MN-039": {}, "MN-041": {}, "MN-043": {}, "MN-046": {}, + "MN-047": {}, "MN-049": {}, "MN-051": {}, "MN-053": {}, "MN-055": {}, + "MN-057": {}, "MN-059": {}, "MN-061": {}, "MN-063": {}, "MN-064": {}, + "MN-065": {}, "MN-067": {}, "MN-069": {}, "MN-071": {}, "MN-073": {}, + "MN-1": {}, "MR-01": {}, "MR-02": {}, "MR-03": {}, "MR-04": {}, + "MR-05": {}, "MR-06": {}, "MR-07": {}, "MR-08": {}, "MR-09": {}, + "MR-10": {}, "MR-11": {}, "MR-12": {}, "MR-13": {}, "MR-NKC": {}, "MT-01": {}, + "MT-02": {}, "MT-03": {}, "MT-04": {}, "MT-05": {}, "MT-06": {}, + "MT-07": {}, "MT-08": {}, "MT-09": {}, "MT-10": {}, "MT-11": {}, + "MT-12": {}, "MT-13": {}, "MT-14": {}, "MT-15": {}, "MT-16": {}, + "MT-17": {}, "MT-18": {}, "MT-19": {}, "MT-20": {}, "MT-21": {}, + "MT-22": {}, "MT-23": {}, "MT-24": {}, "MT-25": {}, "MT-26": {}, + "MT-27": {}, "MT-28": {}, "MT-29": {}, "MT-30": {}, "MT-31": {}, + "MT-32": {}, "MT-33": {}, "MT-34": {}, "MT-35": {}, "MT-36": {}, + "MT-37": {}, "MT-38": {}, "MT-39": {}, "MT-40": {}, "MT-41": {}, + "MT-42": {}, "MT-43": {}, "MT-44": {}, "MT-45": {}, "MT-46": {}, + "MT-47": {}, "MT-48": {}, "MT-49": {}, "MT-50": {}, "MT-51": {}, + "MT-52": {}, "MT-53": {}, "MT-54": {}, "MT-55": {}, "MT-56": {}, + "MT-57": {}, "MT-58": {}, "MT-59": {}, "MT-60": {}, "MT-61": {}, + "MT-62": {}, "MT-63": {}, "MT-64": {}, "MT-65": {}, "MT-66": {}, + "MT-67": {}, "MT-68": {}, "MU-AG": {}, "MU-BL": {}, "MU-BR": {}, + "MU-CC": {}, "MU-CU": {}, "MU-FL": {}, "MU-GP": {}, "MU-MO": {}, + "MU-PA": {}, "MU-PL": {}, "MU-PU": {}, "MU-PW": {}, "MU-QB": {}, + "MU-RO": {}, "MU-RP": {}, "MU-RR": {}, "MU-SA": {}, "MU-VP": {}, "MV-00": {}, + "MV-01": {}, "MV-02": {}, "MV-03": {}, "MV-04": {}, "MV-05": {}, + "MV-07": {}, "MV-08": {}, "MV-12": {}, "MV-13": {}, "MV-14": {}, + "MV-17": {}, "MV-20": {}, "MV-23": {}, "MV-24": {}, "MV-25": {}, + "MV-26": {}, "MV-27": {}, "MV-28": {}, "MV-29": {}, "MV-CE": {}, + "MV-MLE": {}, "MV-NC": {}, "MV-NO": {}, "MV-SC": {}, "MV-SU": {}, + "MV-UN": {}, "MV-US": {}, "MW-BA": {}, "MW-BL": {}, "MW-C": {}, + "MW-CK": {}, "MW-CR": {}, "MW-CT": {}, "MW-DE": {}, "MW-DO": {}, + "MW-KR": {}, "MW-KS": {}, "MW-LI": {}, "MW-LK": {}, "MW-MC": {}, + "MW-MG": {}, "MW-MH": {}, "MW-MU": {}, "MW-MW": {}, "MW-MZ": {}, + "MW-N": {}, "MW-NB": {}, "MW-NE": {}, "MW-NI": {}, "MW-NK": {}, + "MW-NS": {}, "MW-NU": {}, "MW-PH": {}, "MW-RU": {}, "MW-S": {}, + "MW-SA": {}, "MW-TH": {}, "MW-ZO": {}, "MX-AGU": {}, "MX-BCN": {}, + "MX-BCS": {}, "MX-CAM": {}, "MX-CHH": {}, "MX-CHP": {}, "MX-COA": {}, + "MX-COL": {}, "MX-CMX": {}, "MX-DIF": {}, "MX-DUR": {}, "MX-GRO": {}, "MX-GUA": {}, + "MX-HID": {}, "MX-JAL": {}, "MX-MEX": {}, "MX-MIC": {}, "MX-MOR": {}, + "MX-NAY": {}, "MX-NLE": {}, "MX-OAX": {}, "MX-PUE": {}, "MX-QUE": {}, + "MX-ROO": {}, "MX-SIN": {}, "MX-SLP": {}, "MX-SON": {}, "MX-TAB": {}, + "MX-TAM": {}, "MX-TLA": {}, "MX-VER": {}, "MX-YUC": {}, "MX-ZAC": {}, + "MY-01": {}, "MY-02": {}, "MY-03": {}, "MY-04": {}, "MY-05": {}, + "MY-06": {}, "MY-07": {}, "MY-08": {}, "MY-09": {}, "MY-10": {}, + "MY-11": {}, "MY-12": {}, "MY-13": {}, "MY-14": {}, "MY-15": {}, + "MY-16": {}, "MZ-A": {}, "MZ-B": {}, "MZ-G": {}, "MZ-I": {}, + "MZ-L": {}, "MZ-MPM": {}, "MZ-N": {}, "MZ-P": {}, "MZ-Q": {}, + "MZ-S": {}, "MZ-T": {}, "NA-CA": {}, "NA-ER": {}, "NA-HA": {}, + "NA-KA": {}, "NA-KE": {}, "NA-KH": {}, "NA-KU": {}, "NA-KW": {}, "NA-OD": {}, "NA-OH": {}, + "NA-OK": {}, "NA-ON": {}, "NA-OS": {}, "NA-OT": {}, "NA-OW": {}, + "NE-1": {}, "NE-2": {}, "NE-3": {}, "NE-4": {}, "NE-5": {}, + "NE-6": {}, "NE-7": {}, "NE-8": {}, "NG-AB": {}, "NG-AD": {}, + "NG-AK": {}, "NG-AN": {}, "NG-BA": {}, "NG-BE": {}, "NG-BO": {}, + "NG-BY": {}, "NG-CR": {}, "NG-DE": {}, "NG-EB": {}, "NG-ED": {}, + "NG-EK": {}, "NG-EN": {}, "NG-FC": {}, "NG-GO": {}, "NG-IM": {}, + "NG-JI": {}, "NG-KD": {}, "NG-KE": {}, "NG-KN": {}, "NG-KO": {}, + "NG-KT": {}, "NG-KW": {}, "NG-LA": {}, "NG-NA": {}, "NG-NI": {}, + "NG-OG": {}, "NG-ON": {}, "NG-OS": {}, "NG-OY": {}, "NG-PL": {}, + "NG-RI": {}, "NG-SO": {}, "NG-TA": {}, "NG-YO": {}, "NG-ZA": {}, + "NI-AN": {}, "NI-AS": {}, "NI-BO": {}, "NI-CA": {}, "NI-CI": {}, + "NI-CO": {}, "NI-ES": {}, "NI-GR": {}, "NI-JI": {}, "NI-LE": {}, + "NI-MD": {}, "NI-MN": {}, "NI-MS": {}, "NI-MT": {}, "NI-NS": {}, + "NI-RI": {}, "NI-SJ": {}, "NL-AW": {}, "NL-BQ1": {}, "NL-BQ2": {}, + "NL-BQ3": {}, "NL-CW": {}, "NL-DR": {}, "NL-FL": {}, "NL-FR": {}, + "NL-GE": {}, "NL-GR": {}, "NL-LI": {}, "NL-NB": {}, "NL-NH": {}, + "NL-OV": {}, "NL-SX": {}, "NL-UT": {}, "NL-ZE": {}, "NL-ZH": {}, + "NO-03": {}, "NO-11": {}, "NO-15": {}, "NO-16": {}, "NO-17": {}, + "NO-18": {}, "NO-21": {}, "NO-30": {}, "NO-34": {}, "NO-38": {}, + "NO-42": {}, "NO-46": {}, "NO-50": {}, "NO-54": {}, + "NO-22": {}, "NP-1": {}, "NP-2": {}, "NP-3": {}, "NP-4": {}, + "NP-5": {}, "NP-BA": {}, "NP-BH": {}, "NP-DH": {}, "NP-GA": {}, + "NP-JA": {}, "NP-KA": {}, "NP-KO": {}, "NP-LU": {}, "NP-MA": {}, + "NP-ME": {}, "NP-NA": {}, "NP-RA": {}, "NP-SA": {}, "NP-SE": {}, + "NR-01": {}, "NR-02": {}, "NR-03": {}, "NR-04": {}, "NR-05": {}, + "NR-06": {}, "NR-07": {}, "NR-08": {}, "NR-09": {}, "NR-10": {}, + "NR-11": {}, "NR-12": {}, "NR-13": {}, "NR-14": {}, "NZ-AUK": {}, + "NZ-BOP": {}, "NZ-CAN": {}, "NZ-CIT": {}, "NZ-GIS": {}, "NZ-HKB": {}, + "NZ-MBH": {}, "NZ-MWT": {}, "NZ-N": {}, "NZ-NSN": {}, "NZ-NTL": {}, + "NZ-OTA": {}, "NZ-S": {}, "NZ-STL": {}, "NZ-TAS": {}, "NZ-TKI": {}, + "NZ-WGN": {}, "NZ-WKO": {}, "NZ-WTC": {}, "OM-BA": {}, "OM-BS": {}, "OM-BU": {}, "OM-BJ": {}, + "OM-DA": {}, "OM-MA": {}, "OM-MU": {}, "OM-SH": {}, "OM-SJ": {}, "OM-SS": {}, "OM-WU": {}, + "OM-ZA": {}, "OM-ZU": {}, "PA-1": {}, "PA-2": {}, "PA-3": {}, + "PA-4": {}, "PA-5": {}, "PA-6": {}, "PA-7": {}, "PA-8": {}, + "PA-9": {}, "PA-EM": {}, "PA-KY": {}, "PA-NB": {}, "PE-AMA": {}, + "PE-ANC": {}, "PE-APU": {}, "PE-ARE": {}, "PE-AYA": {}, "PE-CAJ": {}, + "PE-CAL": {}, "PE-CUS": {}, "PE-HUC": {}, "PE-HUV": {}, "PE-ICA": {}, + "PE-JUN": {}, "PE-LAL": {}, "PE-LAM": {}, "PE-LIM": {}, "PE-LMA": {}, + "PE-LOR": {}, "PE-MDD": {}, "PE-MOQ": {}, "PE-PAS": {}, "PE-PIU": {}, + "PE-PUN": {}, "PE-SAM": {}, "PE-TAC": {}, "PE-TUM": {}, "PE-UCA": {}, + "PG-CPK": {}, "PG-CPM": {}, "PG-EBR": {}, "PG-EHG": {}, "PG-EPW": {}, + "PG-ESW": {}, "PG-GPK": {}, "PG-MBA": {}, "PG-MPL": {}, "PG-MPM": {}, + "PG-MRL": {}, "PG-NCD": {}, "PG-NIK": {}, "PG-NPP": {}, "PG-NSB": {}, + "PG-SAN": {}, "PG-SHM": {}, "PG-WBK": {}, "PG-WHM": {}, "PG-WPD": {}, + "PH-00": {}, "PH-01": {}, "PH-02": {}, "PH-03": {}, "PH-05": {}, + "PH-06": {}, "PH-07": {}, "PH-08": {}, "PH-09": {}, "PH-10": {}, + "PH-11": {}, "PH-12": {}, "PH-13": {}, "PH-14": {}, "PH-15": {}, + "PH-40": {}, "PH-41": {}, "PH-ABR": {}, "PH-AGN": {}, "PH-AGS": {}, + "PH-AKL": {}, "PH-ALB": {}, "PH-ANT": {}, "PH-APA": {}, "PH-AUR": {}, + "PH-BAN": {}, "PH-BAS": {}, "PH-BEN": {}, "PH-BIL": {}, "PH-BOH": {}, + "PH-BTG": {}, "PH-BTN": {}, "PH-BUK": {}, "PH-BUL": {}, "PH-CAG": {}, + "PH-CAM": {}, "PH-CAN": {}, "PH-CAP": {}, "PH-CAS": {}, "PH-CAT": {}, + "PH-CAV": {}, "PH-CEB": {}, "PH-COM": {}, "PH-DAO": {}, "PH-DAS": {}, + "PH-DAV": {}, "PH-DIN": {}, "PH-EAS": {}, "PH-GUI": {}, "PH-IFU": {}, + "PH-ILI": {}, "PH-ILN": {}, "PH-ILS": {}, "PH-ISA": {}, "PH-KAL": {}, + "PH-LAG": {}, "PH-LAN": {}, "PH-LAS": {}, "PH-LEY": {}, "PH-LUN": {}, + "PH-MAD": {}, "PH-MAG": {}, "PH-MAS": {}, "PH-MDC": {}, "PH-MDR": {}, + "PH-MOU": {}, "PH-MSC": {}, "PH-MSR": {}, "PH-NCO": {}, "PH-NEC": {}, + "PH-NER": {}, "PH-NSA": {}, "PH-NUE": {}, "PH-NUV": {}, "PH-PAM": {}, + "PH-PAN": {}, "PH-PLW": {}, "PH-QUE": {}, "PH-QUI": {}, "PH-RIZ": {}, + "PH-ROM": {}, "PH-SAR": {}, "PH-SCO": {}, "PH-SIG": {}, "PH-SLE": {}, + "PH-SLU": {}, "PH-SOR": {}, "PH-SUK": {}, "PH-SUN": {}, "PH-SUR": {}, + "PH-TAR": {}, "PH-TAW": {}, "PH-WSA": {}, "PH-ZAN": {}, "PH-ZAS": {}, + "PH-ZMB": {}, "PH-ZSI": {}, "PK-BA": {}, "PK-GB": {}, "PK-IS": {}, + "PK-JK": {}, "PK-KP": {}, "PK-PB": {}, "PK-SD": {}, "PK-TA": {}, + "PL-02": {}, "PL-04": {}, "PL-06": {}, "PL-08": {}, "PL-10": {}, + "PL-12": {}, "PL-14": {}, "PL-16": {}, "PL-18": {}, "PL-20": {}, + "PL-22": {}, "PL-24": {}, "PL-26": {}, "PL-28": {}, "PL-30": {}, "PL-32": {}, + "PS-BTH": {}, "PS-DEB": {}, "PS-GZA": {}, "PS-HBN": {}, + "PS-JEM": {}, "PS-JEN": {}, "PS-JRH": {}, "PS-KYS": {}, "PS-NBS": {}, + "PS-NGZ": {}, "PS-QQA": {}, "PS-RBH": {}, "PS-RFH": {}, "PS-SLT": {}, + "PS-TBS": {}, "PS-TKM": {}, "PT-01": {}, "PT-02": {}, "PT-03": {}, + "PT-04": {}, "PT-05": {}, "PT-06": {}, "PT-07": {}, "PT-08": {}, + "PT-09": {}, "PT-10": {}, "PT-11": {}, "PT-12": {}, "PT-13": {}, + "PT-14": {}, "PT-15": {}, "PT-16": {}, "PT-17": {}, "PT-18": {}, + "PT-20": {}, "PT-30": {}, "PW-002": {}, "PW-004": {}, "PW-010": {}, + "PW-050": {}, "PW-100": {}, "PW-150": {}, "PW-212": {}, "PW-214": {}, + "PW-218": {}, "PW-222": {}, "PW-224": {}, "PW-226": {}, "PW-227": {}, + "PW-228": {}, "PW-350": {}, "PW-370": {}, "PY-1": {}, "PY-10": {}, + "PY-11": {}, "PY-12": {}, "PY-13": {}, "PY-14": {}, "PY-15": {}, + "PY-16": {}, "PY-19": {}, "PY-2": {}, "PY-3": {}, "PY-4": {}, + "PY-5": {}, "PY-6": {}, "PY-7": {}, "PY-8": {}, "PY-9": {}, + "PY-ASU": {}, "QA-DA": {}, "QA-KH": {}, "QA-MS": {}, "QA-RA": {}, + "QA-US": {}, "QA-WA": {}, "QA-ZA": {}, "RO-AB": {}, "RO-AG": {}, + "RO-AR": {}, "RO-B": {}, "RO-BC": {}, "RO-BH": {}, "RO-BN": {}, + "RO-BR": {}, "RO-BT": {}, "RO-BV": {}, "RO-BZ": {}, "RO-CJ": {}, + "RO-CL": {}, "RO-CS": {}, "RO-CT": {}, "RO-CV": {}, "RO-DB": {}, + "RO-DJ": {}, "RO-GJ": {}, "RO-GL": {}, "RO-GR": {}, "RO-HD": {}, + "RO-HR": {}, "RO-IF": {}, "RO-IL": {}, "RO-IS": {}, "RO-MH": {}, + "RO-MM": {}, "RO-MS": {}, "RO-NT": {}, "RO-OT": {}, "RO-PH": {}, + "RO-SB": {}, "RO-SJ": {}, "RO-SM": {}, "RO-SV": {}, "RO-TL": {}, + "RO-TM": {}, "RO-TR": {}, "RO-VL": {}, "RO-VN": {}, "RO-VS": {}, + "RS-00": {}, "RS-01": {}, "RS-02": {}, "RS-03": {}, "RS-04": {}, + "RS-05": {}, "RS-06": {}, "RS-07": {}, "RS-08": {}, "RS-09": {}, + "RS-10": {}, "RS-11": {}, "RS-12": {}, "RS-13": {}, "RS-14": {}, + "RS-15": {}, "RS-16": {}, "RS-17": {}, "RS-18": {}, "RS-19": {}, + "RS-20": {}, "RS-21": {}, "RS-22": {}, "RS-23": {}, "RS-24": {}, + "RS-25": {}, "RS-26": {}, "RS-27": {}, "RS-28": {}, "RS-29": {}, + "RS-KM": {}, "RS-VO": {}, "RU-AD": {}, "RU-AL": {}, "RU-ALT": {}, + "RU-AMU": {}, "RU-ARK": {}, "RU-AST": {}, "RU-BA": {}, "RU-BEL": {}, + "RU-BRY": {}, "RU-BU": {}, "RU-CE": {}, "RU-CHE": {}, "RU-CHU": {}, + "RU-CU": {}, "RU-DA": {}, "RU-IN": {}, "RU-IRK": {}, "RU-IVA": {}, + "RU-KAM": {}, "RU-KB": {}, "RU-KC": {}, "RU-KDA": {}, "RU-KEM": {}, + "RU-KGD": {}, "RU-KGN": {}, "RU-KHA": {}, "RU-KHM": {}, "RU-KIR": {}, + "RU-KK": {}, "RU-KL": {}, "RU-KLU": {}, "RU-KO": {}, "RU-KOS": {}, + "RU-KR": {}, "RU-KRS": {}, "RU-KYA": {}, "RU-LEN": {}, "RU-LIP": {}, + "RU-MAG": {}, "RU-ME": {}, "RU-MO": {}, "RU-MOS": {}, "RU-MOW": {}, + "RU-MUR": {}, "RU-NEN": {}, "RU-NGR": {}, "RU-NIZ": {}, "RU-NVS": {}, + "RU-OMS": {}, "RU-ORE": {}, "RU-ORL": {}, "RU-PER": {}, "RU-PNZ": {}, + "RU-PRI": {}, "RU-PSK": {}, "RU-ROS": {}, "RU-RYA": {}, "RU-SA": {}, + "RU-SAK": {}, "RU-SAM": {}, "RU-SAR": {}, "RU-SE": {}, "RU-SMO": {}, + "RU-SPE": {}, "RU-STA": {}, "RU-SVE": {}, "RU-TA": {}, "RU-TAM": {}, + "RU-TOM": {}, "RU-TUL": {}, "RU-TVE": {}, "RU-TY": {}, "RU-TYU": {}, + "RU-UD": {}, "RU-ULY": {}, "RU-VGG": {}, "RU-VLA": {}, "RU-VLG": {}, + "RU-VOR": {}, "RU-YAN": {}, "RU-YAR": {}, "RU-YEV": {}, "RU-ZAB": {}, + "RW-01": {}, "RW-02": {}, "RW-03": {}, "RW-04": {}, "RW-05": {}, + "SA-01": {}, "SA-02": {}, "SA-03": {}, "SA-04": {}, "SA-05": {}, + "SA-06": {}, "SA-07": {}, "SA-08": {}, "SA-09": {}, "SA-10": {}, + "SA-11": {}, "SA-12": {}, "SA-14": {}, "SB-CE": {}, "SB-CH": {}, + "SB-CT": {}, "SB-GU": {}, "SB-IS": {}, "SB-MK": {}, "SB-ML": {}, + "SB-RB": {}, "SB-TE": {}, "SB-WE": {}, "SC-01": {}, "SC-02": {}, + "SC-03": {}, "SC-04": {}, "SC-05": {}, "SC-06": {}, "SC-07": {}, + "SC-08": {}, "SC-09": {}, "SC-10": {}, "SC-11": {}, "SC-12": {}, + "SC-13": {}, "SC-14": {}, "SC-15": {}, "SC-16": {}, "SC-17": {}, + "SC-18": {}, "SC-19": {}, "SC-20": {}, "SC-21": {}, "SC-22": {}, + "SC-23": {}, "SC-24": {}, "SC-25": {}, "SD-DC": {}, "SD-DE": {}, + "SD-DN": {}, "SD-DS": {}, "SD-DW": {}, "SD-GD": {}, "SD-GK": {}, "SD-GZ": {}, + "SD-KA": {}, "SD-KH": {}, "SD-KN": {}, "SD-KS": {}, "SD-NB": {}, + "SD-NO": {}, "SD-NR": {}, "SD-NW": {}, "SD-RS": {}, "SD-SI": {}, + "SE-AB": {}, "SE-AC": {}, "SE-BD": {}, "SE-C": {}, "SE-D": {}, + "SE-E": {}, "SE-F": {}, "SE-G": {}, "SE-H": {}, "SE-I": {}, + "SE-K": {}, "SE-M": {}, "SE-N": {}, "SE-O": {}, "SE-S": {}, + "SE-T": {}, "SE-U": {}, "SE-W": {}, "SE-X": {}, "SE-Y": {}, + "SE-Z": {}, "SG-01": {}, "SG-02": {}, "SG-03": {}, "SG-04": {}, + "SG-05": {}, "SH-AC": {}, "SH-HL": {}, "SH-TA": {}, "SI-001": {}, + "SI-002": {}, "SI-003": {}, "SI-004": {}, "SI-005": {}, "SI-006": {}, + "SI-007": {}, "SI-008": {}, "SI-009": {}, "SI-010": {}, "SI-011": {}, + "SI-012": {}, "SI-013": {}, "SI-014": {}, "SI-015": {}, "SI-016": {}, + "SI-017": {}, "SI-018": {}, "SI-019": {}, "SI-020": {}, "SI-021": {}, + "SI-022": {}, "SI-023": {}, "SI-024": {}, "SI-025": {}, "SI-026": {}, + "SI-027": {}, "SI-028": {}, "SI-029": {}, "SI-030": {}, "SI-031": {}, + "SI-032": {}, "SI-033": {}, "SI-034": {}, "SI-035": {}, "SI-036": {}, + "SI-037": {}, "SI-038": {}, "SI-039": {}, "SI-040": {}, "SI-041": {}, + "SI-042": {}, "SI-043": {}, "SI-044": {}, "SI-045": {}, "SI-046": {}, + "SI-047": {}, "SI-048": {}, "SI-049": {}, "SI-050": {}, "SI-051": {}, + "SI-052": {}, "SI-053": {}, "SI-054": {}, "SI-055": {}, "SI-056": {}, + "SI-057": {}, "SI-058": {}, "SI-059": {}, "SI-060": {}, "SI-061": {}, + "SI-062": {}, "SI-063": {}, "SI-064": {}, "SI-065": {}, "SI-066": {}, + "SI-067": {}, "SI-068": {}, "SI-069": {}, "SI-070": {}, "SI-071": {}, + "SI-072": {}, "SI-073": {}, "SI-074": {}, "SI-075": {}, "SI-076": {}, + "SI-077": {}, "SI-078": {}, "SI-079": {}, "SI-080": {}, "SI-081": {}, + "SI-082": {}, "SI-083": {}, "SI-084": {}, "SI-085": {}, "SI-086": {}, + "SI-087": {}, "SI-088": {}, "SI-089": {}, "SI-090": {}, "SI-091": {}, + "SI-092": {}, "SI-093": {}, "SI-094": {}, "SI-095": {}, "SI-096": {}, + "SI-097": {}, "SI-098": {}, "SI-099": {}, "SI-100": {}, "SI-101": {}, + "SI-102": {}, "SI-103": {}, "SI-104": {}, "SI-105": {}, "SI-106": {}, + "SI-107": {}, "SI-108": {}, "SI-109": {}, "SI-110": {}, "SI-111": {}, + "SI-112": {}, "SI-113": {}, "SI-114": {}, "SI-115": {}, "SI-116": {}, + "SI-117": {}, "SI-118": {}, "SI-119": {}, "SI-120": {}, "SI-121": {}, + "SI-122": {}, "SI-123": {}, "SI-124": {}, "SI-125": {}, "SI-126": {}, + "SI-127": {}, "SI-128": {}, "SI-129": {}, "SI-130": {}, "SI-131": {}, + "SI-132": {}, "SI-133": {}, "SI-134": {}, "SI-135": {}, "SI-136": {}, + "SI-137": {}, "SI-138": {}, "SI-139": {}, "SI-140": {}, "SI-141": {}, + "SI-142": {}, "SI-143": {}, "SI-144": {}, "SI-146": {}, "SI-147": {}, + "SI-148": {}, "SI-149": {}, "SI-150": {}, "SI-151": {}, "SI-152": {}, + "SI-153": {}, "SI-154": {}, "SI-155": {}, "SI-156": {}, "SI-157": {}, + "SI-158": {}, "SI-159": {}, "SI-160": {}, "SI-161": {}, "SI-162": {}, + "SI-163": {}, "SI-164": {}, "SI-165": {}, "SI-166": {}, "SI-167": {}, + "SI-168": {}, "SI-169": {}, "SI-170": {}, "SI-171": {}, "SI-172": {}, + "SI-173": {}, "SI-174": {}, "SI-175": {}, "SI-176": {}, "SI-177": {}, + "SI-178": {}, "SI-179": {}, "SI-180": {}, "SI-181": {}, "SI-182": {}, + "SI-183": {}, "SI-184": {}, "SI-185": {}, "SI-186": {}, "SI-187": {}, + "SI-188": {}, "SI-189": {}, "SI-190": {}, "SI-191": {}, "SI-192": {}, + "SI-193": {}, "SI-194": {}, "SI-195": {}, "SI-196": {}, "SI-197": {}, + "SI-198": {}, "SI-199": {}, "SI-200": {}, "SI-201": {}, "SI-202": {}, + "SI-203": {}, "SI-204": {}, "SI-205": {}, "SI-206": {}, "SI-207": {}, + "SI-208": {}, "SI-209": {}, "SI-210": {}, "SI-211": {}, "SI-212": {}, "SI-213": {}, "SK-BC": {}, + "SK-BL": {}, "SK-KI": {}, "SK-NI": {}, "SK-PV": {}, "SK-TA": {}, + "SK-TC": {}, "SK-ZI": {}, "SL-E": {}, "SL-N": {}, "SL-S": {}, + "SL-W": {}, "SM-01": {}, "SM-02": {}, "SM-03": {}, "SM-04": {}, + "SM-05": {}, "SM-06": {}, "SM-07": {}, "SM-08": {}, "SM-09": {}, + "SN-DB": {}, "SN-DK": {}, "SN-FK": {}, "SN-KA": {}, "SN-KD": {}, + "SN-KE": {}, "SN-KL": {}, "SN-LG": {}, "SN-MT": {}, "SN-SE": {}, + "SN-SL": {}, "SN-TC": {}, "SN-TH": {}, "SN-ZG": {}, "SO-AW": {}, + "SO-BK": {}, "SO-BN": {}, "SO-BR": {}, "SO-BY": {}, "SO-GA": {}, + "SO-GE": {}, "SO-HI": {}, "SO-JD": {}, "SO-JH": {}, "SO-MU": {}, + "SO-NU": {}, "SO-SA": {}, "SO-SD": {}, "SO-SH": {}, "SO-SO": {}, + "SO-TO": {}, "SO-WO": {}, "SR-BR": {}, "SR-CM": {}, "SR-CR": {}, + "SR-MA": {}, "SR-NI": {}, "SR-PM": {}, "SR-PR": {}, "SR-SA": {}, + "SR-SI": {}, "SR-WA": {}, "SS-BN": {}, "SS-BW": {}, "SS-EC": {}, + "SS-EE8": {}, "SS-EE": {}, "SS-EW": {}, "SS-JG": {}, "SS-LK": {}, "SS-NU": {}, + "SS-UY": {}, "SS-WR": {}, "ST-01": {}, "ST-P": {}, "ST-S": {}, "SV-AH": {}, + "SV-CA": {}, "SV-CH": {}, "SV-CU": {}, "SV-LI": {}, "SV-MO": {}, + "SV-PA": {}, "SV-SA": {}, "SV-SM": {}, "SV-SO": {}, "SV-SS": {}, + "SV-SV": {}, "SV-UN": {}, "SV-US": {}, "SY-DI": {}, "SY-DR": {}, + "SY-DY": {}, "SY-HA": {}, "SY-HI": {}, "SY-HL": {}, "SY-HM": {}, + "SY-ID": {}, "SY-LA": {}, "SY-QU": {}, "SY-RA": {}, "SY-RD": {}, + "SY-SU": {}, "SY-TA": {}, "SZ-HH": {}, "SZ-LU": {}, "SZ-MA": {}, + "SZ-SH": {}, "TD-BA": {}, "TD-BG": {}, "TD-BO": {}, "TD-CB": {}, + "TD-EN": {}, "TD-GR": {}, "TD-HL": {}, "TD-KA": {}, "TD-LC": {}, + "TD-LO": {}, "TD-LR": {}, "TD-MA": {}, "TD-MC": {}, "TD-ME": {}, + "TD-MO": {}, "TD-ND": {}, "TD-OD": {}, "TD-SA": {}, "TD-SI": {}, + "TD-TA": {}, "TD-TI": {}, "TD-WF": {}, "TG-C": {}, "TG-K": {}, + "TG-M": {}, "TG-P": {}, "TG-S": {}, "TH-10": {}, "TH-11": {}, + "TH-12": {}, "TH-13": {}, "TH-14": {}, "TH-15": {}, "TH-16": {}, + "TH-17": {}, "TH-18": {}, "TH-19": {}, "TH-20": {}, "TH-21": {}, + "TH-22": {}, "TH-23": {}, "TH-24": {}, "TH-25": {}, "TH-26": {}, + "TH-27": {}, "TH-30": {}, "TH-31": {}, "TH-32": {}, "TH-33": {}, + "TH-34": {}, "TH-35": {}, "TH-36": {}, "TH-37": {}, "TH-38": {}, "TH-39": {}, + "TH-40": {}, "TH-41": {}, "TH-42": {}, "TH-43": {}, "TH-44": {}, + "TH-45": {}, "TH-46": {}, "TH-47": {}, "TH-48": {}, "TH-49": {}, + "TH-50": {}, "TH-51": {}, "TH-52": {}, "TH-53": {}, "TH-54": {}, + "TH-55": {}, "TH-56": {}, "TH-57": {}, "TH-58": {}, "TH-60": {}, + "TH-61": {}, "TH-62": {}, "TH-63": {}, "TH-64": {}, "TH-65": {}, + "TH-66": {}, "TH-67": {}, "TH-70": {}, "TH-71": {}, "TH-72": {}, + "TH-73": {}, "TH-74": {}, "TH-75": {}, "TH-76": {}, "TH-77": {}, + "TH-80": {}, "TH-81": {}, "TH-82": {}, "TH-83": {}, "TH-84": {}, + "TH-85": {}, "TH-86": {}, "TH-90": {}, "TH-91": {}, "TH-92": {}, + "TH-93": {}, "TH-94": {}, "TH-95": {}, "TH-96": {}, "TH-S": {}, + "TJ-GB": {}, "TJ-KT": {}, "TJ-SU": {}, "TJ-DU": {}, "TJ-RA": {}, "TL-AL": {}, "TL-AN": {}, + "TL-BA": {}, "TL-BO": {}, "TL-CO": {}, "TL-DI": {}, "TL-ER": {}, + "TL-LA": {}, "TL-LI": {}, "TL-MF": {}, "TL-MT": {}, "TL-OE": {}, + "TL-VI": {}, "TM-A": {}, "TM-B": {}, "TM-D": {}, "TM-L": {}, + "TM-M": {}, "TM-S": {}, "TN-11": {}, "TN-12": {}, "TN-13": {}, + "TN-14": {}, "TN-21": {}, "TN-22": {}, "TN-23": {}, "TN-31": {}, + "TN-32": {}, "TN-33": {}, "TN-34": {}, "TN-41": {}, "TN-42": {}, + "TN-43": {}, "TN-51": {}, "TN-52": {}, "TN-53": {}, "TN-61": {}, + "TN-71": {}, "TN-72": {}, "TN-73": {}, "TN-81": {}, "TN-82": {}, + "TN-83": {}, "TO-01": {}, "TO-02": {}, "TO-03": {}, "TO-04": {}, + "TO-05": {}, "TR-01": {}, "TR-02": {}, "TR-03": {}, "TR-04": {}, + "TR-05": {}, "TR-06": {}, "TR-07": {}, "TR-08": {}, "TR-09": {}, + "TR-10": {}, "TR-11": {}, "TR-12": {}, "TR-13": {}, "TR-14": {}, + "TR-15": {}, "TR-16": {}, "TR-17": {}, "TR-18": {}, "TR-19": {}, + "TR-20": {}, "TR-21": {}, "TR-22": {}, "TR-23": {}, "TR-24": {}, + "TR-25": {}, "TR-26": {}, "TR-27": {}, "TR-28": {}, "TR-29": {}, + "TR-30": {}, "TR-31": {}, "TR-32": {}, "TR-33": {}, "TR-34": {}, + "TR-35": {}, "TR-36": {}, "TR-37": {}, "TR-38": {}, "TR-39": {}, + "TR-40": {}, "TR-41": {}, "TR-42": {}, "TR-43": {}, "TR-44": {}, + "TR-45": {}, "TR-46": {}, "TR-47": {}, "TR-48": {}, "TR-49": {}, + "TR-50": {}, "TR-51": {}, "TR-52": {}, "TR-53": {}, "TR-54": {}, + "TR-55": {}, "TR-56": {}, "TR-57": {}, "TR-58": {}, "TR-59": {}, + "TR-60": {}, "TR-61": {}, "TR-62": {}, "TR-63": {}, "TR-64": {}, + "TR-65": {}, "TR-66": {}, "TR-67": {}, "TR-68": {}, "TR-69": {}, + "TR-70": {}, "TR-71": {}, "TR-72": {}, "TR-73": {}, "TR-74": {}, + "TR-75": {}, "TR-76": {}, "TR-77": {}, "TR-78": {}, "TR-79": {}, + "TR-80": {}, "TR-81": {}, "TT-ARI": {}, "TT-CHA": {}, "TT-CTT": {}, + "TT-DMN": {}, "TT-ETO": {}, "TT-MRC": {}, "TT-TOB": {}, "TT-PED": {}, "TT-POS": {}, "TT-PRT": {}, + "TT-PTF": {}, "TT-RCM": {}, "TT-SFO": {}, "TT-SGE": {}, "TT-SIP": {}, + "TT-SJL": {}, "TT-TUP": {}, "TT-WTO": {}, "TV-FUN": {}, "TV-NIT": {}, + "TV-NKF": {}, "TV-NKL": {}, "TV-NMA": {}, "TV-NMG": {}, "TV-NUI": {}, + "TV-VAI": {}, "TW-CHA": {}, "TW-CYI": {}, "TW-CYQ": {}, "TW-KIN": {}, "TW-HSQ": {}, + "TW-HSZ": {}, "TW-HUA": {}, "TW-LIE": {}, "TW-ILA": {}, "TW-KEE": {}, "TW-KHH": {}, + "TW-KHQ": {}, "TW-MIA": {}, "TW-NAN": {}, "TW-NWT": {}, "TW-PEN": {}, "TW-PIF": {}, + "TW-TAO": {}, "TW-TNN": {}, "TW-TNQ": {}, "TW-TPE": {}, "TW-TPQ": {}, + "TW-TTT": {}, "TW-TXG": {}, "TW-TXQ": {}, "TW-YUN": {}, "TZ-01": {}, + "TZ-02": {}, "TZ-03": {}, "TZ-04": {}, "TZ-05": {}, "TZ-06": {}, + "TZ-07": {}, "TZ-08": {}, "TZ-09": {}, "TZ-10": {}, "TZ-11": {}, + "TZ-12": {}, "TZ-13": {}, "TZ-14": {}, "TZ-15": {}, "TZ-16": {}, + "TZ-17": {}, "TZ-18": {}, "TZ-19": {}, "TZ-20": {}, "TZ-21": {}, + "TZ-22": {}, "TZ-23": {}, "TZ-24": {}, "TZ-25": {}, "TZ-26": {}, "TZ-27": {}, "TZ-28": {}, "TZ-29": {}, "TZ-30": {}, "TZ-31": {}, + "UA-05": {}, "UA-07": {}, "UA-09": {}, "UA-12": {}, "UA-14": {}, + "UA-18": {}, "UA-21": {}, "UA-23": {}, "UA-26": {}, "UA-30": {}, + "UA-32": {}, "UA-35": {}, "UA-40": {}, "UA-43": {}, "UA-46": {}, + "UA-48": {}, "UA-51": {}, "UA-53": {}, "UA-56": {}, "UA-59": {}, + "UA-61": {}, "UA-63": {}, "UA-65": {}, "UA-68": {}, "UA-71": {}, + "UA-74": {}, "UA-77": {}, "UG-101": {}, "UG-102": {}, "UG-103": {}, + "UG-104": {}, "UG-105": {}, "UG-106": {}, "UG-107": {}, "UG-108": {}, + "UG-109": {}, "UG-110": {}, "UG-111": {}, "UG-112": {}, "UG-113": {}, + "UG-114": {}, "UG-115": {}, "UG-116": {}, "UG-201": {}, "UG-202": {}, + "UG-203": {}, "UG-204": {}, "UG-205": {}, "UG-206": {}, "UG-207": {}, + "UG-208": {}, "UG-209": {}, "UG-210": {}, "UG-211": {}, "UG-212": {}, + "UG-213": {}, "UG-214": {}, "UG-215": {}, "UG-216": {}, "UG-217": {}, + "UG-218": {}, "UG-219": {}, "UG-220": {}, "UG-221": {}, "UG-222": {}, + "UG-223": {}, "UG-224": {}, "UG-301": {}, "UG-302": {}, "UG-303": {}, + "UG-304": {}, "UG-305": {}, "UG-306": {}, "UG-307": {}, "UG-308": {}, + "UG-309": {}, "UG-310": {}, "UG-311": {}, "UG-312": {}, "UG-313": {}, + "UG-314": {}, "UG-315": {}, "UG-316": {}, "UG-317": {}, "UG-318": {}, + "UG-319": {}, "UG-320": {}, "UG-321": {}, "UG-401": {}, "UG-402": {}, + "UG-403": {}, "UG-404": {}, "UG-405": {}, "UG-406": {}, "UG-407": {}, + "UG-408": {}, "UG-409": {}, "UG-410": {}, "UG-411": {}, "UG-412": {}, + "UG-413": {}, "UG-414": {}, "UG-415": {}, "UG-416": {}, "UG-417": {}, + "UG-418": {}, "UG-419": {}, "UG-C": {}, "UG-E": {}, "UG-N": {}, + "UG-W": {}, "UG-322": {}, "UG-323": {}, "UG-420": {}, "UG-117": {}, + "UG-118": {}, "UG-225": {}, "UG-120": {}, "UG-226": {}, + "UG-121": {}, "UG-122": {}, "UG-227": {}, "UG-421": {}, + "UG-325": {}, "UG-228": {}, "UG-123": {}, "UG-422": {}, + "UG-326": {}, "UG-229": {}, "UG-124": {}, "UG-423": {}, + "UG-230": {}, "UG-327": {}, "UG-424": {}, "UG-328": {}, + "UG-425": {}, "UG-426": {}, "UG-330": {}, + "UM-67": {}, "UM-71": {}, "UM-76": {}, "UM-79": {}, + "UM-81": {}, "UM-84": {}, "UM-86": {}, "UM-89": {}, "UM-95": {}, + "US-AK": {}, "US-AL": {}, "US-AR": {}, "US-AS": {}, "US-AZ": {}, + "US-CA": {}, "US-CO": {}, "US-CT": {}, "US-DC": {}, "US-DE": {}, + "US-FL": {}, "US-GA": {}, "US-GU": {}, "US-HI": {}, "US-IA": {}, + "US-ID": {}, "US-IL": {}, "US-IN": {}, "US-KS": {}, "US-KY": {}, + "US-LA": {}, "US-MA": {}, "US-MD": {}, "US-ME": {}, "US-MI": {}, + "US-MN": {}, "US-MO": {}, "US-MP": {}, "US-MS": {}, "US-MT": {}, + "US-NC": {}, "US-ND": {}, "US-NE": {}, "US-NH": {}, "US-NJ": {}, + "US-NM": {}, "US-NV": {}, "US-NY": {}, "US-OH": {}, "US-OK": {}, + "US-OR": {}, "US-PA": {}, "US-PR": {}, "US-RI": {}, "US-SC": {}, + "US-SD": {}, "US-TN": {}, "US-TX": {}, "US-UM": {}, "US-UT": {}, + "US-VA": {}, "US-VI": {}, "US-VT": {}, "US-WA": {}, "US-WI": {}, + "US-WV": {}, "US-WY": {}, "UY-AR": {}, "UY-CA": {}, "UY-CL": {}, + "UY-CO": {}, "UY-DU": {}, "UY-FD": {}, "UY-FS": {}, "UY-LA": {}, + "UY-MA": {}, "UY-MO": {}, "UY-PA": {}, "UY-RN": {}, "UY-RO": {}, + "UY-RV": {}, "UY-SA": {}, "UY-SJ": {}, "UY-SO": {}, "UY-TA": {}, + "UY-TT": {}, "UZ-AN": {}, "UZ-BU": {}, "UZ-FA": {}, "UZ-JI": {}, + "UZ-NG": {}, "UZ-NW": {}, "UZ-QA": {}, "UZ-QR": {}, "UZ-SA": {}, + "UZ-SI": {}, "UZ-SU": {}, "UZ-TK": {}, "UZ-TO": {}, "UZ-XO": {}, + "VC-01": {}, "VC-02": {}, "VC-03": {}, "VC-04": {}, "VC-05": {}, + "VC-06": {}, "VE-A": {}, "VE-B": {}, "VE-C": {}, "VE-D": {}, + "VE-E": {}, "VE-F": {}, "VE-G": {}, "VE-H": {}, "VE-I": {}, + "VE-J": {}, "VE-K": {}, "VE-L": {}, "VE-M": {}, "VE-N": {}, + "VE-O": {}, "VE-P": {}, "VE-R": {}, "VE-S": {}, "VE-T": {}, + "VE-U": {}, "VE-V": {}, "VE-W": {}, "VE-X": {}, "VE-Y": {}, + "VE-Z": {}, "VN-01": {}, "VN-02": {}, "VN-03": {}, "VN-04": {}, + "VN-05": {}, "VN-06": {}, "VN-07": {}, "VN-09": {}, "VN-13": {}, + "VN-14": {}, "VN-15": {}, "VN-18": {}, "VN-20": {}, "VN-21": {}, + "VN-22": {}, "VN-23": {}, "VN-24": {}, "VN-25": {}, "VN-26": {}, + "VN-27": {}, "VN-28": {}, "VN-29": {}, "VN-30": {}, "VN-31": {}, + "VN-32": {}, "VN-33": {}, "VN-34": {}, "VN-35": {}, "VN-36": {}, + "VN-37": {}, "VN-39": {}, "VN-40": {}, "VN-41": {}, "VN-43": {}, + "VN-44": {}, "VN-45": {}, "VN-46": {}, "VN-47": {}, "VN-49": {}, + "VN-50": {}, "VN-51": {}, "VN-52": {}, "VN-53": {}, "VN-54": {}, + "VN-55": {}, "VN-56": {}, "VN-57": {}, "VN-58": {}, "VN-59": {}, + "VN-61": {}, "VN-63": {}, "VN-66": {}, "VN-67": {}, "VN-68": {}, + "VN-69": {}, "VN-70": {}, "VN-71": {}, "VN-72": {}, "VN-73": {}, + "VN-CT": {}, "VN-DN": {}, "VN-HN": {}, "VN-HP": {}, "VN-SG": {}, + "VU-MAP": {}, "VU-PAM": {}, "VU-SAM": {}, "VU-SEE": {}, "VU-TAE": {}, + "VU-TOB": {}, "WF-SG": {}, "WF-UV": {}, "WS-AA": {}, "WS-AL": {}, "WS-AT": {}, "WS-FA": {}, + "WS-GE": {}, "WS-GI": {}, "WS-PA": {}, "WS-SA": {}, "WS-TU": {}, + "WS-VF": {}, "WS-VS": {}, "YE-AB": {}, "YE-AD": {}, "YE-AM": {}, + "YE-BA": {}, "YE-DA": {}, "YE-DH": {}, "YE-HD": {}, "YE-HJ": {}, "YE-HU": {}, + "YE-IB": {}, "YE-JA": {}, "YE-LA": {}, "YE-MA": {}, "YE-MR": {}, + "YE-MU": {}, "YE-MW": {}, "YE-RA": {}, "YE-SA": {}, "YE-SD": {}, "YE-SH": {}, + "YE-SN": {}, "YE-TA": {}, "ZA-EC": {}, "ZA-FS": {}, "ZA-GP": {}, + "ZA-LP": {}, "ZA-MP": {}, "ZA-NC": {}, "ZA-NW": {}, "ZA-WC": {}, + "ZA-ZN": {}, "ZA-KZN": {}, "ZM-01": {}, "ZM-02": {}, "ZM-03": {}, "ZM-04": {}, + "ZM-05": {}, "ZM-06": {}, "ZM-07": {}, "ZM-08": {}, "ZM-09": {}, "ZM-10": {}, + "ZW-BU": {}, "ZW-HA": {}, "ZW-MA": {}, "ZW-MC": {}, "ZW-ME": {}, + "ZW-MI": {}, "ZW-MN": {}, "ZW-MS": {}, "ZW-MV": {}, "ZW-MW": {}, +} diff --git a/vendor/github.com/go-playground/validator/v10/currency_codes.go b/vendor/github.com/go-playground/validator/v10/currency_codes.go new file mode 100644 index 00000000..d0317f89 --- /dev/null +++ b/vendor/github.com/go-playground/validator/v10/currency_codes.go @@ -0,0 +1,79 @@ +package validator + +var iso4217 = map[string]struct{}{ + "AFN": {}, "EUR": {}, "ALL": {}, "DZD": {}, "USD": {}, + "AOA": {}, "XCD": {}, "ARS": {}, "AMD": {}, "AWG": {}, + "AUD": {}, "AZN": {}, "BSD": {}, "BHD": {}, "BDT": {}, + "BBD": {}, "BYN": {}, "BZD": {}, "XOF": {}, "BMD": {}, + "INR": {}, "BTN": {}, "BOB": {}, "BOV": {}, "BAM": {}, + "BWP": {}, "NOK": {}, "BRL": {}, "BND": {}, "BGN": {}, + "BIF": {}, "CVE": {}, "KHR": {}, "XAF": {}, "CAD": {}, + "KYD": {}, "CLP": {}, "CLF": {}, "CNY": {}, "COP": {}, + "COU": {}, "KMF": {}, "CDF": {}, "NZD": {}, "CRC": {}, + "HRK": {}, "CUP": {}, "CUC": {}, "ANG": {}, "CZK": {}, + "DKK": {}, "DJF": {}, "DOP": {}, "EGP": {}, "SVC": {}, + "ERN": {}, "SZL": {}, "ETB": {}, "FKP": {}, "FJD": {}, + "XPF": {}, "GMD": {}, "GEL": {}, "GHS": {}, "GIP": {}, + "GTQ": {}, "GBP": {}, "GNF": {}, "GYD": {}, "HTG": {}, + "HNL": {}, "HKD": {}, "HUF": {}, "ISK": {}, "IDR": {}, + "XDR": {}, "IRR": {}, "IQD": {}, "ILS": {}, "JMD": {}, + "JPY": {}, "JOD": {}, "KZT": {}, "KES": {}, "KPW": {}, + "KRW": {}, "KWD": {}, "KGS": {}, "LAK": {}, "LBP": {}, + "LSL": {}, "ZAR": {}, "LRD": {}, "LYD": {}, "CHF": {}, + "MOP": {}, "MKD": {}, "MGA": {}, "MWK": {}, "MYR": {}, + "MVR": {}, "MRU": {}, "MUR": {}, "XUA": {}, "MXN": {}, + "MXV": {}, "MDL": {}, "MNT": {}, "MAD": {}, "MZN": {}, + "MMK": {}, "NAD": {}, "NPR": {}, "NIO": {}, "NGN": {}, + "OMR": {}, "PKR": {}, "PAB": {}, "PGK": {}, "PYG": {}, + "PEN": {}, "PHP": {}, "PLN": {}, "QAR": {}, "RON": {}, + "RUB": {}, "RWF": {}, "SHP": {}, "WST": {}, "STN": {}, + "SAR": {}, "RSD": {}, "SCR": {}, "SLL": {}, "SGD": {}, + "XSU": {}, "SBD": {}, "SOS": {}, "SSP": {}, "LKR": {}, + "SDG": {}, "SRD": {}, "SEK": {}, "CHE": {}, "CHW": {}, + "SYP": {}, "TWD": {}, "TJS": {}, "TZS": {}, "THB": {}, + "TOP": {}, "TTD": {}, "TND": {}, "TRY": {}, "TMT": {}, + "UGX": {}, "UAH": {}, "AED": {}, "USN": {}, "UYU": {}, + "UYI": {}, "UYW": {}, "UZS": {}, "VUV": {}, "VES": {}, + "VND": {}, "YER": {}, "ZMW": {}, "ZWL": {}, "XBA": {}, + "XBB": {}, "XBC": {}, "XBD": {}, "XTS": {}, "XXX": {}, + "XAU": {}, "XPD": {}, "XPT": {}, "XAG": {}, +} + +var iso4217_numeric = map[int]struct{}{ + 8: {}, 12: {}, 32: {}, 36: {}, 44: {}, + 48: {}, 50: {}, 51: {}, 52: {}, 60: {}, + 64: {}, 68: {}, 72: {}, 84: {}, 90: {}, + 96: {}, 104: {}, 108: {}, 116: {}, 124: {}, + 132: {}, 136: {}, 144: {}, 152: {}, 156: {}, + 170: {}, 174: {}, 188: {}, 191: {}, 192: {}, + 203: {}, 208: {}, 214: {}, 222: {}, 230: {}, + 232: {}, 238: {}, 242: {}, 262: {}, 270: {}, + 292: {}, 320: {}, 324: {}, 328: {}, 332: {}, + 340: {}, 344: {}, 348: {}, 352: {}, 356: {}, + 360: {}, 364: {}, 368: {}, 376: {}, 388: {}, + 392: {}, 398: {}, 400: {}, 404: {}, 408: {}, + 410: {}, 414: {}, 417: {}, 418: {}, 422: {}, + 426: {}, 430: {}, 434: {}, 446: {}, 454: {}, + 458: {}, 462: {}, 480: {}, 484: {}, 496: {}, + 498: {}, 504: {}, 512: {}, 516: {}, 524: {}, + 532: {}, 533: {}, 548: {}, 554: {}, 558: {}, + 566: {}, 578: {}, 586: {}, 590: {}, 598: {}, + 600: {}, 604: {}, 608: {}, 634: {}, 643: {}, + 646: {}, 654: {}, 682: {}, 690: {}, 694: {}, + 702: {}, 704: {}, 706: {}, 710: {}, 728: {}, + 748: {}, 752: {}, 756: {}, 760: {}, 764: {}, + 776: {}, 780: {}, 784: {}, 788: {}, 800: {}, + 807: {}, 818: {}, 826: {}, 834: {}, 840: {}, + 858: {}, 860: {}, 882: {}, 886: {}, 901: {}, + 927: {}, 928: {}, 929: {}, 930: {}, 931: {}, + 932: {}, 933: {}, 934: {}, 936: {}, 938: {}, + 940: {}, 941: {}, 943: {}, 944: {}, 946: {}, + 947: {}, 948: {}, 949: {}, 950: {}, 951: {}, + 952: {}, 953: {}, 955: {}, 956: {}, 957: {}, + 958: {}, 959: {}, 960: {}, 961: {}, 962: {}, + 963: {}, 964: {}, 965: {}, 967: {}, 968: {}, + 969: {}, 970: {}, 971: {}, 972: {}, 973: {}, + 975: {}, 976: {}, 977: {}, 978: {}, 979: {}, + 980: {}, 981: {}, 984: {}, 985: {}, 986: {}, + 990: {}, 994: {}, 997: {}, 999: {}, +} diff --git a/vendor/github.com/go-playground/validator/v10/doc.go b/vendor/github.com/go-playground/validator/v10/doc.go new file mode 100644 index 00000000..23cce991 --- /dev/null +++ b/vendor/github.com/go-playground/validator/v10/doc.go @@ -0,0 +1,1518 @@ +/* +Package validator implements value validations for structs and individual fields +based on tags. + +It can also handle Cross-Field and Cross-Struct validation for nested structs +and has the ability to dive into arrays and maps of any type. + +see more examples https://github.com/go-playground/validator/tree/master/_examples + +# Singleton + +Validator is designed to be thread-safe and used as a singleton instance. +It caches information about your struct and validations, +in essence only parsing your validation tags once per struct type. +Using multiple instances neglects the benefit of caching. +The not thread-safe functions are explicitly marked as such in the documentation. + +# Validation Functions Return Type error + +Doing things this way is actually the way the standard library does, see the +file.Open method here: + + https://golang.org/pkg/os/#Open. + +The authors return type "error" to avoid the issue discussed in the following, +where err is always != nil: + + http://stackoverflow.com/a/29138676/3158232 + https://github.com/go-playground/validator/issues/134 + +Validator only InvalidValidationError for bad validation input, nil or +ValidationErrors as type error; so, in your code all you need to do is check +if the error returned is not nil, and if it's not check if error is +InvalidValidationError ( if necessary, most of the time it isn't ) type cast +it to type ValidationErrors like so err.(validator.ValidationErrors). + +# Custom Validation Functions + +Custom Validation functions can be added. Example: + + // Structure + func customFunc(fl validator.FieldLevel) bool { + + if fl.Field().String() == "invalid" { + return false + } + + return true + } + + validate.RegisterValidation("custom tag name", customFunc) + // NOTES: using the same tag name as an existing function + // will overwrite the existing one + +# Cross-Field Validation + +Cross-Field Validation can be done via the following tags: + - eqfield + - nefield + - gtfield + - gtefield + - ltfield + - ltefield + - eqcsfield + - necsfield + - gtcsfield + - gtecsfield + - ltcsfield + - ltecsfield + +If, however, some custom cross-field validation is required, it can be done +using a custom validation. + +Why not just have cross-fields validation tags (i.e. only eqcsfield and not +eqfield)? + +The reason is efficiency. If you want to check a field within the same struct +"eqfield" only has to find the field on the same struct (1 level). But, if we +used "eqcsfield" it could be multiple levels down. Example: + + type Inner struct { + StartDate time.Time + } + + type Outer struct { + InnerStructField *Inner + CreatedAt time.Time `validate:"ltecsfield=InnerStructField.StartDate"` + } + + now := time.Now() + + inner := &Inner{ + StartDate: now, + } + + outer := &Outer{ + InnerStructField: inner, + CreatedAt: now, + } + + errs := validate.Struct(outer) + + // NOTE: when calling validate.Struct(val) topStruct will be the top level struct passed + // into the function + // when calling validate.VarWithValue(val, field, tag) val will be + // whatever you pass, struct, field... + // when calling validate.Field(field, tag) val will be nil + +# Multiple Validators + +Multiple validators on a field will process in the order defined. Example: + + type Test struct { + Field `validate:"max=10,min=1"` + } + + // max will be checked then min + +Bad Validator definitions are not handled by the library. Example: + + type Test struct { + Field `validate:"min=10,max=0"` + } + + // this definition of min max will never succeed + +# Using Validator Tags + +Baked In Cross-Field validation only compares fields on the same struct. +If Cross-Field + Cross-Struct validation is needed you should implement your +own custom validator. + +Comma (",") is the default separator of validation tags. If you wish to +have a comma included within the parameter (i.e. excludesall=,) you will need to +use the UTF-8 hex representation 0x2C, which is replaced in the code as a comma, +so the above will become excludesall=0x2C. + + type Test struct { + Field `validate:"excludesall=,"` // BAD! Do not include a comma. + Field `validate:"excludesall=0x2C"` // GOOD! Use the UTF-8 hex representation. + } + +Pipe ("|") is the 'or' validation tags deparator. If you wish to +have a pipe included within the parameter i.e. excludesall=| you will need to +use the UTF-8 hex representation 0x7C, which is replaced in the code as a pipe, +so the above will become excludesall=0x7C + + type Test struct { + Field `validate:"excludesall=|"` // BAD! Do not include a pipe! + Field `validate:"excludesall=0x7C"` // GOOD! Use the UTF-8 hex representation. + } + +# Baked In Validators and Tags + +Here is a list of the current built in validators: + +# Skip Field + +Tells the validation to skip this struct field; this is particularly +handy in ignoring embedded structs from being validated. (Usage: -) + + Usage: - + +# Or Operator + +This is the 'or' operator allowing multiple validators to be used and +accepted. (Usage: rgb|rgba) <-- this would allow either rgb or rgba +colors to be accepted. This can also be combined with 'and' for example +( Usage: omitempty,rgb|rgba) + + Usage: | + +# StructOnly + +When a field that is a nested struct is encountered, and contains this flag +any validation on the nested struct will be run, but none of the nested +struct fields will be validated. This is useful if inside of your program +you know the struct will be valid, but need to verify it has been assigned. +NOTE: only "required" and "omitempty" can be used on a struct itself. + + Usage: structonly + +# NoStructLevel + +Same as structonly tag except that any struct level validations will not run. + + Usage: nostructlevel + +# Omit Empty + +Allows conditional validation, for example, if a field is not set with +a value (Determined by the "required" validator) then other validation +such as min or max won't run, but if a value is set validation will run. + + Usage: omitempty + +# Omit Nil + +Allows to skip the validation if the value is nil (same as omitempty, but +only for the nil-values). + + Usage: omitnil + +# Dive + +This tells the validator to dive into a slice, array or map and validate that +level of the slice, array or map with the validation tags that follow. +Multidimensional nesting is also supported, each level you wish to dive will +require another dive tag. dive has some sub-tags, 'keys' & 'endkeys', please see +the Keys & EndKeys section just below. + + Usage: dive + +Example #1 + + [][]string with validation tag "gt=0,dive,len=1,dive,required" + // gt=0 will be applied to [] + // len=1 will be applied to []string + // required will be applied to string + +Example #2 + + [][]string with validation tag "gt=0,dive,dive,required" + // gt=0 will be applied to [] + // []string will be spared validation + // required will be applied to string + +Keys & EndKeys + +These are to be used together directly after the dive tag and tells the validator +that anything between 'keys' and 'endkeys' applies to the keys of a map and not the +values; think of it like the 'dive' tag, but for map keys instead of values. +Multidimensional nesting is also supported, each level you wish to validate will +require another 'keys' and 'endkeys' tag. These tags are only valid for maps. + + Usage: dive,keys,othertagvalidation(s),endkeys,valuevalidationtags + +Example #1 + + map[string]string with validation tag "gt=0,dive,keys,eq=1|eq=2,endkeys,required" + // gt=0 will be applied to the map itself + // eq=1|eq=2 will be applied to the map keys + // required will be applied to map values + +Example #2 + + map[[2]string]string with validation tag "gt=0,dive,keys,dive,eq=1|eq=2,endkeys,required" + // gt=0 will be applied to the map itself + // eq=1|eq=2 will be applied to each array element in the map keys + // required will be applied to map values + +# Required + +This validates that the value is not the data types default zero value. +For numbers ensures value is not zero. For strings ensures value is +not "". For booleans ensures value is not false. For slices, maps, pointers, interfaces, channels and functions +ensures the value is not nil. For structs ensures value is not the zero value when using WithRequiredStructEnabled. + + Usage: required + +# Required If + +The field under validation must be present and not empty only if all +the other specified fields are equal to the value following the specified +field. For strings ensures value is not "". For slices, maps, pointers, +interfaces, channels and functions ensures the value is not nil. For structs ensures value is not the zero value. + + Usage: required_if + +Examples: + + // require the field if the Field1 is equal to the parameter given: + Usage: required_if=Field1 foobar + + // require the field if the Field1 and Field2 is equal to the value respectively: + Usage: required_if=Field1 foo Field2 bar + +# Required Unless + +The field under validation must be present and not empty unless all +the other specified fields are equal to the value following the specified +field. For strings ensures value is not "". For slices, maps, pointers, +interfaces, channels and functions ensures the value is not nil. For structs ensures value is not the zero value. + + Usage: required_unless + +Examples: + + // require the field unless the Field1 is equal to the parameter given: + Usage: required_unless=Field1 foobar + + // require the field unless the Field1 and Field2 is equal to the value respectively: + Usage: required_unless=Field1 foo Field2 bar + +# Required With + +The field under validation must be present and not empty only if any +of the other specified fields are present. For strings ensures value is +not "". For slices, maps, pointers, interfaces, channels and functions +ensures the value is not nil. For structs ensures value is not the zero value. + + Usage: required_with + +Examples: + + // require the field if the Field1 is present: + Usage: required_with=Field1 + + // require the field if the Field1 or Field2 is present: + Usage: required_with=Field1 Field2 + +# Required With All + +The field under validation must be present and not empty only if all +of the other specified fields are present. For strings ensures value is +not "". For slices, maps, pointers, interfaces, channels and functions +ensures the value is not nil. For structs ensures value is not the zero value. + + Usage: required_with_all + +Example: + + // require the field if the Field1 and Field2 is present: + Usage: required_with_all=Field1 Field2 + +# Required Without + +The field under validation must be present and not empty only when any +of the other specified fields are not present. For strings ensures value is +not "". For slices, maps, pointers, interfaces, channels and functions +ensures the value is not nil. For structs ensures value is not the zero value. + + Usage: required_without + +Examples: + + // require the field if the Field1 is not present: + Usage: required_without=Field1 + + // require the field if the Field1 or Field2 is not present: + Usage: required_without=Field1 Field2 + +# Required Without All + +The field under validation must be present and not empty only when all +of the other specified fields are not present. For strings ensures value is +not "". For slices, maps, pointers, interfaces, channels and functions +ensures the value is not nil. For structs ensures value is not the zero value. + + Usage: required_without_all + +Example: + + // require the field if the Field1 and Field2 is not present: + Usage: required_without_all=Field1 Field2 + +# Excluded If + +The field under validation must not be present or not empty only if all +the other specified fields are equal to the value following the specified +field. For strings ensures value is not "". For slices, maps, pointers, +interfaces, channels and functions ensures the value is not nil. For structs ensures value is not the zero value. + + Usage: excluded_if + +Examples: + + // exclude the field if the Field1 is equal to the parameter given: + Usage: excluded_if=Field1 foobar + + // exclude the field if the Field1 and Field2 is equal to the value respectively: + Usage: excluded_if=Field1 foo Field2 bar + +# Excluded Unless + +The field under validation must not be present or empty unless all +the other specified fields are equal to the value following the specified +field. For strings ensures value is not "". For slices, maps, pointers, +interfaces, channels and functions ensures the value is not nil. For structs ensures value is not the zero value. + + Usage: excluded_unless + +Examples: + + // exclude the field unless the Field1 is equal to the parameter given: + Usage: excluded_unless=Field1 foobar + + // exclude the field unless the Field1 and Field2 is equal to the value respectively: + Usage: excluded_unless=Field1 foo Field2 bar + +# Is Default + +This validates that the value is the default value and is almost the +opposite of required. + + Usage: isdefault + +# Length + +For numbers, length will ensure that the value is +equal to the parameter given. For strings, it checks that +the string length is exactly that number of characters. For slices, +arrays, and maps, validates the number of items. + +Example #1 + + Usage: len=10 + +Example #2 (time.Duration) + +For time.Duration, len will ensure that the value is equal to the duration given +in the parameter. + + Usage: len=1h30m + +# Maximum + +For numbers, max will ensure that the value is +less than or equal to the parameter given. For strings, it checks +that the string length is at most that number of characters. For +slices, arrays, and maps, validates the number of items. + +Example #1 + + Usage: max=10 + +Example #2 (time.Duration) + +For time.Duration, max will ensure that the value is less than or equal to the +duration given in the parameter. + + Usage: max=1h30m + +# Minimum + +For numbers, min will ensure that the value is +greater or equal to the parameter given. For strings, it checks that +the string length is at least that number of characters. For slices, +arrays, and maps, validates the number of items. + +Example #1 + + Usage: min=10 + +Example #2 (time.Duration) + +For time.Duration, min will ensure that the value is greater than or equal to +the duration given in the parameter. + + Usage: min=1h30m + +# Equals + +For strings & numbers, eq will ensure that the value is +equal to the parameter given. For slices, arrays, and maps, +validates the number of items. + +Example #1 + + Usage: eq=10 + +Example #2 (time.Duration) + +For time.Duration, eq will ensure that the value is equal to the duration given +in the parameter. + + Usage: eq=1h30m + +# Not Equal + +For strings & numbers, ne will ensure that the value is not +equal to the parameter given. For slices, arrays, and maps, +validates the number of items. + +Example #1 + + Usage: ne=10 + +Example #2 (time.Duration) + +For time.Duration, ne will ensure that the value is not equal to the duration +given in the parameter. + + Usage: ne=1h30m + +# One Of + +For strings, ints, and uints, oneof will ensure that the value +is one of the values in the parameter. The parameter should be +a list of values separated by whitespace. Values may be +strings or numbers. To match strings with spaces in them, include +the target string between single quotes. Kind of like an 'enum'. + + Usage: oneof=red green + oneof='red green' 'blue yellow' + oneof=5 7 9 + +# One Of Case Insensitive + +Works the same as oneof but is case insensitive and therefore only accepts strings. + + Usage: oneofci=red green + oneofci='red green' 'blue yellow' + +# Greater Than + +For numbers, this will ensure that the value is greater than the +parameter given. For strings, it checks that the string length +is greater than that number of characters. For slices, arrays +and maps it validates the number of items. + +Example #1 + + Usage: gt=10 + +Example #2 (time.Time) + +For time.Time ensures the time value is greater than time.Now.UTC(). + + Usage: gt + +Example #3 (time.Duration) + +For time.Duration, gt will ensure that the value is greater than the duration +given in the parameter. + + Usage: gt=1h30m + +# Greater Than or Equal + +Same as 'min' above. Kept both to make terminology with 'len' easier. + +Example #1 + + Usage: gte=10 + +Example #2 (time.Time) + +For time.Time ensures the time value is greater than or equal to time.Now.UTC(). + + Usage: gte + +Example #3 (time.Duration) + +For time.Duration, gte will ensure that the value is greater than or equal to +the duration given in the parameter. + + Usage: gte=1h30m + +# Less Than + +For numbers, this will ensure that the value is less than the parameter given. +For strings, it checks that the string length is less than that number of +characters. For slices, arrays, and maps it validates the number of items. + +Example #1 + + Usage: lt=10 + +Example #2 (time.Time) + +For time.Time ensures the time value is less than time.Now.UTC(). + + Usage: lt + +Example #3 (time.Duration) + +For time.Duration, lt will ensure that the value is less than the duration given +in the parameter. + + Usage: lt=1h30m + +# Less Than or Equal + +Same as 'max' above. Kept both to make terminology with 'len' easier. + +Example #1 + + Usage: lte=10 + +Example #2 (time.Time) + +For time.Time ensures the time value is less than or equal to time.Now.UTC(). + + Usage: lte + +Example #3 (time.Duration) + +For time.Duration, lte will ensure that the value is less than or equal to the +duration given in the parameter. + + Usage: lte=1h30m + +# Field Equals Another Field + +This will validate the field value against another fields value either within +a struct or passed in field. + +Example #1: + + // Validation on Password field using: + Usage: eqfield=ConfirmPassword + +Example #2: + + // Validating by field: + validate.VarWithValue(password, confirmpassword, "eqfield") + +Field Equals Another Field (relative) + +This does the same as eqfield except that it validates the field provided relative +to the top level struct. + + Usage: eqcsfield=InnerStructField.Field) + +# Field Does Not Equal Another Field + +This will validate the field value against another fields value either within +a struct or passed in field. + +Examples: + + // Confirm two colors are not the same: + // + // Validation on Color field: + Usage: nefield=Color2 + + // Validating by field: + validate.VarWithValue(color1, color2, "nefield") + +Field Does Not Equal Another Field (relative) + +This does the same as nefield except that it validates the field provided +relative to the top level struct. + + Usage: necsfield=InnerStructField.Field + +# Field Greater Than Another Field + +Only valid for Numbers, time.Duration and time.Time types, this will validate +the field value against another fields value either within a struct or passed in +field. usage examples are for validation of a Start and End date: + +Example #1: + + // Validation on End field using: + validate.Struct Usage(gtfield=Start) + +Example #2: + + // Validating by field: + validate.VarWithValue(start, end, "gtfield") + +# Field Greater Than Another Relative Field + +This does the same as gtfield except that it validates the field provided +relative to the top level struct. + + Usage: gtcsfield=InnerStructField.Field + +# Field Greater Than or Equal To Another Field + +Only valid for Numbers, time.Duration and time.Time types, this will validate +the field value against another fields value either within a struct or passed in +field. usage examples are for validation of a Start and End date: + +Example #1: + + // Validation on End field using: + validate.Struct Usage(gtefield=Start) + +Example #2: + + // Validating by field: + validate.VarWithValue(start, end, "gtefield") + +# Field Greater Than or Equal To Another Relative Field + +This does the same as gtefield except that it validates the field provided relative +to the top level struct. + + Usage: gtecsfield=InnerStructField.Field + +# Less Than Another Field + +Only valid for Numbers, time.Duration and time.Time types, this will validate +the field value against another fields value either within a struct or passed in +field. usage examples are for validation of a Start and End date: + +Example #1: + + // Validation on End field using: + validate.Struct Usage(ltfield=Start) + +Example #2: + + // Validating by field: + validate.VarWithValue(start, end, "ltfield") + +# Less Than Another Relative Field + +This does the same as ltfield except that it validates the field provided relative +to the top level struct. + + Usage: ltcsfield=InnerStructField.Field + +# Less Than or Equal To Another Field + +Only valid for Numbers, time.Duration and time.Time types, this will validate +the field value against another fields value either within a struct or passed in +field. usage examples are for validation of a Start and End date: + +Example #1: + + // Validation on End field using: + validate.Struct Usage(ltefield=Start) + +Example #2: + + // Validating by field: + validate.VarWithValue(start, end, "ltefield") + +# Less Than or Equal To Another Relative Field + +This does the same as ltefield except that it validates the field provided relative +to the top level struct. + + Usage: ltecsfield=InnerStructField.Field + +# Field Contains Another Field + +This does the same as contains except for struct fields. It should only be used +with string types. See the behavior of reflect.Value.String() for behavior on +other types. + + Usage: containsfield=InnerStructField.Field + +# Field Excludes Another Field + +This does the same as excludes except for struct fields. It should only be used +with string types. See the behavior of reflect.Value.String() for behavior on +other types. + + Usage: excludesfield=InnerStructField.Field + +# Unique + +For arrays & slices, unique will ensure that there are no duplicates. +For maps, unique will ensure that there are no duplicate values. +For slices of struct, unique will ensure that there are no duplicate values +in a field of the struct specified via a parameter. + + // For arrays, slices, and maps: + Usage: unique + + // For slices of struct: + Usage: unique=field + +# ValidateFn + +This validates that an object responds to a method that can return error or bool. +By default it expects an interface `Validate() error` and check that the method +does not return an error. Other methods can be specified using two signatures: +If the method returns an error, it check if the return value is nil. +If the method returns a boolean, it checks if the value is true. + + // to use the default method Validate() error + Usage: validateFn + + // to use the custom method IsValid() bool (or error) + Usage: validateFn=IsValid + +# Alpha Only + +This validates that a string value contains ASCII alpha characters only + + Usage: alpha + +# Alphanumeric + +This validates that a string value contains ASCII alphanumeric characters only + + Usage: alphanum + +# Alpha Unicode + +This validates that a string value contains unicode alpha characters only + + Usage: alphaunicode + +# Alphanumeric Unicode + +This validates that a string value contains unicode alphanumeric characters only + + Usage: alphanumunicode + +# Boolean + +This validates that a string value can successfully be parsed into a boolean with strconv.ParseBool + + Usage: boolean + +# Number + +This validates that a string value contains number values only. +For integers or float it returns true. + + Usage: number + +# Numeric + +This validates that a string value contains a basic numeric value. +basic excludes exponents etc... +for integers or float it returns true. + + Usage: numeric + +# Hexadecimal String + +This validates that a string value contains a valid hexadecimal. + + Usage: hexadecimal + +# Hexcolor String + +This validates that a string value contains a valid hex color including +hashtag (#) + + Usage: hexcolor + +# Lowercase String + +This validates that a string value contains only lowercase characters. An empty string is not a valid lowercase string. + + Usage: lowercase + +# Uppercase String + +This validates that a string value contains only uppercase characters. An empty string is not a valid uppercase string. + + Usage: uppercase + +# RGB String + +This validates that a string value contains a valid rgb color + + Usage: rgb + +# RGBA String + +This validates that a string value contains a valid rgba color + + Usage: rgba + +# HSL String + +This validates that a string value contains a valid hsl color + + Usage: hsl + +# HSLA String + +This validates that a string value contains a valid hsla color + + Usage: hsla + +# E.164 Phone Number String + +This validates that a string value contains a valid E.164 Phone number +https://en.wikipedia.org/wiki/E.164 (ex. +1123456789) + + Usage: e164 + +# E-mail String + +This validates that a string value contains a valid email +This may not conform to all possibilities of any rfc standard, but neither +does any email provider accept all possibilities. + + Usage: email + +# JSON String + +This validates that a string value is valid JSON + + Usage: json + +# JWT String + +This validates that a string value is a valid JWT + + Usage: jwt + +# File + +This validates that a string value contains a valid file path and that +the file exists on the machine. +This is done using os.Stat, which is a platform independent function. + + Usage: file + +# Image path + +This validates that a string value contains a valid file path and that +the file exists on the machine and is an image. +This is done using os.Stat and github.com/gabriel-vasile/mimetype + + Usage: image + +# File Path + +This validates that a string value contains a valid file path but does not +validate the existence of that file. +This is done using os.Stat, which is a platform independent function. + + Usage: filepath + +# URL String + +This validates that a string value contains a valid url +This will accept any url the golang request uri accepts but must contain +a schema for example http:// or rtmp:// + + Usage: url + +# URI String + +This validates that a string value contains a valid uri +This will accept any uri the golang request uri accepts + + Usage: uri + +# Urn RFC 2141 String + +This validates that a string value contains a valid URN +according to the RFC 2141 spec. + + Usage: urn_rfc2141 + +# Base32 String + +This validates that a string value contains a valid bas324 value. +Although an empty string is valid base32 this will report an empty string +as an error, if you wish to accept an empty string as valid you can use +this with the omitempty tag. + + Usage: base32 + +# Base64 String + +This validates that a string value contains a valid base64 value. +Although an empty string is valid base64 this will report an empty string +as an error, if you wish to accept an empty string as valid you can use +this with the omitempty tag. + + Usage: base64 + +# Base64URL String + +This validates that a string value contains a valid base64 URL safe value +according the RFC4648 spec. +Although an empty string is a valid base64 URL safe value, this will report +an empty string as an error, if you wish to accept an empty string as valid +you can use this with the omitempty tag. + + Usage: base64url + +# Base64RawURL String + +This validates that a string value contains a valid base64 URL safe value, +but without = padding, according the RFC4648 spec, section 3.2. +Although an empty string is a valid base64 URL safe value, this will report +an empty string as an error, if you wish to accept an empty string as valid +you can use this with the omitempty tag. + + Usage: base64rawurl + +# Bitcoin Address + +This validates that a string value contains a valid bitcoin address. +The format of the string is checked to ensure it matches one of the three formats +P2PKH, P2SH and performs checksum validation. + + Usage: btc_addr + +Bitcoin Bech32 Address (segwit) + +This validates that a string value contains a valid bitcoin Bech32 address as defined +by bip-0173 (https://github.com/bitcoin/bips/blob/master/bip-0173.mediawiki) +Special thanks to Pieter Wuille for providing reference implementations. + + Usage: btc_addr_bech32 + +# Ethereum Address + +This validates that a string value contains a valid ethereum address. +The format of the string is checked to ensure it matches the standard Ethereum address format. + + Usage: eth_addr + +# Contains + +This validates that a string value contains the substring value. + + Usage: contains=@ + +# Contains Any + +This validates that a string value contains any Unicode code points +in the substring value. + + Usage: containsany=!@#? + +# Contains Rune + +This validates that a string value contains the supplied rune value. + + Usage: containsrune=@ + +# Excludes + +This validates that a string value does not contain the substring value. + + Usage: excludes=@ + +# Excludes All + +This validates that a string value does not contain any Unicode code +points in the substring value. + + Usage: excludesall=!@#? + +# Excludes Rune + +This validates that a string value does not contain the supplied rune value. + + Usage: excludesrune=@ + +# Starts With + +This validates that a string value starts with the supplied string value + + Usage: startswith=hello + +# Ends With + +This validates that a string value ends with the supplied string value + + Usage: endswith=goodbye + +# Does Not Start With + +This validates that a string value does not start with the supplied string value + + Usage: startsnotwith=hello + +# Does Not End With + +This validates that a string value does not end with the supplied string value + + Usage: endsnotwith=goodbye + +# International Standard Book Number + +This validates that a string value contains a valid isbn10 or isbn13 value. + + Usage: isbn + +# International Standard Book Number 10 + +This validates that a string value contains a valid isbn10 value. + + Usage: isbn10 + +# International Standard Book Number 13 + +This validates that a string value contains a valid isbn13 value. + + Usage: isbn13 + +# Universally Unique Identifier UUID + +This validates that a string value contains a valid UUID. Uppercase UUID values will not pass - use `uuid_rfc4122` instead. + + Usage: uuid + +# Universally Unique Identifier UUID v3 + +This validates that a string value contains a valid version 3 UUID. Uppercase UUID values will not pass - use `uuid3_rfc4122` instead. + + Usage: uuid3 + +# Universally Unique Identifier UUID v4 + +This validates that a string value contains a valid version 4 UUID. Uppercase UUID values will not pass - use `uuid4_rfc4122` instead. + + Usage: uuid4 + +# Universally Unique Identifier UUID v5 + +This validates that a string value contains a valid version 5 UUID. Uppercase UUID values will not pass - use `uuid5_rfc4122` instead. + + Usage: uuid5 + +# Universally Unique Lexicographically Sortable Identifier ULID + +This validates that a string value contains a valid ULID value. + + Usage: ulid + +# ASCII + +This validates that a string value contains only ASCII characters. +NOTE: if the string is blank, this validates as true. + + Usage: ascii + +# Printable ASCII + +This validates that a string value contains only printable ASCII characters. +NOTE: if the string is blank, this validates as true. + + Usage: printascii + +# Multi-Byte Characters + +This validates that a string value contains one or more multibyte characters. +NOTE: if the string is blank, this validates as true. + + Usage: multibyte + +# Data URL + +This validates that a string value contains a valid DataURI. +NOTE: this will also validate that the data portion is valid base64 + + Usage: datauri + +# Latitude + +This validates that a string value contains a valid latitude. + + Usage: latitude + +# Longitude + +This validates that a string value contains a valid longitude. + + Usage: longitude + +# Employeer Identification Number EIN + +This validates that a string value contains a valid U.S. Employer Identification Number. + + Usage: ein + +# Social Security Number SSN + +This validates that a string value contains a valid U.S. Social Security Number. + + Usage: ssn + +# Internet Protocol Address IP + +This validates that a string value contains a valid IP Address. + + Usage: ip + +# Internet Protocol Address IPv4 + +This validates that a string value contains a valid v4 IP Address. + + Usage: ipv4 + +# Internet Protocol Address IPv6 + +This validates that a string value contains a valid v6 IP Address. + + Usage: ipv6 + +# Classless Inter-Domain Routing CIDR + +This validates that a string value contains a valid CIDR Address. + + Usage: cidr + +# Classless Inter-Domain Routing CIDRv4 + +This validates that a string value contains a valid v4 CIDR Address. + + Usage: cidrv4 + +# Classless Inter-Domain Routing CIDRv6 + +This validates that a string value contains a valid v6 CIDR Address. + + Usage: cidrv6 + +# Transmission Control Protocol Address TCP + +This validates that a string value contains a valid resolvable TCP Address. + + Usage: tcp_addr + +# Transmission Control Protocol Address TCPv4 + +This validates that a string value contains a valid resolvable v4 TCP Address. + + Usage: tcp4_addr + +# Transmission Control Protocol Address TCPv6 + +This validates that a string value contains a valid resolvable v6 TCP Address. + + Usage: tcp6_addr + +# User Datagram Protocol Address UDP + +This validates that a string value contains a valid resolvable UDP Address. + + Usage: udp_addr + +# User Datagram Protocol Address UDPv4 + +This validates that a string value contains a valid resolvable v4 UDP Address. + + Usage: udp4_addr + +# User Datagram Protocol Address UDPv6 + +This validates that a string value contains a valid resolvable v6 UDP Address. + + Usage: udp6_addr + +# Internet Protocol Address IP + +This validates that a string value contains a valid resolvable IP Address. + + Usage: ip_addr + +# Internet Protocol Address IPv4 + +This validates that a string value contains a valid resolvable v4 IP Address. + + Usage: ip4_addr + +# Internet Protocol Address IPv6 + +This validates that a string value contains a valid resolvable v6 IP Address. + + Usage: ip6_addr + +# Unix domain socket end point Address + +This validates that a string value contains a valid Unix Address. + + Usage: unix_addr + +# Media Access Control Address MAC + +This validates that a string value contains a valid MAC Address. + + Usage: mac + +Note: See Go's ParseMAC for accepted formats and types: + + http://golang.org/src/net/mac.go?s=866:918#L29 + +# Hostname RFC 952 + +This validates that a string value is a valid Hostname according to RFC 952 https://tools.ietf.org/html/rfc952 + + Usage: hostname + +# Hostname RFC 1123 + +This validates that a string value is a valid Hostname according to RFC 1123 https://tools.ietf.org/html/rfc1123 + + Usage: hostname_rfc1123 or if you want to continue to use 'hostname' in your tags, create an alias. + +Full Qualified Domain Name (FQDN) + +This validates that a string value contains a valid FQDN. + + Usage: fqdn + +# HTML Tags + +This validates that a string value appears to be an HTML element tag +including those described at https://developer.mozilla.org/en-US/docs/Web/HTML/Element + + Usage: html + +# HTML Encoded + +This validates that a string value is a proper character reference in decimal +or hexadecimal format + + Usage: html_encoded + +# URL Encoded + +This validates that a string value is percent-encoded (URL encoded) according +to https://tools.ietf.org/html/rfc3986#section-2.1 + + Usage: url_encoded + +# Directory + +This validates that a string value contains a valid directory and that +it exists on the machine. +This is done using os.Stat, which is a platform independent function. + + Usage: dir + +# Directory Path + +This validates that a string value contains a valid directory but does +not validate the existence of that directory. +This is done using os.Stat, which is a platform independent function. +It is safest to suffix the string with os.PathSeparator if the directory +may not exist at the time of validation. + + Usage: dirpath + +# HostPort + +This validates that a string value contains a valid DNS hostname and port that +can be used to validate fields typically passed to sockets and connections. + + Usage: hostname_port + +# Datetime + +This validates that a string value is a valid datetime based on the supplied datetime format. +Supplied format must match the official Go time format layout as documented in https://golang.org/pkg/time/ + + Usage: datetime=2006-01-02 + +# Iso3166-1 alpha-2 + +This validates that a string value is a valid country code based on iso3166-1 alpha-2 standard. +see: https://www.iso.org/iso-3166-country-codes.html + + Usage: iso3166_1_alpha2 + +# Iso3166-1 alpha-3 + +This validates that a string value is a valid country code based on iso3166-1 alpha-3 standard. +see: https://www.iso.org/iso-3166-country-codes.html + + Usage: iso3166_1_alpha3 + +# Iso3166-1 alpha-numeric + +This validates that a string value is a valid country code based on iso3166-1 alpha-numeric standard. +see: https://www.iso.org/iso-3166-country-codes.html + + Usage: iso3166_1_alpha3 + +# BCP 47 Language Tag + +This validates that a string value is a valid BCP 47 language tag, as parsed by language.Parse. +More information on https://pkg.go.dev/golang.org/x/text/language + + Usage: bcp47_language_tag + +BIC (SWIFT code) + +This validates that a string value is a valid Business Identifier Code (SWIFT code), defined in ISO 9362. +More information on https://www.iso.org/standard/60390.html + + Usage: bic + +# RFC 1035 label + +This validates that a string value is a valid dns RFC 1035 label, defined in RFC 1035. +More information on https://datatracker.ietf.org/doc/html/rfc1035 + + Usage: dns_rfc1035_label + +# TimeZone + +This validates that a string value is a valid time zone based on the time zone database present on the system. +Although empty value and Local value are allowed by time.LoadLocation golang function, they are not allowed by this validator. +More information on https://golang.org/pkg/time/#LoadLocation + + Usage: timezone + +# Semantic Version + +This validates that a string value is a valid semver version, defined in Semantic Versioning 2.0.0. +More information on https://semver.org/ + + Usage: semver + +# CVE Identifier + +This validates that a string value is a valid cve id, defined in cve mitre. +More information on https://cve.mitre.org/ + + Usage: cve + +# Credit Card + +This validates that a string value contains a valid credit card number using Luhn algorithm. + + Usage: credit_card + +# Luhn Checksum + + Usage: luhn_checksum + +This validates that a string or (u)int value contains a valid checksum using the Luhn algorithm. + +# MongoDB + +This validates that a string is a valid 24 character hexadecimal string or valid connection string. + + Usage: mongodb + mongodb_connection_string + +Example: + + type Test struct { + ObjectIdField string `validate:"mongodb"` + ConnectionStringField string `validate:"mongodb_connection_string"` + } + +# Cron + +This validates that a string value contains a valid cron expression. + + Usage: cron + +# SpiceDb ObjectID/Permission/Object Type + +This validates that a string is valid for use with SpiceDb for the indicated purpose. If no purpose is given, a purpose of 'id' is assumed. + + Usage: spicedb=id|permission|type + +# Alias Validators and Tags + +Alias Validators and Tags +NOTE: When returning an error, the tag returned in "FieldError" will be +the alias tag unless the dive tag is part of the alias. Everything after the +dive tag is not reported as the alias tag. Also, the "ActualTag" in the before +case will be the actual tag within the alias that failed. + +Here is a list of the current built in alias tags: + + "iscolor" + alias is "hexcolor|rgb|rgba|hsl|hsla" (Usage: iscolor) + "country_code" + alias is "iso3166_1_alpha2|iso3166_1_alpha3|iso3166_1_alpha_numeric" (Usage: country_code) + +Validator notes: + + regex + a regex validator won't be added because commas and = signs can be part + of a regex which conflict with the validation definitions. Although + workarounds can be made, they take away from using pure regex's. + Furthermore it's quick and dirty but the regex's become harder to + maintain and are not reusable, so it's as much a programming philosophy + as anything. + + In place of this new validator functions should be created; a regex can + be used within the validator function and even be precompiled for better + efficiency within regexes.go. + + And the best reason, you can submit a pull request and we can keep on + adding to the validation library of this package! + +# Non standard validators + +A collection of validation rules that are frequently needed but are more +complex than the ones found in the baked in validators. +A non standard validator must be registered manually like you would +with your own custom validation functions. + +Example of registration and use: + + type Test struct { + TestField string `validate:"yourtag"` + } + + t := &Test{ + TestField: "Test" + } + + validate := validator.New() + validate.RegisterValidation("yourtag", validators.NotBlank) + +Here is a list of the current non standard validators: + + NotBlank + This validates that the value is not blank or with length zero. + For strings ensures they do not contain only spaces. For channels, maps, slices and arrays + ensures they don't have zero length. For others, a non empty value is required. + + Usage: notblank + +# Panics + +This package panics when bad input is provided, this is by design, bad code like +that should not make it to production. + + type Test struct { + TestField string `validate:"nonexistantfunction=1"` + } + + t := &Test{ + TestField: "Test" + } + + validate.Struct(t) // this will panic +*/ +package validator diff --git a/vendor/github.com/go-playground/validator/v10/errors.go b/vendor/github.com/go-playground/validator/v10/errors.go new file mode 100644 index 00000000..fd906256 --- /dev/null +++ b/vendor/github.com/go-playground/validator/v10/errors.go @@ -0,0 +1,273 @@ +package validator + +import ( + "bytes" + "fmt" + "reflect" + "strings" + + ut "github.com/go-playground/universal-translator" +) + +const ( + fieldErrMsg = "Key: '%s' Error:Field validation for '%s' failed on the '%s' tag" +) + +// ValidationErrorsTranslations is the translation return type +type ValidationErrorsTranslations map[string]string + +// InvalidValidationError describes an invalid argument passed to +// `Struct`, `StructExcept`, StructPartial` or `Field` +type InvalidValidationError struct { + Type reflect.Type +} + +// Error returns InvalidValidationError message +func (e *InvalidValidationError) Error() string { + if e.Type == nil { + return "validator: (nil)" + } + + return "validator: (nil " + e.Type.String() + ")" +} + +// ValidationErrors is an array of FieldError's +// for use in custom error messages post validation. +type ValidationErrors []FieldError + +// Error is intended for use in development + debugging and not intended to be a production error message. +// It allows ValidationErrors to subscribe to the Error interface. +// All information to create an error message specific to your application is contained within +// the FieldError found within the ValidationErrors array +func (ve ValidationErrors) Error() string { + buff := bytes.NewBufferString("") + + for i := 0; i < len(ve); i++ { + buff.WriteString(ve[i].Error()) + buff.WriteString("\n") + } + + return strings.TrimSpace(buff.String()) +} + +// Translate translates all of the ValidationErrors +func (ve ValidationErrors) Translate(ut ut.Translator) ValidationErrorsTranslations { + trans := make(ValidationErrorsTranslations) + + var fe *fieldError + + for i := 0; i < len(ve); i++ { + fe = ve[i].(*fieldError) + + // // in case an Anonymous struct was used, ensure that the key + // // would be 'Username' instead of ".Username" + // if len(fe.ns) > 0 && fe.ns[:1] == "." { + // trans[fe.ns[1:]] = fe.Translate(ut) + // continue + // } + + trans[fe.ns] = fe.Translate(ut) + } + + return trans +} + +// FieldError contains all functions to get error details +type FieldError interface { + + // Tag returns the validation tag that failed. if the + // validation was an alias, this will return the + // alias name and not the underlying tag that failed. + // + // eg. alias "iscolor": "hexcolor|rgb|rgba|hsl|hsla" + // will return "iscolor" + Tag() string + + // ActualTag returns the validation tag that failed, even if an + // alias the actual tag within the alias will be returned. + // If an 'or' validation fails the entire or will be returned. + // + // eg. alias "iscolor": "hexcolor|rgb|rgba|hsl|hsla" + // will return "hexcolor|rgb|rgba|hsl|hsla" + ActualTag() string + + // Namespace returns the namespace for the field error, with the tag + // name taking precedence over the field's actual name. + // + // eg. JSON name "User.fname" + // + // See StructNamespace() for a version that returns actual names. + // + // NOTE: this field can be blank when validating a single primitive field + // using validate.Field(...) as there is no way to extract it's name + Namespace() string + + // StructNamespace returns the namespace for the field error, with the field's + // actual name. + // + // eg. "User.FirstName" see Namespace for comparison + // + // NOTE: this field can be blank when validating a single primitive field + // using validate.Field(...) as there is no way to extract its name + StructNamespace() string + + // Field returns the field's name with the tag name taking precedence over the + // field's actual name. + // + // `RegisterTagNameFunc` must be registered to get tag value. + // + // eg. JSON name "fname" + // see StructField for comparison + Field() string + + // StructField returns the field's actual name from the struct, when able to determine. + // + // eg. "FirstName" + // see Field for comparison + StructField() string + + // Value returns the actual field's value in case needed for creating the error + // message + Value() interface{} + + // Param returns the param value, in string form for comparison; this will also + // help with generating an error message + Param() string + + // Kind returns the Field's reflect Kind + // + // eg. time.Time's kind is a struct + Kind() reflect.Kind + + // Type returns the Field's reflect Type + // + // eg. time.Time's type is time.Time + Type() reflect.Type + + // Translate returns the FieldError's translated error + // from the provided 'ut.Translator' and registered 'TranslationFunc' + // + // NOTE: if no registered translator can be found it returns the same as + // calling fe.Error() + Translate(ut ut.Translator) string + + // Error returns the FieldError's message + Error() string +} + +// compile time interface checks +var _ FieldError = new(fieldError) +var _ error = new(fieldError) + +// fieldError contains a single field's validation error along +// with other properties that may be needed for error message creation +// it complies with the FieldError interface +type fieldError struct { + v *Validate + tag string + actualTag string + ns string + structNs string + fieldLen uint8 + structfieldLen uint8 + value interface{} + param string + kind reflect.Kind + typ reflect.Type +} + +// Tag returns the validation tag that failed. +func (fe *fieldError) Tag() string { + return fe.tag +} + +// ActualTag returns the validation tag that failed, even if an +// alias the actual tag within the alias will be returned. +func (fe *fieldError) ActualTag() string { + return fe.actualTag +} + +// Namespace returns the namespace for the field error, with the tag +// name taking precedence over the field's actual name. +func (fe *fieldError) Namespace() string { + return fe.ns +} + +// StructNamespace returns the namespace for the field error, with the field's +// actual name. +func (fe *fieldError) StructNamespace() string { + return fe.structNs +} + +// Field returns the field's name with the tag name taking precedence over the +// field's actual name. +func (fe *fieldError) Field() string { + return fe.ns[len(fe.ns)-int(fe.fieldLen):] + // // return fe.field + // fld := fe.ns[len(fe.ns)-int(fe.fieldLen):] + + // log.Println("FLD:", fld) + + // if len(fld) > 0 && fld[:1] == "." { + // return fld[1:] + // } + + // return fld +} + +// StructField returns the field's actual name from the struct, when able to determine. +func (fe *fieldError) StructField() string { + // return fe.structField + return fe.structNs[len(fe.structNs)-int(fe.structfieldLen):] +} + +// Value returns the actual field's value in case needed for creating the error +// message +func (fe *fieldError) Value() interface{} { + return fe.value +} + +// Param returns the param value, in string form for comparison; this will +// also help with generating an error message +func (fe *fieldError) Param() string { + return fe.param +} + +// Kind returns the Field's reflect Kind +func (fe *fieldError) Kind() reflect.Kind { + return fe.kind +} + +// Type returns the Field's reflect Type +func (fe *fieldError) Type() reflect.Type { + return fe.typ +} + +// Error returns the fieldError's error message +func (fe *fieldError) Error() string { + return fmt.Sprintf(fieldErrMsg, fe.ns, fe.Field(), fe.tag) +} + +// Translate returns the FieldError's translated error +// from the provided 'ut.Translator' and registered 'TranslationFunc' +// +// NOTE: if no registered translation can be found, it returns the original +// untranslated error message. +func (fe *fieldError) Translate(ut ut.Translator) string { + var fn TranslationFunc + + m, ok := fe.v.transTagFunc[ut] + if !ok { + return fe.Error() + } + + fn, ok = m[fe.tag] + if !ok { + fn, ok = m[fe.actualTag] + if !ok { + return fe.Error() + } + } + + return fn(ut, fe) +} diff --git a/vendor/github.com/go-playground/validator/v10/field_level.go b/vendor/github.com/go-playground/validator/v10/field_level.go new file mode 100644 index 00000000..ef35826e --- /dev/null +++ b/vendor/github.com/go-playground/validator/v10/field_level.go @@ -0,0 +1,120 @@ +package validator + +import "reflect" + +// FieldLevel contains all the information and helper functions +// to validate a field +type FieldLevel interface { + + // Top returns the top level struct, if any + Top() reflect.Value + + // Parent returns the current fields parent struct, if any or + // the comparison value if called 'VarWithValue' + Parent() reflect.Value + + // Field returns current field for validation + Field() reflect.Value + + // FieldName returns the field's name with the tag + // name taking precedence over the fields actual name. + FieldName() string + + // StructFieldName returns the struct field's name + StructFieldName() string + + // Param returns param for validation against current field + Param() string + + // GetTag returns the current validations tag name + GetTag() string + + // ExtractType gets the actual underlying type of field value. + // It will dive into pointers, customTypes and return you the + // underlying value and it's kind. + ExtractType(field reflect.Value) (value reflect.Value, kind reflect.Kind, nullable bool) + + // GetStructFieldOK traverses the parent struct to retrieve a specific field denoted by the provided namespace + // in the param and returns the field, field kind and whether is was successful in retrieving + // the field at all. + // + // NOTE: when not successful ok will be false, this can happen when a nested struct is nil and so the field + // could not be retrieved because it didn't exist. + // + // Deprecated: Use GetStructFieldOK2() instead which also return if the value is nullable. + GetStructFieldOK() (reflect.Value, reflect.Kind, bool) + + // GetStructFieldOKAdvanced is the same as GetStructFieldOK except that it accepts the parent struct to start looking for + // the field and namespace allowing more extensibility for validators. + // + // Deprecated: Use GetStructFieldOKAdvanced2() instead which also return if the value is nullable. + GetStructFieldOKAdvanced(val reflect.Value, namespace string) (reflect.Value, reflect.Kind, bool) + + // GetStructFieldOK2 traverses the parent struct to retrieve a specific field denoted by the provided namespace + // in the param and returns the field, field kind, if it's a nullable type and whether is was successful in retrieving + // the field at all. + // + // NOTE: when not successful ok will be false, this can happen when a nested struct is nil and so the field + // could not be retrieved because it didn't exist. + GetStructFieldOK2() (reflect.Value, reflect.Kind, bool, bool) + + // GetStructFieldOKAdvanced2 is the same as GetStructFieldOK except that it accepts the parent struct to start looking for + // the field and namespace allowing more extensibility for validators. + GetStructFieldOKAdvanced2(val reflect.Value, namespace string) (reflect.Value, reflect.Kind, bool, bool) +} + +var _ FieldLevel = new(validate) + +// Field returns current field for validation +func (v *validate) Field() reflect.Value { + return v.flField +} + +// FieldName returns the field's name with the tag +// name taking precedence over the fields actual name. +func (v *validate) FieldName() string { + return v.cf.altName +} + +// GetTag returns the current validations tag name +func (v *validate) GetTag() string { + return v.ct.tag +} + +// StructFieldName returns the struct field's name +func (v *validate) StructFieldName() string { + return v.cf.name +} + +// Param returns param for validation against current field +func (v *validate) Param() string { + return v.ct.param +} + +// GetStructFieldOK returns Param returns param for validation against current field +// +// Deprecated: Use GetStructFieldOK2() instead which also return if the value is nullable. +func (v *validate) GetStructFieldOK() (reflect.Value, reflect.Kind, bool) { + current, kind, _, found := v.getStructFieldOKInternal(v.slflParent, v.ct.param) + return current, kind, found +} + +// GetStructFieldOKAdvanced is the same as GetStructFieldOK except that it accepts the parent struct to start looking for +// the field and namespace allowing more extensibility for validators. +// +// Deprecated: Use GetStructFieldOKAdvanced2() instead which also return if the value is nullable. +func (v *validate) GetStructFieldOKAdvanced(val reflect.Value, namespace string) (reflect.Value, reflect.Kind, bool) { + current, kind, _, found := v.GetStructFieldOKAdvanced2(val, namespace) + return current, kind, found +} + +// GetStructFieldOK2 returns Param returns param for validation against current field +func (v *validate) GetStructFieldOK2() (reflect.Value, reflect.Kind, bool, bool) { + return v.getStructFieldOKInternal(v.slflParent, v.ct.param) +} + +// GetStructFieldOKAdvanced2 is the same as GetStructFieldOK except that it accepts the parent struct to start looking for +// the field and namespace allowing more extensibility for validators. +func (v *validate) GetStructFieldOKAdvanced2(val reflect.Value, namespace string) (reflect.Value, reflect.Kind, bool, bool) { + return v.getStructFieldOKInternal(val, namespace) +} diff --git a/vendor/github.com/go-playground/validator/v10/logo.png b/vendor/github.com/go-playground/validator/v10/logo.png new file mode 100644 index 00000000..355000f5 Binary files /dev/null and b/vendor/github.com/go-playground/validator/v10/logo.png differ diff --git a/vendor/github.com/go-playground/validator/v10/options.go b/vendor/github.com/go-playground/validator/v10/options.go new file mode 100644 index 00000000..86a0db21 --- /dev/null +++ b/vendor/github.com/go-playground/validator/v10/options.go @@ -0,0 +1,26 @@ +package validator + +// Option represents a configurations option to be applied to validator during initialization. +type Option func(*Validate) + +// WithRequiredStructEnabled enables required tag on non-pointer structs to be applied instead of ignored. +// +// This was made opt-in behaviour in order to maintain backward compatibility with the behaviour previous +// to being able to apply struct level validations on struct fields directly. +// +// It is recommended you enabled this as it will be the default behaviour in v11+ +func WithRequiredStructEnabled() Option { + return func(v *Validate) { + v.requiredStructEnabled = true + } +} + +// WithPrivateFieldValidation activates validation for unexported fields via the use of the `unsafe` package. +// +// By opting into this feature you are acknowledging that you are aware of the risks and accept any current or future +// consequences of using this feature. +func WithPrivateFieldValidation() Option { + return func(v *Validate) { + v.privateFieldValidation = true + } +} diff --git a/vendor/github.com/go-playground/validator/v10/postcode_regexes.go b/vendor/github.com/go-playground/validator/v10/postcode_regexes.go new file mode 100644 index 00000000..326b8f75 --- /dev/null +++ b/vendor/github.com/go-playground/validator/v10/postcode_regexes.go @@ -0,0 +1,179 @@ +package validator + +import ( + "regexp" + "sync" +) + +var postCodePatternDict = map[string]string{ + "GB": `^GIR[ ]?0AA|((AB|AL|B|BA|BB|BD|BH|BL|BN|BR|BS|BT|CA|CB|CF|CH|CM|CO|CR|CT|CV|CW|DA|DD|DE|DG|DH|DL|DN|DT|DY|E|EC|EH|EN|EX|FK|FY|G|GL|GY|GU|HA|HD|HG|HP|HR|HS|HU|HX|IG|IM|IP|IV|JE|KA|KT|KW|KY|L|LA|LD|LE|LL|LN|LS|LU|M|ME|MK|ML|N|NE|NG|NN|NP|NR|NW|OL|OX|PA|PE|PH|PL|PO|PR|RG|RH|RM|S|SA|SE|SG|SK|SL|SM|SN|SO|SP|SR|SS|ST|SW|SY|TA|TD|TF|TN|TQ|TR|TS|TW|UB|W|WA|WC|WD|WF|WN|WR|WS|WV|YO|ZE)(\d[\dA-Z]?[ ]?\d[ABD-HJLN-UW-Z]{2}))|BFPO[ ]?\d{1,4}$`, + "JE": `^JE\d[\dA-Z]?[ ]?\d[ABD-HJLN-UW-Z]{2}$`, + "GG": `^GY\d[\dA-Z]?[ ]?\d[ABD-HJLN-UW-Z]{2}$`, + "IM": `^IM\d[\dA-Z]?[ ]?\d[ABD-HJLN-UW-Z]{2}$`, + "US": `^\d{5}([ \-]\d{4})?$`, + "CA": `^[ABCEGHJKLMNPRSTVXY]\d[ABCEGHJ-NPRSTV-Z][ ]?\d[ABCEGHJ-NPRSTV-Z]\d$`, + "DE": `^\d{5}$`, + "JP": `^\d{3}-\d{4}$`, + "FR": `^\d{2}[ ]?\d{3}$`, + "AU": `^\d{4}$`, + "IT": `^\d{5}$`, + "CH": `^\d{4}$`, + "AT": `^\d{4}$`, + "ES": `^\d{5}$`, + "NL": `^\d{4}[ ]?[A-Z]{2}$`, + "BE": `^\d{4}$`, + "DK": `^\d{4}$`, + "SE": `^\d{3}[ ]?\d{2}$`, + "NO": `^\d{4}$`, + "BR": `^\d{5}[\-]?\d{3}$`, + "PT": `^\d{4}([\-]\d{3})?$`, + "FI": `^\d{5}$`, + "AX": `^22\d{3}$`, + "KR": `^\d{3}[\-]\d{3}$`, + "CN": `^\d{6}$`, + "TW": `^\d{3}(\d{2})?$`, + "SG": `^\d{6}$`, + "DZ": `^\d{5}$`, + "AD": `^AD\d{3}$`, + "AR": `^([A-HJ-NP-Z])?\d{4}([A-Z]{3})?$`, + "AM": `^(37)?\d{4}$`, + "AZ": `^\d{4}$`, + "BH": `^((1[0-2]|[2-9])\d{2})?$`, + "BD": `^\d{4}$`, + "BB": `^(BB\d{5})?$`, + "BY": `^\d{6}$`, + "BM": `^[A-Z]{2}[ ]?[A-Z0-9]{2}$`, + "BA": `^\d{5}$`, + "IO": `^BBND 1ZZ$`, + "BN": `^[A-Z]{2}[ ]?\d{4}$`, + "BG": `^\d{4}$`, + "KH": `^\d{5}$`, + "CV": `^\d{4}$`, + "CL": `^\d{7}$`, + "CR": `^\d{4,5}|\d{3}-\d{4}$`, + "HR": `^\d{5}$`, + "CY": `^\d{4}$`, + "CZ": `^\d{3}[ ]?\d{2}$`, + "DO": `^\d{5}$`, + "EC": `^([A-Z]\d{4}[A-Z]|(?:[A-Z]{2})?\d{6})?$`, + "EG": `^\d{5}$`, + "EE": `^\d{5}$`, + "FO": `^\d{3}$`, + "GE": `^\d{4}$`, + "GR": `^\d{3}[ ]?\d{2}$`, + "GL": `^39\d{2}$`, + "GT": `^\d{5}$`, + "HT": `^\d{4}$`, + "HN": `^(?:\d{5})?$`, + "HU": `^\d{4}$`, + "IS": `^\d{3}$`, + "IN": `^\d{6}$`, + "ID": `^\d{5}$`, + "IL": `^\d{5}$`, + "JO": `^\d{5}$`, + "KZ": `^\d{6}$`, + "KE": `^\d{5}$`, + "KW": `^\d{5}$`, + "LA": `^\d{5}$`, + "LV": `^\d{4}$`, + "LB": `^(\d{4}([ ]?\d{4})?)?$`, + "LI": `^(948[5-9])|(949[0-7])$`, + "LT": `^\d{5}$`, + "LU": `^\d{4}$`, + "MK": `^\d{4}$`, + "MY": `^\d{5}$`, + "MV": `^\d{5}$`, + "MT": `^[A-Z]{3}[ ]?\d{2,4}$`, + "MU": `^(\d{3}[A-Z]{2}\d{3})?$`, + "MX": `^\d{5}$`, + "MD": `^\d{4}$`, + "MC": `^980\d{2}$`, + "MA": `^\d{5}$`, + "NP": `^\d{5}$`, + "NZ": `^\d{4}$`, + "NI": `^((\d{4}-)?\d{3}-\d{3}(-\d{1})?)?$`, + "NG": `^(\d{6})?$`, + "OM": `^(PC )?\d{3}$`, + "PK": `^\d{5}$`, + "PY": `^\d{4}$`, + "PH": `^\d{4}$`, + "PL": `^\d{2}-\d{3}$`, + "PR": `^00[679]\d{2}([ \-]\d{4})?$`, + "RO": `^\d{6}$`, + "RU": `^\d{6}$`, + "SM": `^4789\d$`, + "SA": `^\d{5}$`, + "SN": `^\d{5}$`, + "SK": `^\d{3}[ ]?\d{2}$`, + "SI": `^\d{4}$`, + "ZA": `^\d{4}$`, + "LK": `^\d{5}$`, + "TJ": `^\d{6}$`, + "TH": `^\d{5}$`, + "TN": `^\d{4}$`, + "TR": `^\d{5}$`, + "TM": `^\d{6}$`, + "UA": `^\d{5}$`, + "UY": `^\d{5}$`, + "UZ": `^\d{6}$`, + "VA": `^00120$`, + "VE": `^\d{4}$`, + "ZM": `^\d{5}$`, + "AS": `^96799$`, + "CC": `^6799$`, + "CK": `^\d{4}$`, + "RS": `^\d{6}$`, + "ME": `^8\d{4}$`, + "CS": `^\d{5}$`, + "YU": `^\d{5}$`, + "CX": `^6798$`, + "ET": `^\d{4}$`, + "FK": `^FIQQ 1ZZ$`, + "NF": `^2899$`, + "FM": `^(9694[1-4])([ \-]\d{4})?$`, + "GF": `^9[78]3\d{2}$`, + "GN": `^\d{3}$`, + "GP": `^9[78][01]\d{2}$`, + "GS": `^SIQQ 1ZZ$`, + "GU": `^969[123]\d([ \-]\d{4})?$`, + "GW": `^\d{4}$`, + "HM": `^\d{4}$`, + "IQ": `^\d{5}$`, + "KG": `^\d{6}$`, + "LR": `^\d{4}$`, + "LS": `^\d{3}$`, + "MG": `^\d{3}$`, + "MH": `^969[67]\d([ \-]\d{4})?$`, + "MN": `^\d{6}$`, + "MP": `^9695[012]([ \-]\d{4})?$`, + "MQ": `^9[78]2\d{2}$`, + "NC": `^988\d{2}$`, + "NE": `^\d{4}$`, + "VI": `^008(([0-4]\d)|(5[01]))([ \-]\d{4})?$`, + "VN": `^[0-9]{1,6}$`, + "PF": `^987\d{2}$`, + "PG": `^\d{3}$`, + "PM": `^9[78]5\d{2}$`, + "PN": `^PCRN 1ZZ$`, + "PW": `^96940$`, + "RE": `^9[78]4\d{2}$`, + "SH": `^(ASCN|STHL) 1ZZ$`, + "SJ": `^\d{4}$`, + "SO": `^\d{5}$`, + "SZ": `^[HLMS]\d{3}$`, + "TC": `^TKCA 1ZZ$`, + "WF": `^986\d{2}$`, + "XK": `^\d{5}$`, + "YT": `^976\d{2}$`, +} + +var ( + postcodeRegexInit sync.Once + postCodeRegexDict = map[string]*regexp.Regexp{} +) + +func initPostcodes() { + for countryCode, pattern := range postCodePatternDict { + postCodeRegexDict[countryCode] = regexp.MustCompile(pattern) + } +} diff --git a/vendor/github.com/go-playground/validator/v10/regexes.go b/vendor/github.com/go-playground/validator/v10/regexes.go new file mode 100644 index 00000000..93909b2e --- /dev/null +++ b/vendor/github.com/go-playground/validator/v10/regexes.go @@ -0,0 +1,165 @@ +package validator + +import ( + "regexp" + "sync" +) + +const ( + alphaRegexString = "^[a-zA-Z]+$" + alphaNumericRegexString = "^[a-zA-Z0-9]+$" + alphaUnicodeRegexString = "^[\\p{L}]+$" + alphaUnicodeNumericRegexString = "^[\\p{L}\\p{N}]+$" + numericRegexString = "^[-+]?[0-9]+(?:\\.[0-9]+)?$" + numberRegexString = "^[0-9]+$" + hexadecimalRegexString = "^(0[xX])?[0-9a-fA-F]+$" + hexColorRegexString = "^#(?:[0-9a-fA-F]{3}|[0-9a-fA-F]{4}|[0-9a-fA-F]{6}|[0-9a-fA-F]{8})$" + rgbRegexString = "^rgb\\(\\s*(?:(?:0|[1-9]\\d?|1\\d\\d?|2[0-4]\\d|25[0-5])\\s*,\\s*(?:0|[1-9]\\d?|1\\d\\d?|2[0-4]\\d|25[0-5])\\s*,\\s*(?:0|[1-9]\\d?|1\\d\\d?|2[0-4]\\d|25[0-5])|(?:0|[1-9]\\d?|1\\d\\d?|2[0-4]\\d|25[0-5])%\\s*,\\s*(?:0|[1-9]\\d?|1\\d\\d?|2[0-4]\\d|25[0-5])%\\s*,\\s*(?:0|[1-9]\\d?|1\\d\\d?|2[0-4]\\d|25[0-5])%)\\s*\\)$" + rgbaRegexString = "^rgba\\(\\s*(?:(?:0|[1-9]\\d?|1\\d\\d?|2[0-4]\\d|25[0-5])\\s*,\\s*(?:0|[1-9]\\d?|1\\d\\d?|2[0-4]\\d|25[0-5])\\s*,\\s*(?:0|[1-9]\\d?|1\\d\\d?|2[0-4]\\d|25[0-5])|(?:0|[1-9]\\d?|1\\d\\d?|2[0-4]\\d|25[0-5])%\\s*,\\s*(?:0|[1-9]\\d?|1\\d\\d?|2[0-4]\\d|25[0-5])%\\s*,\\s*(?:0|[1-9]\\d?|1\\d\\d?|2[0-4]\\d|25[0-5])%)\\s*,\\s*(?:(?:0.[1-9]*)|[01])\\s*\\)$" + hslRegexString = "^hsl\\(\\s*(?:0|[1-9]\\d?|[12]\\d\\d|3[0-5]\\d|360)\\s*,\\s*(?:(?:0|[1-9]\\d?|100)%)\\s*,\\s*(?:(?:0|[1-9]\\d?|100)%)\\s*\\)$" + hslaRegexString = "^hsla\\(\\s*(?:0|[1-9]\\d?|[12]\\d\\d|3[0-5]\\d|360)\\s*,\\s*(?:(?:0|[1-9]\\d?|100)%)\\s*,\\s*(?:(?:0|[1-9]\\d?|100)%)\\s*,\\s*(?:(?:0.[1-9]*)|[01])\\s*\\)$" + emailRegexString = "^(?:(?:(?:(?:[a-zA-Z]|\\d|[!#\\$%&'\\*\\+\\-\\/=\\?\\^_`{\\|}~]|[\\x{00A0}-\\x{D7FF}\\x{F900}-\\x{FDCF}\\x{FDF0}-\\x{FFEF}])+(?:\\.([a-zA-Z]|\\d|[!#\\$%&'\\*\\+\\-\\/=\\?\\^_`{\\|}~]|[\\x{00A0}-\\x{D7FF}\\x{F900}-\\x{FDCF}\\x{FDF0}-\\x{FFEF}])+)*)|(?:(?:\\x22)(?:(?:(?:(?:\\x20|\\x09)*(?:\\x0d\\x0a))?(?:\\x20|\\x09)+)?(?:(?:[\\x01-\\x08\\x0b\\x0c\\x0e-\\x1f\\x7f]|\\x21|[\\x23-\\x5b]|[\\x5d-\\x7e]|[\\x{00A0}-\\x{D7FF}\\x{F900}-\\x{FDCF}\\x{FDF0}-\\x{FFEF}])|(?:(?:[\\x01-\\x09\\x0b\\x0c\\x0d-\\x7f]|[\\x{00A0}-\\x{D7FF}\\x{F900}-\\x{FDCF}\\x{FDF0}-\\x{FFEF}]))))*(?:(?:(?:\\x20|\\x09)*(?:\\x0d\\x0a))?(\\x20|\\x09)+)?(?:\\x22))))@(?:(?:(?:[a-zA-Z]|\\d|[\\x{00A0}-\\x{D7FF}\\x{F900}-\\x{FDCF}\\x{FDF0}-\\x{FFEF}])|(?:(?:[a-zA-Z]|\\d|[\\x{00A0}-\\x{D7FF}\\x{F900}-\\x{FDCF}\\x{FDF0}-\\x{FFEF}])(?:[a-zA-Z]|\\d|-|\\.|~|[\\x{00A0}-\\x{D7FF}\\x{F900}-\\x{FDCF}\\x{FDF0}-\\x{FFEF}])*(?:[a-zA-Z]|\\d|[\\x{00A0}-\\x{D7FF}\\x{F900}-\\x{FDCF}\\x{FDF0}-\\x{FFEF}])))\\.)+(?:(?:[a-zA-Z]|[\\x{00A0}-\\x{D7FF}\\x{F900}-\\x{FDCF}\\x{FDF0}-\\x{FFEF}])|(?:(?:[a-zA-Z]|[\\x{00A0}-\\x{D7FF}\\x{F900}-\\x{FDCF}\\x{FDF0}-\\x{FFEF}])(?:[a-zA-Z]|\\d|-|\\.|~|[\\x{00A0}-\\x{D7FF}\\x{F900}-\\x{FDCF}\\x{FDF0}-\\x{FFEF}])*(?:[a-zA-Z]|[\\x{00A0}-\\x{D7FF}\\x{F900}-\\x{FDCF}\\x{FDF0}-\\x{FFEF}])))\\.?$" + e164RegexString = "^\\+[1-9]?[0-9]{7,14}$" + base32RegexString = "^(?:[A-Z2-7]{8})*(?:[A-Z2-7]{2}={6}|[A-Z2-7]{4}={4}|[A-Z2-7]{5}={3}|[A-Z2-7]{7}=|[A-Z2-7]{8})$" + base64RegexString = "^(?:[A-Za-z0-9+\\/]{4})*(?:[A-Za-z0-9+\\/]{2}==|[A-Za-z0-9+\\/]{3}=|[A-Za-z0-9+\\/]{4})$" + base64URLRegexString = "^(?:[A-Za-z0-9-_]{4})*(?:[A-Za-z0-9-_]{2}==|[A-Za-z0-9-_]{3}=|[A-Za-z0-9-_]{4})$" + base64RawURLRegexString = "^(?:[A-Za-z0-9-_]{4})*(?:[A-Za-z0-9-_]{2,4})$" + iSBN10RegexString = "^(?:[0-9]{9}X|[0-9]{10})$" + iSBN13RegexString = "^(?:(?:97(?:8|9))[0-9]{10})$" + iSSNRegexString = "^(?:[0-9]{4}-[0-9]{3}[0-9X])$" + uUID3RegexString = "^[0-9a-f]{8}-[0-9a-f]{4}-3[0-9a-f]{3}-[0-9a-f]{4}-[0-9a-f]{12}$" + uUID4RegexString = "^[0-9a-f]{8}-[0-9a-f]{4}-4[0-9a-f]{3}-[89ab][0-9a-f]{3}-[0-9a-f]{12}$" + uUID5RegexString = "^[0-9a-f]{8}-[0-9a-f]{4}-5[0-9a-f]{3}-[89ab][0-9a-f]{3}-[0-9a-f]{12}$" + uUIDRegexString = "^[0-9a-f]{8}-[0-9a-f]{4}-[0-9a-f]{4}-[0-9a-f]{4}-[0-9a-f]{12}$" + uUID3RFC4122RegexString = "^[0-9a-fA-F]{8}-[0-9a-fA-F]{4}-3[0-9a-fA-F]{3}-[0-9a-fA-F]{4}-[0-9a-fA-F]{12}$" + uUID4RFC4122RegexString = "^[0-9a-fA-F]{8}-[0-9a-fA-F]{4}-4[0-9a-fA-F]{3}-[89abAB][0-9a-fA-F]{3}-[0-9a-fA-F]{12}$" + uUID5RFC4122RegexString = "^[0-9a-fA-F]{8}-[0-9a-fA-F]{4}-5[0-9a-fA-F]{3}-[89abAB][0-9a-fA-F]{3}-[0-9a-fA-F]{12}$" + uUIDRFC4122RegexString = "^[0-9a-fA-F]{8}-[0-9a-fA-F]{4}-[0-9a-fA-F]{4}-[0-9a-fA-F]{4}-[0-9a-fA-F]{12}$" + uLIDRegexString = "^(?i)[A-HJKMNP-TV-Z0-9]{26}$" + md4RegexString = "^[0-9a-f]{32}$" + md5RegexString = "^[0-9a-f]{32}$" + sha256RegexString = "^[0-9a-f]{64}$" + sha384RegexString = "^[0-9a-f]{96}$" + sha512RegexString = "^[0-9a-f]{128}$" + ripemd128RegexString = "^[0-9a-f]{32}$" + ripemd160RegexString = "^[0-9a-f]{40}$" + tiger128RegexString = "^[0-9a-f]{32}$" + tiger160RegexString = "^[0-9a-f]{40}$" + tiger192RegexString = "^[0-9a-f]{48}$" + aSCIIRegexString = "^[\x00-\x7F]*$" + printableASCIIRegexString = "^[\x20-\x7E]*$" + multibyteRegexString = "[^\x00-\x7F]" + dataURIRegexString = `^data:((?:\w+\/(?:([^;]|;[^;]).)+)?)` + latitudeRegexString = "^[-+]?([1-8]?\\d(\\.\\d+)?|90(\\.0+)?)$" + longitudeRegexString = "^[-+]?(180(\\.0+)?|((1[0-7]\\d)|([1-9]?\\d))(\\.\\d+)?)$" + sSNRegexString = `^[0-9]{3}[ -]?(0[1-9]|[1-9][0-9])[ -]?([1-9][0-9]{3}|[0-9][1-9][0-9]{2}|[0-9]{2}[1-9][0-9]|[0-9]{3}[1-9])$` + hostnameRegexStringRFC952 = `^[a-zA-Z]([a-zA-Z0-9\-]+[\.]?)*[a-zA-Z0-9]$` // https://tools.ietf.org/html/rfc952 + hostnameRegexStringRFC1123 = `^([a-zA-Z0-9]{1}[a-zA-Z0-9-]{0,62}){1}(\.[a-zA-Z0-9]{1}[a-zA-Z0-9-]{0,62})*?$` // accepts hostname starting with a digit https://tools.ietf.org/html/rfc1123 + fqdnRegexStringRFC1123 = `^([a-zA-Z0-9]{1}[a-zA-Z0-9-]{0,62})(\.[a-zA-Z0-9]{1}[a-zA-Z0-9-]{0,62})*?(\.[a-zA-Z]{1}[a-zA-Z0-9]{0,62})\.?$` // same as hostnameRegexStringRFC1123 but must contain a non numerical TLD (possibly ending with '.') + btcAddressRegexString = `^[13][a-km-zA-HJ-NP-Z1-9]{25,34}$` // bitcoin address + btcAddressUpperRegexStringBech32 = `^BC1[02-9AC-HJ-NP-Z]{7,76}$` // bitcoin bech32 address https://en.bitcoin.it/wiki/Bech32 + btcAddressLowerRegexStringBech32 = `^bc1[02-9ac-hj-np-z]{7,76}$` // bitcoin bech32 address https://en.bitcoin.it/wiki/Bech32 + ethAddressRegexString = `^0x[0-9a-fA-F]{40}$` + ethAddressUpperRegexString = `^0x[0-9A-F]{40}$` + ethAddressLowerRegexString = `^0x[0-9a-f]{40}$` + uRLEncodedRegexString = `^(?:[^%]|%[0-9A-Fa-f]{2})*$` + hTMLEncodedRegexString = `&#[x]?([0-9a-fA-F]{2})|(>)|(<)|(")|(&)+[;]?` + hTMLRegexString = `<[/]?([a-zA-Z]+).*?>` + jWTRegexString = "^[A-Za-z0-9-_]+\\.[A-Za-z0-9-_]+\\.[A-Za-z0-9-_]*$" + splitParamsRegexString = `'[^']*'|\S+` + bicRegexString = `^[A-Za-z]{6}[A-Za-z0-9]{2}([A-Za-z0-9]{3})?$` + semverRegexString = `^(0|[1-9]\d*)\.(0|[1-9]\d*)\.(0|[1-9]\d*)(?:-((?:0|[1-9]\d*|\d*[a-zA-Z-][0-9a-zA-Z-]*)(?:\.(?:0|[1-9]\d*|\d*[a-zA-Z-][0-9a-zA-Z-]*))*))?(?:\+([0-9a-zA-Z-]+(?:\.[0-9a-zA-Z-]+)*))?$` // numbered capture groups https://semver.org/ + dnsRegexStringRFC1035Label = "^[a-z]([-a-z0-9]*[a-z0-9])?$" + cveRegexString = `^CVE-(1999|2\d{3})-(0[^0]\d{2}|0\d[^0]\d{1}|0\d{2}[^0]|[1-9]{1}\d{3,})$` // CVE Format Id https://cve.mitre.org/cve/identifiers/syntaxchange.html + mongodbIdRegexString = "^[a-f\\d]{24}$" + mongodbConnStringRegexString = "^mongodb(\\+srv)?:\\/\\/(([a-zA-Z\\d]+):([a-zA-Z\\d$:\\/?#\\[\\]@]+)@)?(([a-z\\d.-]+)(:[\\d]+)?)((,(([a-z\\d.-]+)(:(\\d+))?))*)?(\\/[a-zA-Z-_]{1,64})?(\\?(([a-zA-Z]+)=([a-zA-Z\\d]+))(&(([a-zA-Z\\d]+)=([a-zA-Z\\d]+))?)*)?$" + cronRegexString = `(@(annually|yearly|monthly|weekly|daily|hourly|reboot))|(@every (\d+(ns|us|µs|ms|s|m|h))+)|((((\d+,)+\d+|((\*|\d+)(\/|-)\d+)|\d+|\*) ?){5,7})` + spicedbIDRegexString = `^(([a-zA-Z0-9/_|\-=+]{1,})|\*)$` + spicedbPermissionRegexString = "^([a-z][a-z0-9_]{1,62}[a-z0-9])?$" + spicedbTypeRegexString = "^([a-z][a-z0-9_]{1,61}[a-z0-9]/)?[a-z][a-z0-9_]{1,62}[a-z0-9]$" + einRegexString = "^(\\d{2}-\\d{7})$" +) + +func lazyRegexCompile(str string) func() *regexp.Regexp { + var regex *regexp.Regexp + var once sync.Once + return func() *regexp.Regexp { + once.Do(func() { + regex = regexp.MustCompile(str) + }) + return regex + } +} + +var ( + alphaRegex = lazyRegexCompile(alphaRegexString) + alphaNumericRegex = lazyRegexCompile(alphaNumericRegexString) + alphaUnicodeRegex = lazyRegexCompile(alphaUnicodeRegexString) + alphaUnicodeNumericRegex = lazyRegexCompile(alphaUnicodeNumericRegexString) + numericRegex = lazyRegexCompile(numericRegexString) + numberRegex = lazyRegexCompile(numberRegexString) + hexadecimalRegex = lazyRegexCompile(hexadecimalRegexString) + hexColorRegex = lazyRegexCompile(hexColorRegexString) + rgbRegex = lazyRegexCompile(rgbRegexString) + rgbaRegex = lazyRegexCompile(rgbaRegexString) + hslRegex = lazyRegexCompile(hslRegexString) + hslaRegex = lazyRegexCompile(hslaRegexString) + e164Regex = lazyRegexCompile(e164RegexString) + emailRegex = lazyRegexCompile(emailRegexString) + base32Regex = lazyRegexCompile(base32RegexString) + base64Regex = lazyRegexCompile(base64RegexString) + base64URLRegex = lazyRegexCompile(base64URLRegexString) + base64RawURLRegex = lazyRegexCompile(base64RawURLRegexString) + iSBN10Regex = lazyRegexCompile(iSBN10RegexString) + iSBN13Regex = lazyRegexCompile(iSBN13RegexString) + iSSNRegex = lazyRegexCompile(iSSNRegexString) + uUID3Regex = lazyRegexCompile(uUID3RegexString) + uUID4Regex = lazyRegexCompile(uUID4RegexString) + uUID5Regex = lazyRegexCompile(uUID5RegexString) + uUIDRegex = lazyRegexCompile(uUIDRegexString) + uUID3RFC4122Regex = lazyRegexCompile(uUID3RFC4122RegexString) + uUID4RFC4122Regex = lazyRegexCompile(uUID4RFC4122RegexString) + uUID5RFC4122Regex = lazyRegexCompile(uUID5RFC4122RegexString) + uUIDRFC4122Regex = lazyRegexCompile(uUIDRFC4122RegexString) + uLIDRegex = lazyRegexCompile(uLIDRegexString) + md4Regex = lazyRegexCompile(md4RegexString) + md5Regex = lazyRegexCompile(md5RegexString) + sha256Regex = lazyRegexCompile(sha256RegexString) + sha384Regex = lazyRegexCompile(sha384RegexString) + sha512Regex = lazyRegexCompile(sha512RegexString) + ripemd128Regex = lazyRegexCompile(ripemd128RegexString) + ripemd160Regex = lazyRegexCompile(ripemd160RegexString) + tiger128Regex = lazyRegexCompile(tiger128RegexString) + tiger160Regex = lazyRegexCompile(tiger160RegexString) + tiger192Regex = lazyRegexCompile(tiger192RegexString) + aSCIIRegex = lazyRegexCompile(aSCIIRegexString) + printableASCIIRegex = lazyRegexCompile(printableASCIIRegexString) + multibyteRegex = lazyRegexCompile(multibyteRegexString) + dataURIRegex = lazyRegexCompile(dataURIRegexString) + latitudeRegex = lazyRegexCompile(latitudeRegexString) + longitudeRegex = lazyRegexCompile(longitudeRegexString) + sSNRegex = lazyRegexCompile(sSNRegexString) + hostnameRegexRFC952 = lazyRegexCompile(hostnameRegexStringRFC952) + hostnameRegexRFC1123 = lazyRegexCompile(hostnameRegexStringRFC1123) + fqdnRegexRFC1123 = lazyRegexCompile(fqdnRegexStringRFC1123) + btcAddressRegex = lazyRegexCompile(btcAddressRegexString) + btcUpperAddressRegexBech32 = lazyRegexCompile(btcAddressUpperRegexStringBech32) + btcLowerAddressRegexBech32 = lazyRegexCompile(btcAddressLowerRegexStringBech32) + ethAddressRegex = lazyRegexCompile(ethAddressRegexString) + uRLEncodedRegex = lazyRegexCompile(uRLEncodedRegexString) + hTMLEncodedRegex = lazyRegexCompile(hTMLEncodedRegexString) + hTMLRegex = lazyRegexCompile(hTMLRegexString) + jWTRegex = lazyRegexCompile(jWTRegexString) + splitParamsRegex = lazyRegexCompile(splitParamsRegexString) + bicRegex = lazyRegexCompile(bicRegexString) + semverRegex = lazyRegexCompile(semverRegexString) + dnsRegexRFC1035Label = lazyRegexCompile(dnsRegexStringRFC1035Label) + cveRegex = lazyRegexCompile(cveRegexString) + mongodbIdRegex = lazyRegexCompile(mongodbIdRegexString) + mongodbConnectionRegex = lazyRegexCompile(mongodbConnStringRegexString) + cronRegex = lazyRegexCompile(cronRegexString) + spicedbIDRegex = lazyRegexCompile(spicedbIDRegexString) + spicedbPermissionRegex = lazyRegexCompile(spicedbPermissionRegexString) + spicedbTypeRegex = lazyRegexCompile(spicedbTypeRegexString) + einRegex = lazyRegexCompile(einRegexString) +) diff --git a/vendor/github.com/go-playground/validator/v10/struct_level.go b/vendor/github.com/go-playground/validator/v10/struct_level.go new file mode 100644 index 00000000..129b2872 --- /dev/null +++ b/vendor/github.com/go-playground/validator/v10/struct_level.go @@ -0,0 +1,171 @@ +package validator + +import ( + "context" + "reflect" +) + +// StructLevelFunc accepts all values needed for struct level validation +type StructLevelFunc func(sl StructLevel) + +// StructLevelFuncCtx accepts all values needed for struct level validation +// but also allows passing of contextual validation information via context.Context. +type StructLevelFuncCtx func(ctx context.Context, sl StructLevel) + +// wrapStructLevelFunc wraps normal StructLevelFunc makes it compatible with StructLevelFuncCtx +func wrapStructLevelFunc(fn StructLevelFunc) StructLevelFuncCtx { + return func(ctx context.Context, sl StructLevel) { + fn(sl) + } +} + +// StructLevel contains all the information and helper functions +// to validate a struct +type StructLevel interface { + + // Validator returns the main validation object, in case one wants to call validations internally. + // this is so you don't have to use anonymous functions to get access to the validate + // instance. + Validator() *Validate + + // Top returns the top level struct, if any + Top() reflect.Value + + // Parent returns the current fields parent struct, if any + Parent() reflect.Value + + // Current returns the current struct. + Current() reflect.Value + + // ExtractType gets the actual underlying type of field value. + // It will dive into pointers, customTypes and return you the + // underlying value and its kind. + ExtractType(field reflect.Value) (value reflect.Value, kind reflect.Kind, nullable bool) + + // ReportError reports an error just by passing the field and tag information + // + // NOTES: + // + // fieldName and structFieldName get appended to the existing + // namespace that validator is on. e.g. pass 'FirstName' or + // 'Names[0]' depending on the nesting + // + // tag can be an existing validation tag or just something you make up + // and process on the flip side it's up to you. + ReportError(field interface{}, fieldName, structFieldName string, tag, param string) + + // ReportValidationErrors reports an error just by passing ValidationErrors + // + // NOTES: + // + // relativeNamespace and relativeActualNamespace get appended to the + // existing namespace that validator is on. + // e.g. pass 'User.FirstName' or 'Users[0].FirstName' depending + // on the nesting. most of the time they will be blank, unless you validate + // at a level lower the current field depth + ReportValidationErrors(relativeNamespace, relativeActualNamespace string, errs ValidationErrors) +} + +var _ StructLevel = new(validate) + +// Top returns the top level struct +// +// NOTE: this can be the same as the current struct being validated +// if not is a nested struct. +// +// this is only called when within Struct and Field Level validation and +// should not be relied upon for an accurate value otherwise. +func (v *validate) Top() reflect.Value { + return v.top +} + +// Parent returns the current structs parent +// +// NOTE: this can be the same as the current struct being validated +// if not is a nested struct. +// +// this is only called when within Struct and Field Level validation and +// should not be relied upon for an accurate value otherwise. +func (v *validate) Parent() reflect.Value { + return v.slflParent +} + +// Current returns the current struct. +func (v *validate) Current() reflect.Value { + return v.slCurrent +} + +// Validator returns the main validation object, in case one want to call validations internally. +func (v *validate) Validator() *Validate { + return v.v +} + +// ExtractType gets the actual underlying type of field value. +func (v *validate) ExtractType(field reflect.Value) (reflect.Value, reflect.Kind, bool) { + return v.extractTypeInternal(field, false) +} + +// ReportError reports an error just by passing the field and tag information +func (v *validate) ReportError(field interface{}, fieldName, structFieldName, tag, param string) { + fv, kind, _ := v.extractTypeInternal(reflect.ValueOf(field), false) + + if len(structFieldName) == 0 { + structFieldName = fieldName + } + + v.str1 = string(append(v.ns, fieldName...)) + + if v.v.hasTagNameFunc || fieldName != structFieldName { + v.str2 = string(append(v.actualNs, structFieldName...)) + } else { + v.str2 = v.str1 + } + + if kind == reflect.Invalid { + v.errs = append(v.errs, + &fieldError{ + v: v.v, + tag: tag, + actualTag: tag, + ns: v.str1, + structNs: v.str2, + fieldLen: uint8(len(fieldName)), + structfieldLen: uint8(len(structFieldName)), + param: param, + kind: kind, + }, + ) + return + } + + v.errs = append(v.errs, + &fieldError{ + v: v.v, + tag: tag, + actualTag: tag, + ns: v.str1, + structNs: v.str2, + fieldLen: uint8(len(fieldName)), + structfieldLen: uint8(len(structFieldName)), + value: getValue(fv), + param: param, + kind: kind, + typ: fv.Type(), + }, + ) +} + +// ReportValidationErrors reports ValidationErrors obtained from running validations within the Struct Level validation. +// +// NOTE: this function prepends the current namespace to the relative ones. +func (v *validate) ReportValidationErrors(relativeNamespace, relativeStructNamespace string, errs ValidationErrors) { + var err *fieldError + + for i := 0; i < len(errs); i++ { + err = errs[i].(*fieldError) + err.ns = string(append(append(v.ns, relativeNamespace...), err.ns...)) + err.structNs = string(append(append(v.actualNs, relativeStructNamespace...), err.structNs...)) + + v.errs = append(v.errs, err) + } +} diff --git a/vendor/github.com/go-playground/validator/v10/translations.go b/vendor/github.com/go-playground/validator/v10/translations.go new file mode 100644 index 00000000..4d9d75c1 --- /dev/null +++ b/vendor/github.com/go-playground/validator/v10/translations.go @@ -0,0 +1,11 @@ +package validator + +import ut "github.com/go-playground/universal-translator" + +// TranslationFunc is the function type used to register or override +// custom translations +type TranslationFunc func(ut ut.Translator, fe FieldError) string + +// RegisterTranslationsFunc allows for registering of translations +// for a 'ut.Translator' for use within the 'TranslationFunc' +type RegisterTranslationsFunc func(ut ut.Translator) error diff --git a/vendor/github.com/go-playground/validator/v10/util.go b/vendor/github.com/go-playground/validator/v10/util.go new file mode 100644 index 00000000..b1fd8cc1 --- /dev/null +++ b/vendor/github.com/go-playground/validator/v10/util.go @@ -0,0 +1,305 @@ +package validator + +import ( + "fmt" + "reflect" + "regexp" + "strconv" + "strings" + "time" +) + +// extractTypeInternal gets the actual underlying type of field value. +// It will dive into pointers, customTypes and return you the +// underlying value and it's kind. +func (v *validate) extractTypeInternal(current reflect.Value, nullable bool) (reflect.Value, reflect.Kind, bool) { +BEGIN: + switch current.Kind() { + case reflect.Ptr: + + nullable = true + + if current.IsNil() { + return current, reflect.Ptr, nullable + } + + current = current.Elem() + goto BEGIN + + case reflect.Interface: + + nullable = true + + if current.IsNil() { + return current, reflect.Interface, nullable + } + + current = current.Elem() + goto BEGIN + + case reflect.Invalid: + return current, reflect.Invalid, nullable + + default: + + if v.v.hasCustomFuncs { + if fn, ok := v.v.customFuncs[current.Type()]; ok { + current = reflect.ValueOf(fn(current)) + goto BEGIN + } + } + + return current, current.Kind(), nullable + } +} + +// getStructFieldOKInternal traverses a struct to retrieve a specific field denoted by the provided namespace and +// returns the field, field kind and whether is was successful in retrieving the field at all. +// +// NOTE: when not successful ok will be false, this can happen when a nested struct is nil and so the field +// could not be retrieved because it didn't exist. +func (v *validate) getStructFieldOKInternal(val reflect.Value, namespace string) (current reflect.Value, kind reflect.Kind, nullable bool, found bool) { +BEGIN: + current, kind, nullable = v.ExtractType(val) + if kind == reflect.Invalid { + return + } + + if namespace == "" { + found = true + return + } + + switch kind { + case reflect.Ptr, reflect.Interface: + return + + case reflect.Struct: + + typ := current.Type() + fld := namespace + var ns string + + if !typ.ConvertibleTo(timeType) { + idx := strings.Index(namespace, namespaceSeparator) + + if idx != -1 { + fld = namespace[:idx] + ns = namespace[idx+1:] + } else { + ns = "" + } + + bracketIdx := strings.Index(fld, leftBracket) + if bracketIdx != -1 { + fld = fld[:bracketIdx] + + ns = namespace[bracketIdx:] + } + + val = current.FieldByName(fld) + namespace = ns + goto BEGIN + } + + case reflect.Array, reflect.Slice: + idx := strings.Index(namespace, leftBracket) + idx2 := strings.Index(namespace, rightBracket) + + arrIdx, _ := strconv.Atoi(namespace[idx+1 : idx2]) + + if arrIdx >= current.Len() { + return + } + + startIdx := idx2 + 1 + + if startIdx < len(namespace) { + if namespace[startIdx:startIdx+1] == namespaceSeparator { + startIdx++ + } + } + + val = current.Index(arrIdx) + namespace = namespace[startIdx:] + goto BEGIN + + case reflect.Map: + idx := strings.Index(namespace, leftBracket) + 1 + idx2 := strings.Index(namespace, rightBracket) + + endIdx := idx2 + + if endIdx+1 < len(namespace) { + if namespace[endIdx+1:endIdx+2] == namespaceSeparator { + endIdx++ + } + } + + key := namespace[idx:idx2] + + switch current.Type().Key().Kind() { + case reflect.Int: + i, _ := strconv.Atoi(key) + val = current.MapIndex(reflect.ValueOf(i)) + namespace = namespace[endIdx+1:] + + case reflect.Int8: + i, _ := strconv.ParseInt(key, 10, 8) + val = current.MapIndex(reflect.ValueOf(int8(i))) + namespace = namespace[endIdx+1:] + + case reflect.Int16: + i, _ := strconv.ParseInt(key, 10, 16) + val = current.MapIndex(reflect.ValueOf(int16(i))) + namespace = namespace[endIdx+1:] + + case reflect.Int32: + i, _ := strconv.ParseInt(key, 10, 32) + val = current.MapIndex(reflect.ValueOf(int32(i))) + namespace = namespace[endIdx+1:] + + case reflect.Int64: + i, _ := strconv.ParseInt(key, 10, 64) + val = current.MapIndex(reflect.ValueOf(i)) + namespace = namespace[endIdx+1:] + + case reflect.Uint: + i, _ := strconv.ParseUint(key, 10, 0) + val = current.MapIndex(reflect.ValueOf(uint(i))) + namespace = namespace[endIdx+1:] + + case reflect.Uint8: + i, _ := strconv.ParseUint(key, 10, 8) + val = current.MapIndex(reflect.ValueOf(uint8(i))) + namespace = namespace[endIdx+1:] + + case reflect.Uint16: + i, _ := strconv.ParseUint(key, 10, 16) + val = current.MapIndex(reflect.ValueOf(uint16(i))) + namespace = namespace[endIdx+1:] + + case reflect.Uint32: + i, _ := strconv.ParseUint(key, 10, 32) + val = current.MapIndex(reflect.ValueOf(uint32(i))) + namespace = namespace[endIdx+1:] + + case reflect.Uint64: + i, _ := strconv.ParseUint(key, 10, 64) + val = current.MapIndex(reflect.ValueOf(i)) + namespace = namespace[endIdx+1:] + + case reflect.Float32: + f, _ := strconv.ParseFloat(key, 32) + val = current.MapIndex(reflect.ValueOf(float32(f))) + namespace = namespace[endIdx+1:] + + case reflect.Float64: + f, _ := strconv.ParseFloat(key, 64) + val = current.MapIndex(reflect.ValueOf(f)) + namespace = namespace[endIdx+1:] + + case reflect.Bool: + b, _ := strconv.ParseBool(key) + val = current.MapIndex(reflect.ValueOf(b)) + namespace = namespace[endIdx+1:] + + // reflect.Type = string + default: + val = current.MapIndex(reflect.ValueOf(key)) + namespace = namespace[endIdx+1:] + } + + goto BEGIN + } + + // if got here there was more namespace, cannot go any deeper + panic("Invalid field namespace") +} + +// asInt returns the parameter as an int64 +// or panics if it can't convert +func asInt(param string) int64 { + i, err := strconv.ParseInt(param, 0, 64) + panicIf(err) + + return i +} + +// asIntFromTimeDuration parses param as time.Duration and returns it as int64 +// or panics on error. +func asIntFromTimeDuration(param string) int64 { + d, err := time.ParseDuration(param) + if err != nil { + // attempt parsing as an integer assuming nanosecond precision + return asInt(param) + } + return int64(d) +} + +// asIntFromType calls the proper function to parse param as int64, +// given a field's Type t. +func asIntFromType(t reflect.Type, param string) int64 { + switch t { + case timeDurationType: + return asIntFromTimeDuration(param) + default: + return asInt(param) + } +} + +// asUint returns the parameter as a uint64 +// or panics if it can't convert +func asUint(param string) uint64 { + i, err := strconv.ParseUint(param, 0, 64) + panicIf(err) + + return i +} + +// asFloat64 returns the parameter as a float64 +// or panics if it can't convert +func asFloat64(param string) float64 { + i, err := strconv.ParseFloat(param, 64) + panicIf(err) + return i +} + +// asFloat32 returns the parameter as a float32 +// or panics if it can't convert +func asFloat32(param string) float64 { + i, err := strconv.ParseFloat(param, 32) + panicIf(err) + return i +} + +// asBool returns the parameter as a bool +// or panics if it can't convert +func asBool(param string) bool { + i, err := strconv.ParseBool(param) + panicIf(err) + + return i +} + +func panicIf(err error) { + if err != nil { + panic(err.Error()) + } +} + +// Checks if field value matches regex. If fl.Field can be cast to Stringer, it uses the Stringer interfaces +// String() return value. Otherwise, it uses fl.Field's String() value. +func fieldMatchesRegexByStringerValOrString(regexFn func() *regexp.Regexp, fl FieldLevel) bool { + regex := regexFn() + switch fl.Field().Kind() { + case reflect.String: + return regex.MatchString(fl.Field().String()) + default: + if stringer, ok := getValue(fl.Field()).(fmt.Stringer); ok { + return regex.MatchString(stringer.String()) + } else { + return regex.MatchString(fl.Field().String()) + } + } +} diff --git a/vendor/github.com/go-playground/validator/v10/validator.go b/vendor/github.com/go-playground/validator/v10/validator.go new file mode 100644 index 00000000..995b0e19 --- /dev/null +++ b/vendor/github.com/go-playground/validator/v10/validator.go @@ -0,0 +1,523 @@ +package validator + +import ( + "context" + "fmt" + "reflect" + "strconv" + "unsafe" +) + +// per validate construct +type validate struct { + v *Validate + top reflect.Value + ns []byte + actualNs []byte + errs ValidationErrors + includeExclude map[string]struct{} // reset only if StructPartial or StructExcept are called, no need otherwise + ffn FilterFunc + slflParent reflect.Value // StructLevel & FieldLevel + slCurrent reflect.Value // StructLevel & FieldLevel + flField reflect.Value // StructLevel & FieldLevel + cf *cField // StructLevel & FieldLevel + ct *cTag // StructLevel & FieldLevel + misc []byte // misc reusable + str1 string // misc reusable + str2 string // misc reusable + fldIsPointer bool // StructLevel & FieldLevel + isPartial bool + hasExcludes bool +} + +// parent and current will be the same the first run of validateStruct +func (v *validate) validateStruct(ctx context.Context, parent reflect.Value, current reflect.Value, typ reflect.Type, ns []byte, structNs []byte, ct *cTag) { + cs, ok := v.v.structCache.Get(typ) + if !ok { + cs = v.v.extractStructCache(current, typ.Name()) + } + + if len(ns) == 0 && len(cs.name) != 0 { + ns = append(ns, cs.name...) + ns = append(ns, '.') + + structNs = append(structNs, cs.name...) + structNs = append(structNs, '.') + } + + // ct is nil on top level struct, and structs as fields that have no tag info + // so if nil or if not nil and the structonly tag isn't present + if ct == nil || ct.typeof != typeStructOnly { + var f *cField + + for i := 0; i < len(cs.fields); i++ { + f = cs.fields[i] + + if v.isPartial { + if v.ffn != nil { + // used with StructFiltered + if v.ffn(append(structNs, f.name...)) { + continue + } + } else { + // used with StructPartial & StructExcept + _, ok = v.includeExclude[string(append(structNs, f.name...))] + + if (ok && v.hasExcludes) || (!ok && !v.hasExcludes) { + continue + } + } + } + + v.traverseField(ctx, current, current.Field(f.idx), ns, structNs, f, f.cTags) + } + } + + // check if any struct level validations, after all field validations already checked. + // first iteration will have no info about nostructlevel tag, and is checked prior to + // calling the next iteration of validateStruct called from traverseField. + if cs.fn != nil { + v.slflParent = parent + v.slCurrent = current + v.ns = ns + v.actualNs = structNs + + cs.fn(ctx, v) + } +} + +// traverseField validates any field, be it a struct or single field, ensures it's validity and passes it along to be validated via it's tag options +func (v *validate) traverseField(ctx context.Context, parent reflect.Value, current reflect.Value, ns []byte, structNs []byte, cf *cField, ct *cTag) { + var typ reflect.Type + var kind reflect.Kind + + current, kind, v.fldIsPointer = v.extractTypeInternal(current, false) + + var isNestedStruct bool + + switch kind { + case reflect.Ptr, reflect.Interface, reflect.Invalid: + + if ct == nil { + return + } + + if ct.typeof == typeOmitEmpty || ct.typeof == typeIsDefault { + return + } + + if ct.typeof == typeOmitNil && (kind != reflect.Invalid && current.IsNil()) { + return + } + + if ct.typeof == typeOmitZero { + return + } + + if ct.hasTag { + if kind == reflect.Invalid { + v.str1 = string(append(ns, cf.altName...)) + if v.v.hasTagNameFunc { + v.str2 = string(append(structNs, cf.name...)) + } else { + v.str2 = v.str1 + } + v.errs = append(v.errs, + &fieldError{ + v: v.v, + tag: ct.aliasTag, + actualTag: ct.tag, + ns: v.str1, + structNs: v.str2, + fieldLen: uint8(len(cf.altName)), + structfieldLen: uint8(len(cf.name)), + param: ct.param, + kind: kind, + }, + ) + return + } + + v.str1 = string(append(ns, cf.altName...)) + if v.v.hasTagNameFunc { + v.str2 = string(append(structNs, cf.name...)) + } else { + v.str2 = v.str1 + } + if !ct.runValidationWhenNil { + v.errs = append(v.errs, + &fieldError{ + v: v.v, + tag: ct.aliasTag, + actualTag: ct.tag, + ns: v.str1, + structNs: v.str2, + fieldLen: uint8(len(cf.altName)), + structfieldLen: uint8(len(cf.name)), + value: getValue(current), + param: ct.param, + kind: kind, + typ: current.Type(), + }, + ) + return + } + } + + if kind == reflect.Invalid { + return + } + + case reflect.Struct: + isNestedStruct = !current.Type().ConvertibleTo(timeType) + // For backward compatibility before struct level validation tags were supported + // as there were a number of projects relying on `required` not failing on non-pointer + // structs. Since it's basically nonsensical to use `required` with a non-pointer struct + // are explicitly skipping the required validation for it. This WILL be removed in the + // next major version. + if isNestedStruct && !v.v.requiredStructEnabled && ct != nil && ct.tag == requiredTag { + ct = ct.next + } + } + + typ = current.Type() + +OUTER: + for { + if ct == nil || !ct.hasTag || (isNestedStruct && len(cf.name) == 0) { + // isNestedStruct check here + if isNestedStruct { + // if len == 0 then validating using 'Var' or 'VarWithValue' + // Var - doesn't make much sense to do it that way, should call 'Struct', but no harm... + // VarWithField - this allows for validating against each field within the struct against a specific value + // pretty handy in certain situations + if len(cf.name) > 0 { + ns = append(append(ns, cf.altName...), '.') + structNs = append(append(structNs, cf.name...), '.') + } + + v.validateStruct(ctx, parent, current, typ, ns, structNs, ct) + } + return + } + + switch ct.typeof { + case typeNoStructLevel: + return + + case typeStructOnly: + if isNestedStruct { + // if len == 0 then validating using 'Var' or 'VarWithValue' + // Var - doesn't make much sense to do it that way, should call 'Struct', but no harm... + // VarWithField - this allows for validating against each field within the struct against a specific value + // pretty handy in certain situations + if len(cf.name) > 0 { + ns = append(append(ns, cf.altName...), '.') + structNs = append(append(structNs, cf.name...), '.') + } + + v.validateStruct(ctx, parent, current, typ, ns, structNs, ct) + } + return + + case typeOmitEmpty: + + // set Field Level fields + v.slflParent = parent + v.flField = current + v.cf = cf + v.ct = ct + + if !hasValue(v) { + return + } + + ct = ct.next + continue + + case typeOmitZero: + v.slflParent = parent + v.flField = current + v.cf = cf + v.ct = ct + + if !hasNotZeroValue(v) { + return + } + + ct = ct.next + continue + + case typeOmitNil: + v.slflParent = parent + v.flField = current + v.cf = cf + v.ct = ct + + switch field := v.Field(); field.Kind() { + case reflect.Slice, reflect.Map, reflect.Ptr, reflect.Interface, reflect.Chan, reflect.Func: + if field.IsNil() { + return + } + default: + if v.fldIsPointer && getValue(field) == nil { + return + } + } + + ct = ct.next + continue + + case typeEndKeys: + return + + case typeDive: + + ct = ct.next + + // traverse slice or map here + // or panic ;) + switch kind { + case reflect.Slice, reflect.Array: + + var i64 int64 + reusableCF := &cField{} + + for i := 0; i < current.Len(); i++ { + i64 = int64(i) + + v.misc = append(v.misc[0:0], cf.name...) + v.misc = append(v.misc, '[') + v.misc = strconv.AppendInt(v.misc, i64, 10) + v.misc = append(v.misc, ']') + + reusableCF.name = string(v.misc) + + if cf.namesEqual { + reusableCF.altName = reusableCF.name + } else { + v.misc = append(v.misc[0:0], cf.altName...) + v.misc = append(v.misc, '[') + v.misc = strconv.AppendInt(v.misc, i64, 10) + v.misc = append(v.misc, ']') + + reusableCF.altName = string(v.misc) + } + v.traverseField(ctx, parent, current.Index(i), ns, structNs, reusableCF, ct) + } + + case reflect.Map: + + var pv string + reusableCF := &cField{} + + for _, key := range current.MapKeys() { + pv = fmt.Sprintf("%v", key) + + v.misc = append(v.misc[0:0], cf.name...) + v.misc = append(v.misc, '[') + v.misc = append(v.misc, pv...) + v.misc = append(v.misc, ']') + + reusableCF.name = string(v.misc) + + if cf.namesEqual { + reusableCF.altName = reusableCF.name + } else { + v.misc = append(v.misc[0:0], cf.altName...) + v.misc = append(v.misc, '[') + v.misc = append(v.misc, pv...) + v.misc = append(v.misc, ']') + + reusableCF.altName = string(v.misc) + } + + if ct != nil && ct.typeof == typeKeys && ct.keys != nil { + v.traverseField(ctx, parent, key, ns, structNs, reusableCF, ct.keys) + // can be nil when just keys being validated + if ct.next != nil { + v.traverseField(ctx, parent, current.MapIndex(key), ns, structNs, reusableCF, ct.next) + } else { + // Struct fallback when map values are structs + val := current.MapIndex(key) + switch val.Kind() { + case reflect.Ptr: + if val.Elem().Kind() == reflect.Struct { + // Dive into the struct so its own tags run + v.traverseField(ctx, parent, val, ns, structNs, reusableCF, nil) + } + case reflect.Struct: + v.traverseField(ctx, parent, val, ns, structNs, reusableCF, nil) + } + } + } else { + v.traverseField(ctx, parent, current.MapIndex(key), ns, structNs, reusableCF, ct) + } + } + + default: + // throw error, if not a slice or map then should not have gotten here + // bad dive tag + panic("dive error! can't dive on a non slice or map") + } + + return + + case typeOr: + + v.misc = v.misc[0:0] + + for { + // set Field Level fields + v.slflParent = parent + v.flField = current + v.cf = cf + v.ct = ct + + if ct.fn(ctx, v) { + if ct.isBlockEnd { + ct = ct.next + continue OUTER + } + + // drain rest of the 'or' values, then continue or leave + for { + ct = ct.next + + if ct == nil { + continue OUTER + } + + if ct.typeof != typeOr { + continue OUTER + } + + if ct.isBlockEnd { + ct = ct.next + continue OUTER + } + } + } + + v.misc = append(v.misc, '|') + v.misc = append(v.misc, ct.tag...) + + if ct.hasParam { + v.misc = append(v.misc, '=') + v.misc = append(v.misc, ct.param...) + } + + if ct.isBlockEnd || ct.next == nil { + // if we get here, no valid 'or' value and no more tags + v.str1 = string(append(ns, cf.altName...)) + + if v.v.hasTagNameFunc { + v.str2 = string(append(structNs, cf.name...)) + } else { + v.str2 = v.str1 + } + + if ct.hasAlias { + v.errs = append(v.errs, + &fieldError{ + v: v.v, + tag: ct.aliasTag, + actualTag: ct.actualAliasTag, + ns: v.str1, + structNs: v.str2, + fieldLen: uint8(len(cf.altName)), + structfieldLen: uint8(len(cf.name)), + value: getValue(current), + param: ct.param, + kind: kind, + typ: typ, + }, + ) + } else { + tVal := string(v.misc)[1:] + + v.errs = append(v.errs, + &fieldError{ + v: v.v, + tag: tVal, + actualTag: tVal, + ns: v.str1, + structNs: v.str2, + fieldLen: uint8(len(cf.altName)), + structfieldLen: uint8(len(cf.name)), + value: getValue(current), + param: ct.param, + kind: kind, + typ: typ, + }, + ) + } + + return + } + + ct = ct.next + } + + default: + + // set Field Level fields + v.slflParent = parent + v.flField = current + v.cf = cf + v.ct = ct + + if !ct.fn(ctx, v) { + v.str1 = string(append(ns, cf.altName...)) + + if v.v.hasTagNameFunc { + v.str2 = string(append(structNs, cf.name...)) + } else { + v.str2 = v.str1 + } + + v.errs = append(v.errs, + &fieldError{ + v: v.v, + tag: ct.aliasTag, + actualTag: ct.tag, + ns: v.str1, + structNs: v.str2, + fieldLen: uint8(len(cf.altName)), + structfieldLen: uint8(len(cf.name)), + value: getValue(current), + param: ct.param, + kind: kind, + typ: typ, + }, + ) + + return + } + ct = ct.next + } + } +} + +func getValue(val reflect.Value) interface{} { + if val.CanInterface() { + return val.Interface() + } + + if val.CanAddr() { + return reflect.NewAt(val.Type(), unsafe.Pointer(val.UnsafeAddr())).Elem().Interface() + } + + switch val.Kind() { + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + return val.Int() + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: + return val.Uint() + case reflect.Complex64, reflect.Complex128: + return val.Complex() + case reflect.Float32, reflect.Float64: + return val.Float() + default: + return val.String() + } +} diff --git a/vendor/github.com/go-playground/validator/v10/validator_instance.go b/vendor/github.com/go-playground/validator/v10/validator_instance.go new file mode 100644 index 00000000..9362cd73 --- /dev/null +++ b/vendor/github.com/go-playground/validator/v10/validator_instance.go @@ -0,0 +1,699 @@ +package validator + +import ( + "context" + "errors" + "fmt" + "reflect" + "strings" + "sync" + "time" + + ut "github.com/go-playground/universal-translator" +) + +const ( + defaultTagName = "validate" + utf8HexComma = "0x2C" + utf8Pipe = "0x7C" + tagSeparator = "," + orSeparator = "|" + tagKeySeparator = "=" + structOnlyTag = "structonly" + noStructLevelTag = "nostructlevel" + omitzero = "omitzero" + omitempty = "omitempty" + omitnil = "omitnil" + isdefault = "isdefault" + requiredWithoutAllTag = "required_without_all" + requiredWithoutTag = "required_without" + requiredWithTag = "required_with" + requiredWithAllTag = "required_with_all" + requiredIfTag = "required_if" + requiredUnlessTag = "required_unless" + skipUnlessTag = "skip_unless" + excludedWithoutAllTag = "excluded_without_all" + excludedWithoutTag = "excluded_without" + excludedWithTag = "excluded_with" + excludedWithAllTag = "excluded_with_all" + excludedIfTag = "excluded_if" + excludedUnlessTag = "excluded_unless" + skipValidationTag = "-" + diveTag = "dive" + keysTag = "keys" + endKeysTag = "endkeys" + requiredTag = "required" + namespaceSeparator = "." + leftBracket = "[" + rightBracket = "]" + restrictedTagChars = ".[],|=+()`~!@#$%^&*\\\"/?<>{}" + restrictedAliasErr = "Alias '%s' either contains restricted characters or is the same as a restricted tag needed for normal operation" + restrictedTagErr = "Tag '%s' either contains restricted characters or is the same as a restricted tag needed for normal operation" +) + +var ( + timeDurationType = reflect.TypeOf(time.Duration(0)) + timeType = reflect.TypeOf(time.Time{}) + + byteSliceType = reflect.TypeOf([]byte{}) + + defaultCField = &cField{namesEqual: true} +) + +// FilterFunc is the type used to filter fields using +// StructFiltered(...) function. +// returning true results in the field being filtered/skipped from +// validation +type FilterFunc func(ns []byte) bool + +// CustomTypeFunc allows for overriding or adding custom field type handler functions +// field = field value of the type to return a value to be validated +// example Valuer from sql drive see https://golang.org/src/database/sql/driver/types.go?s=1210:1293#L29 +type CustomTypeFunc func(field reflect.Value) interface{} + +// TagNameFunc allows for adding of a custom tag name parser +type TagNameFunc func(field reflect.StructField) string + +type internalValidationFuncWrapper struct { + fn FuncCtx + runValidationOnNil bool +} + +// Validate contains the validator settings and cache +type Validate struct { + tagName string + pool *sync.Pool + tagNameFunc TagNameFunc + structLevelFuncs map[reflect.Type]StructLevelFuncCtx + customFuncs map[reflect.Type]CustomTypeFunc + aliases map[string]string + validations map[string]internalValidationFuncWrapper + transTagFunc map[ut.Translator]map[string]TranslationFunc // map[]map[]TranslationFunc + rules map[reflect.Type]map[string]string + tagCache *tagCache + structCache *structCache + hasCustomFuncs bool + hasTagNameFunc bool + requiredStructEnabled bool + privateFieldValidation bool +} + +// New returns a new instance of 'validate' with sane defaults. +// Validate is designed to be thread-safe and used as a singleton instance. +// It caches information about your struct and validations, +// in essence only parsing your validation tags once per struct type. +// Using multiple instances neglects the benefit of caching. +func New(options ...Option) *Validate { + tc := new(tagCache) + tc.m.Store(make(map[string]*cTag)) + + sc := new(structCache) + sc.m.Store(make(map[reflect.Type]*cStruct)) + + v := &Validate{ + tagName: defaultTagName, + aliases: make(map[string]string, len(bakedInAliases)), + validations: make(map[string]internalValidationFuncWrapper, len(bakedInValidators)), + tagCache: tc, + structCache: sc, + } + + // must copy alias validators for separate validations to be used in each validator instance + for k, val := range bakedInAliases { + v.RegisterAlias(k, val) + } + + // must copy validators for separate validations to be used in each instance + for k, val := range bakedInValidators { + switch k { + // these require that even if the value is nil that the validation should run, omitempty still overrides this behaviour + case requiredIfTag, requiredUnlessTag, requiredWithTag, requiredWithAllTag, requiredWithoutTag, requiredWithoutAllTag, + excludedIfTag, excludedUnlessTag, excludedWithTag, excludedWithAllTag, excludedWithoutTag, excludedWithoutAllTag, + skipUnlessTag: + _ = v.registerValidation(k, wrapFunc(val), true, true) + default: + // no need to error check here, baked in will always be valid + _ = v.registerValidation(k, wrapFunc(val), true, false) + } + } + + v.pool = &sync.Pool{ + New: func() interface{} { + return &validate{ + v: v, + ns: make([]byte, 0, 64), + actualNs: make([]byte, 0, 64), + misc: make([]byte, 32), + } + }, + } + + for _, o := range options { + o(v) + } + return v +} + +// SetTagName allows for changing of the default tag name of 'validate' +func (v *Validate) SetTagName(name string) { + v.tagName = name +} + +// ValidateMapCtx validates a map using a map of validation rules and allows passing of contextual +// validation information via context.Context. +func (v Validate) ValidateMapCtx(ctx context.Context, data map[string]interface{}, rules map[string]interface{}) map[string]interface{} { + errs := make(map[string]interface{}) + for field, rule := range rules { + if ruleObj, ok := rule.(map[string]interface{}); ok { + if dataObj, ok := data[field].(map[string]interface{}); ok { + err := v.ValidateMapCtx(ctx, dataObj, ruleObj) + if len(err) > 0 { + errs[field] = err + } + } else if dataObjs, ok := data[field].([]map[string]interface{}); ok { + for _, obj := range dataObjs { + err := v.ValidateMapCtx(ctx, obj, ruleObj) + if len(err) > 0 { + errs[field] = err + } + } + } else { + errs[field] = errors.New("The field: '" + field + "' is not a map to dive") + } + } else if ruleStr, ok := rule.(string); ok { + err := v.VarCtx(ctx, data[field], ruleStr) + if err != nil { + errs[field] = err + } + } + } + return errs +} + +// ValidateMap validates map data from a map of tags +func (v *Validate) ValidateMap(data map[string]interface{}, rules map[string]interface{}) map[string]interface{} { + return v.ValidateMapCtx(context.Background(), data, rules) +} + +// RegisterTagNameFunc registers a function to get alternate names for StructFields. +// +// eg. to use the names which have been specified for JSON representations of structs, rather than normal Go field names: +// +// validate.RegisterTagNameFunc(func(fld reflect.StructField) string { +// name := strings.SplitN(fld.Tag.Get("json"), ",", 2)[0] +// // skip if tag key says it should be ignored +// if name == "-" { +// return "" +// } +// return name +// }) +func (v *Validate) RegisterTagNameFunc(fn TagNameFunc) { + v.tagNameFunc = fn + v.hasTagNameFunc = true +} + +// RegisterValidation adds a validation with the given tag +// +// NOTES: +// - if the key already exists, the previous validation function will be replaced. +// - this method is not thread-safe it is intended that these all be registered prior to any validation +func (v *Validate) RegisterValidation(tag string, fn Func, callValidationEvenIfNull ...bool) error { + return v.RegisterValidationCtx(tag, wrapFunc(fn), callValidationEvenIfNull...) +} + +// RegisterValidationCtx does the same as RegisterValidation on accepts a FuncCtx validation +// allowing context.Context validation support. +func (v *Validate) RegisterValidationCtx(tag string, fn FuncCtx, callValidationEvenIfNull ...bool) error { + var nilCheckable bool + if len(callValidationEvenIfNull) > 0 { + nilCheckable = callValidationEvenIfNull[0] + } + return v.registerValidation(tag, fn, false, nilCheckable) +} + +// RegisterAlias registers a mapping of a single validation tag that +// defines a common or complex set of validation(s) to simplify adding validation +// to structs. +// +// NOTE: this function is not thread-safe it is intended that these all be registered prior to any validation +func (v *Validate) RegisterAlias(alias, tags string) { + _, ok := restrictedTags[alias] + + if ok || strings.ContainsAny(alias, restrictedTagChars) { + panic(fmt.Sprintf(restrictedAliasErr, alias)) + } + + v.aliases[alias] = tags +} + +// RegisterStructValidation registers a StructLevelFunc against a number of types. +// +// NOTE: +// - this method is not thread-safe it is intended that these all be registered prior to any validation +func (v *Validate) RegisterStructValidation(fn StructLevelFunc, types ...interface{}) { + v.RegisterStructValidationCtx(wrapStructLevelFunc(fn), types...) +} + +// RegisterStructValidationCtx registers a StructLevelFuncCtx against a number of types and allows passing +// of contextual validation information via context.Context. +// +// NOTE: +// - this method is not thread-safe it is intended that these all be registered prior to any validation +func (v *Validate) RegisterStructValidationCtx(fn StructLevelFuncCtx, types ...interface{}) { + if v.structLevelFuncs == nil { + v.structLevelFuncs = make(map[reflect.Type]StructLevelFuncCtx) + } + + for _, t := range types { + tv := reflect.ValueOf(t) + if tv.Kind() == reflect.Ptr { + t = reflect.Indirect(tv).Interface() + } + + v.structLevelFuncs[reflect.TypeOf(t)] = fn + } +} + +// RegisterStructValidationMapRules registers validate map rules. +// Be aware that map validation rules supersede those defined on a/the struct if present. +// +// NOTE: this method is not thread-safe it is intended that these all be registered prior to any validation +func (v *Validate) RegisterStructValidationMapRules(rules map[string]string, types ...interface{}) { + if v.rules == nil { + v.rules = make(map[reflect.Type]map[string]string) + } + + deepCopyRules := make(map[string]string) + for i, rule := range rules { + deepCopyRules[i] = rule + } + + for _, t := range types { + typ := reflect.TypeOf(t) + + if typ.Kind() == reflect.Ptr { + typ = typ.Elem() + } + + if typ.Kind() != reflect.Struct { + continue + } + v.rules[typ] = deepCopyRules + } +} + +// RegisterCustomTypeFunc registers a CustomTypeFunc against a number of types +// +// NOTE: this method is not thread-safe it is intended that these all be registered prior to any validation +func (v *Validate) RegisterCustomTypeFunc(fn CustomTypeFunc, types ...interface{}) { + if v.customFuncs == nil { + v.customFuncs = make(map[reflect.Type]CustomTypeFunc) + } + + for _, t := range types { + v.customFuncs[reflect.TypeOf(t)] = fn + } + + v.hasCustomFuncs = true +} + +// RegisterTranslation registers translations against the provided tag. +func (v *Validate) RegisterTranslation(tag string, trans ut.Translator, registerFn RegisterTranslationsFunc, translationFn TranslationFunc) (err error) { + if v.transTagFunc == nil { + v.transTagFunc = make(map[ut.Translator]map[string]TranslationFunc) + } + + if err = registerFn(trans); err != nil { + return + } + + m, ok := v.transTagFunc[trans] + if !ok { + m = make(map[string]TranslationFunc) + v.transTagFunc[trans] = m + } + + m[tag] = translationFn + + return +} + +// Struct validates a structs exposed fields, and automatically validates nested structs, unless otherwise specified. +// +// It returns InvalidValidationError for bad values passed in and nil or ValidationErrors as error otherwise. +// You will need to assert the error if it's not nil eg. err.(validator.ValidationErrors) to access the array of errors. +func (v *Validate) Struct(s interface{}) error { + return v.StructCtx(context.Background(), s) +} + +// StructCtx validates a structs exposed fields, and automatically validates nested structs, unless otherwise specified +// and also allows passing of context.Context for contextual validation information. +// +// It returns InvalidValidationError for bad values passed in and nil or ValidationErrors as error otherwise. +// You will need to assert the error if it's not nil eg. err.(validator.ValidationErrors) to access the array of errors. +func (v *Validate) StructCtx(ctx context.Context, s interface{}) (err error) { + val := reflect.ValueOf(s) + top := val + + if val.Kind() == reflect.Ptr && !val.IsNil() { + val = val.Elem() + } + + if val.Kind() != reflect.Struct || val.Type().ConvertibleTo(timeType) { + return &InvalidValidationError{Type: reflect.TypeOf(s)} + } + + // good to validate + vd := v.pool.Get().(*validate) + vd.top = top + vd.isPartial = false + // vd.hasExcludes = false // only need to reset in StructPartial and StructExcept + + vd.validateStruct(ctx, top, val, val.Type(), vd.ns[0:0], vd.actualNs[0:0], nil) + + if len(vd.errs) > 0 { + err = vd.errs + vd.errs = nil + } + + v.pool.Put(vd) + + return +} + +// StructFiltered validates a structs exposed fields, that pass the FilterFunc check and automatically validates +// nested structs, unless otherwise specified. +// +// It returns InvalidValidationError for bad values passed in and nil or ValidationErrors as error otherwise. +// You will need to assert the error if it's not nil eg. err.(validator.ValidationErrors) to access the array of errors. +func (v *Validate) StructFiltered(s interface{}, fn FilterFunc) error { + return v.StructFilteredCtx(context.Background(), s, fn) +} + +// StructFilteredCtx validates a structs exposed fields, that pass the FilterFunc check and automatically validates +// nested structs, unless otherwise specified and also allows passing of contextual validation information via +// context.Context +// +// It returns InvalidValidationError for bad values passed in and nil or ValidationErrors as error otherwise. +// You will need to assert the error if it's not nil eg. err.(validator.ValidationErrors) to access the array of errors. +func (v *Validate) StructFilteredCtx(ctx context.Context, s interface{}, fn FilterFunc) (err error) { + val := reflect.ValueOf(s) + top := val + + if val.Kind() == reflect.Ptr && !val.IsNil() { + val = val.Elem() + } + + if val.Kind() != reflect.Struct || val.Type().ConvertibleTo(timeType) { + return &InvalidValidationError{Type: reflect.TypeOf(s)} + } + + // good to validate + vd := v.pool.Get().(*validate) + vd.top = top + vd.isPartial = true + vd.ffn = fn + // vd.hasExcludes = false // only need to reset in StructPartial and StructExcept + + vd.validateStruct(ctx, top, val, val.Type(), vd.ns[0:0], vd.actualNs[0:0], nil) + + if len(vd.errs) > 0 { + err = vd.errs + vd.errs = nil + } + + v.pool.Put(vd) + + return +} + +// StructPartial validates the fields passed in only, ignoring all others. +// Fields may be provided in a namespaced fashion relative to the struct provided +// eg. NestedStruct.Field or NestedArrayField[0].Struct.Name +// +// It returns InvalidValidationError for bad values passed in and nil or ValidationErrors as error otherwise. +// You will need to assert the error if it's not nil eg. err.(validator.ValidationErrors) to access the array of errors. +func (v *Validate) StructPartial(s interface{}, fields ...string) error { + return v.StructPartialCtx(context.Background(), s, fields...) +} + +// StructPartialCtx validates the fields passed in only, ignoring all others and allows passing of contextual +// validation information via context.Context +// Fields may be provided in a namespaced fashion relative to the struct provided +// eg. NestedStruct.Field or NestedArrayField[0].Struct.Name +// +// It returns InvalidValidationError for bad values passed in and nil or ValidationErrors as error otherwise. +// You will need to assert the error if it's not nil eg. err.(validator.ValidationErrors) to access the array of errors. +func (v *Validate) StructPartialCtx(ctx context.Context, s interface{}, fields ...string) (err error) { + val := reflect.ValueOf(s) + top := val + + if val.Kind() == reflect.Ptr && !val.IsNil() { + val = val.Elem() + } + + if val.Kind() != reflect.Struct || val.Type().ConvertibleTo(timeType) { + return &InvalidValidationError{Type: reflect.TypeOf(s)} + } + + // good to validate + vd := v.pool.Get().(*validate) + vd.top = top + vd.isPartial = true + vd.ffn = nil + vd.hasExcludes = false + vd.includeExclude = make(map[string]struct{}) + + typ := val.Type() + name := typ.Name() + + for _, k := range fields { + flds := strings.Split(k, namespaceSeparator) + if len(flds) > 0 { + vd.misc = append(vd.misc[0:0], name...) + // Don't append empty name for unnamed structs + if len(vd.misc) != 0 { + vd.misc = append(vd.misc, '.') + } + + for _, s := range flds { + idx := strings.Index(s, leftBracket) + + if idx != -1 { + for idx != -1 { + vd.misc = append(vd.misc, s[:idx]...) + vd.includeExclude[string(vd.misc)] = struct{}{} + + idx2 := strings.Index(s, rightBracket) + idx2++ + vd.misc = append(vd.misc, s[idx:idx2]...) + vd.includeExclude[string(vd.misc)] = struct{}{} + s = s[idx2:] + idx = strings.Index(s, leftBracket) + } + } else { + vd.misc = append(vd.misc, s...) + vd.includeExclude[string(vd.misc)] = struct{}{} + } + + vd.misc = append(vd.misc, '.') + } + } + } + + vd.validateStruct(ctx, top, val, typ, vd.ns[0:0], vd.actualNs[0:0], nil) + + if len(vd.errs) > 0 { + err = vd.errs + vd.errs = nil + } + + v.pool.Put(vd) + + return +} + +// StructExcept validates all fields except the ones passed in. +// Fields may be provided in a namespaced fashion relative to the struct provided +// i.e. NestedStruct.Field or NestedArrayField[0].Struct.Name +// +// It returns InvalidValidationError for bad values passed in and nil or ValidationErrors as error otherwise. +// You will need to assert the error if it's not nil eg. err.(validator.ValidationErrors) to access the array of errors. +func (v *Validate) StructExcept(s interface{}, fields ...string) error { + return v.StructExceptCtx(context.Background(), s, fields...) +} + +// StructExceptCtx validates all fields except the ones passed in and allows passing of contextual +// validation information via context.Context +// Fields may be provided in a namespaced fashion relative to the struct provided +// i.e. NestedStruct.Field or NestedArrayField[0].Struct.Name +// +// It returns InvalidValidationError for bad values passed in and nil or ValidationErrors as error otherwise. +// You will need to assert the error if it's not nil eg. err.(validator.ValidationErrors) to access the array of errors. +func (v *Validate) StructExceptCtx(ctx context.Context, s interface{}, fields ...string) (err error) { + val := reflect.ValueOf(s) + top := val + + if val.Kind() == reflect.Ptr && !val.IsNil() { + val = val.Elem() + } + + if val.Kind() != reflect.Struct || val.Type().ConvertibleTo(timeType) { + return &InvalidValidationError{Type: reflect.TypeOf(s)} + } + + // good to validate + vd := v.pool.Get().(*validate) + vd.top = top + vd.isPartial = true + vd.ffn = nil + vd.hasExcludes = true + vd.includeExclude = make(map[string]struct{}) + + typ := val.Type() + name := typ.Name() + + for _, key := range fields { + vd.misc = vd.misc[0:0] + + if len(name) > 0 { + vd.misc = append(vd.misc, name...) + vd.misc = append(vd.misc, '.') + } + + vd.misc = append(vd.misc, key...) + vd.includeExclude[string(vd.misc)] = struct{}{} + } + + vd.validateStruct(ctx, top, val, typ, vd.ns[0:0], vd.actualNs[0:0], nil) + + if len(vd.errs) > 0 { + err = vd.errs + vd.errs = nil + } + + v.pool.Put(vd) + + return +} + +// Var validates a single variable using tag style validation. +// eg. +// var i int +// validate.Var(i, "gt=1,lt=10") +// +// WARNING: a struct can be passed for validation eg. time.Time is a struct or +// if you have a custom type and have registered a custom type handler, so must +// allow it; however unforeseen validations will occur if trying to validate a +// struct that is meant to be passed to 'validate.Struct' +// +// It returns InvalidValidationError for bad values passed in and nil or ValidationErrors as error otherwise. +// You will need to assert the error if it's not nil eg. err.(validator.ValidationErrors) to access the array of errors. +// validate Array, Slice and maps fields which may contain more than one error +func (v *Validate) Var(field interface{}, tag string) error { + return v.VarCtx(context.Background(), field, tag) +} + +// VarCtx validates a single variable using tag style validation and allows passing of contextual +// validation information via context.Context. +// eg. +// var i int +// validate.Var(i, "gt=1,lt=10") +// +// WARNING: a struct can be passed for validation eg. time.Time is a struct or +// if you have a custom type and have registered a custom type handler, so must +// allow it; however unforeseen validations will occur if trying to validate a +// struct that is meant to be passed to 'validate.Struct' +// +// It returns InvalidValidationError for bad values passed in and nil or ValidationErrors as error otherwise. +// You will need to assert the error if it's not nil eg. err.(validator.ValidationErrors) to access the array of errors. +// validate Array, Slice and maps fields which may contain more than one error +func (v *Validate) VarCtx(ctx context.Context, field interface{}, tag string) (err error) { + if len(tag) == 0 || tag == skipValidationTag { + return nil + } + + ctag := v.fetchCacheTag(tag) + + val := reflect.ValueOf(field) + vd := v.pool.Get().(*validate) + vd.top = val + vd.isPartial = false + vd.traverseField(ctx, val, val, vd.ns[0:0], vd.actualNs[0:0], defaultCField, ctag) + + if len(vd.errs) > 0 { + err = vd.errs + vd.errs = nil + } + v.pool.Put(vd) + return +} + +// VarWithValue validates a single variable, against another variable/field's value using tag style validation +// eg. +// s1 := "abcd" +// s2 := "abcd" +// validate.VarWithValue(s1, s2, "eqcsfield") // returns true +// +// WARNING: a struct can be passed for validation eg. time.Time is a struct or +// if you have a custom type and have registered a custom type handler, so must +// allow it; however unforeseen validations will occur if trying to validate a +// struct that is meant to be passed to 'validate.Struct' +// +// It returns InvalidValidationError for bad values passed in and nil or ValidationErrors as error otherwise. +// You will need to assert the error if it's not nil eg. err.(validator.ValidationErrors) to access the array of errors. +// validate Array, Slice and maps fields which may contain more than one error +func (v *Validate) VarWithValue(field interface{}, other interface{}, tag string) error { + return v.VarWithValueCtx(context.Background(), field, other, tag) +} + +// VarWithValueCtx validates a single variable, against another variable/field's value using tag style validation and +// allows passing of contextual validation information via context.Context. +// eg. +// s1 := "abcd" +// s2 := "abcd" +// validate.VarWithValue(s1, s2, "eqcsfield") // returns true +// +// WARNING: a struct can be passed for validation eg. time.Time is a struct or +// if you have a custom type and have registered a custom type handler, so must +// allow it; however unforeseen validations will occur if trying to validate a +// struct that is meant to be passed to 'validate.Struct' +// +// It returns InvalidValidationError for bad values passed in and nil or ValidationErrors as error otherwise. +// You will need to assert the error if it's not nil eg. err.(validator.ValidationErrors) to access the array of errors. +// validate Array, Slice and maps fields which may contain more than one error +func (v *Validate) VarWithValueCtx(ctx context.Context, field interface{}, other interface{}, tag string) (err error) { + if len(tag) == 0 || tag == skipValidationTag { + return nil + } + ctag := v.fetchCacheTag(tag) + otherVal := reflect.ValueOf(other) + vd := v.pool.Get().(*validate) + vd.top = otherVal + vd.isPartial = false + vd.traverseField(ctx, otherVal, reflect.ValueOf(field), vd.ns[0:0], vd.actualNs[0:0], defaultCField, ctag) + + if len(vd.errs) > 0 { + err = vd.errs + vd.errs = nil + } + v.pool.Put(vd) + return +} + +func (v *Validate) registerValidation(tag string, fn FuncCtx, bakedIn bool, nilCheckable bool) error { + if len(tag) == 0 { + return errors.New("function Key cannot be empty") + } + + if fn == nil { + return errors.New("function cannot be empty") + } + + _, ok := restrictedTags[tag] + if !bakedIn && (ok || strings.ContainsAny(tag, restrictedTagChars)) { + panic(fmt.Sprintf(restrictedTagErr, tag)) + } + v.validations[tag] = internalValidationFuncWrapper{fn: fn, runValidationOnNil: nilCheckable} + return nil +} diff --git a/vendor/github.com/leodido/go-urn/.gitignore b/vendor/github.com/leodido/go-urn/.gitignore new file mode 100644 index 00000000..427454f8 --- /dev/null +++ b/vendor/github.com/leodido/go-urn/.gitignore @@ -0,0 +1,13 @@ +*.exe +*.dll +*.so +*.dylib + +*.test + +*.out +*.txt + +vendor/ +/removecomments +/snake2camel \ No newline at end of file diff --git a/vendor/github.com/leodido/go-urn/LICENSE b/vendor/github.com/leodido/go-urn/LICENSE new file mode 100644 index 00000000..8c3504a5 --- /dev/null +++ b/vendor/github.com/leodido/go-urn/LICENSE @@ -0,0 +1,21 @@ +MIT License + +Copyright (c) 2018 Leonardo Di Donato + +Permission is hereby granted, free of charge, to any person obtaining a copy +of this software and associated documentation files (the "Software"), to deal +in the Software without restriction, including without limitation the rights +to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +copies of the Software, and to permit persons to whom the Software is +furnished to do so, subject to the following conditions: + +The above copyright notice and this permission notice shall be included in all +copies or substantial portions of the Software. + +THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE +SOFTWARE. diff --git a/vendor/github.com/leodido/go-urn/README.md b/vendor/github.com/leodido/go-urn/README.md new file mode 100644 index 00000000..619475bf --- /dev/null +++ b/vendor/github.com/leodido/go-urn/README.md @@ -0,0 +1,153 @@ +[![Build](https://img.shields.io/circleci/build/github/leodido/go-urn?style=for-the-badge)](https://app.circleci.com/pipelines/github/leodido/go-urn) [![Coverage](https://img.shields.io/codecov/c/github/leodido/go-urn.svg?style=for-the-badge)](https://codecov.io/gh/leodido/go-urn) [![Documentation](https://img.shields.io/badge/godoc-reference-blue.svg?style=for-the-badge)](https://godoc.org/github.com/leodido/go-urn) + +**A parser for URNs**. + +> As seen on [RFC 2141](https://datatracker.ietf.org/doc/html/rfc2141), [RFC 7643](https://datatracker.ietf.org/doc/html/rfc7643#section-10), and on [RFC 8141](https://datatracker.ietf.org/doc/html/rfc8141). + +[API documentation](https://godoc.org/github.com/leodido/go-urn). + +Starting with version 1.3 this library also supports [RFC 7643 SCIM URNs](https://datatracker.ietf.org/doc/html/rfc7643#section-10). + +Starting with version 1.4 this library also supports [RFC 8141 URNs (2017)](https://datatracker.ietf.org/doc/html/rfc8141). + +## Installation + +``` +go get github.com/leodido/go-urn +``` + +## Features + +1. RFC 2141 URNs parsing (default) +2. RFC 8141 URNs parsing (supersedes RFC 2141) +3. RFC 7643 SCIM URNs parsing +4. Normalization as per RFCs +5. Lexical equivalence as per RFCs +6. Precise, fine-grained errors + +## Performances + +This implementation results to be really fast. + +Usually below 400 ns on my machine[1](#mymachine). + +Notice it also performs, while parsing: + +1. fine-grained and informative erroring +2. specific-string normalization + +``` +ok/00/urn:a:b______________________________________/-10 51372006 109.0 ns/op 275 B/op 3 allocs/op +ok/01/URN:foo:a123,456_____________________________/-10 36024072 160.8 ns/op 296 B/op 6 allocs/op +ok/02/urn:foo:a123%2C456___________________________/-10 31901007 188.4 ns/op 320 B/op 7 allocs/op +ok/03/urn:ietf:params:scim:schemas:core:2.0:User___/-10 22736756 266.6 ns/op 376 B/op 6 allocs/op +ok/04/urn:ietf:params:scim:schemas:extension:enterp/-10 18291859 335.2 ns/op 408 B/op 6 allocs/op +ok/05/urn:ietf:params:scim:schemas:extension:enterp/-10 15283087 379.4 ns/op 440 B/op 6 allocs/op +ok/06/urn:burnout:nss______________________________/-10 39407593 155.1 ns/op 288 B/op 6 allocs/op +ok/07/urn:abcdefghilmnopqrstuvzabcdefghilm:x_______/-10 27832718 211.4 ns/op 307 B/op 4 allocs/op +ok/08/urn:urnurnurn:urn____________________________/-10 33269596 168.1 ns/op 293 B/op 6 allocs/op +ok/09/urn:ciao:!!*_________________________________/-10 41100675 148.8 ns/op 288 B/op 6 allocs/op +ok/10/urn:ciao:=@__________________________________/-10 37214253 149.7 ns/op 284 B/op 6 allocs/op +ok/11/urn:ciao:@!=%2C(xyz)+a,b.*@g=$_'_____________/-10 26534240 229.8 ns/op 336 B/op 7 allocs/op +ok/12/URN:x:abc%1Dz%2F%3az_________________________/-10 28166396 211.8 ns/op 336 B/op 7 allocs/op +no/13/URN:---xxx:x_________________________________/-10 23635159 255.6 ns/op 419 B/op 5 allocs/op +no/14/urn::colon:nss_______________________________/-10 23594779 258.4 ns/op 419 B/op 5 allocs/op +no/15/URN:@,:x_____________________________________/-10 23742535 261.5 ns/op 419 B/op 5 allocs/op +no/16/URN:URN:NSS__________________________________/-10 27432714 223.3 ns/op 371 B/op 5 allocs/op +no/17/urn:UrN:NSS__________________________________/-10 26922117 224.9 ns/op 371 B/op 5 allocs/op +no/18/urn:a:%______________________________________/-10 24926733 224.6 ns/op 371 B/op 5 allocs/op +no/19/urn:urn:NSS__________________________________/-10 27652641 220.7 ns/op 371 B/op 5 allocs/op +``` + +* [1]: Apple M1 Pro + + +## Example + +For more examples take a look at the [examples file](examples_test.go). + + +```go +package main + +import ( + "fmt" + "github.com/leodido/go-urn" +) + +func main() { + var uid = "URN:foo:a123,456" + + // Parse the input string as a RFC 2141 URN only + u, e := urn.NewMachine().Parse(uid) + if e != nil { + fmt.Errorf(err) + + return + } + + fmt.Println(u.ID) + fmt.Println(u.SS) + + // Output: + // foo + // a123,456 +} +``` + +```go +package main + +import ( + "fmt" + "github.com/leodido/go-urn" +) + +func main() { + var uid = "URN:foo:a123,456" + + // Parse the input string as a RFC 2141 URN only + u, ok := urn.Parse([]byte(uid)) + if !ok { + panic("error parsing urn") + } + + fmt.Println(u.ID) + fmt.Println(u.SS) + + // Output: + // foo + // a123,456 +} +``` + +```go +package main + +import ( + "fmt" + "github.com/leodido/go-urn" +) + +func main() { + input := "urn:ietf:params:scim:api:messages:2.0:ListResponse" + + // Parsing the input string as a RFC 7643 SCIM URN + u, ok := urn.Parse([]byte(input), urn.WithParsingMode(urn.RFC7643Only)) + if !ok { + panic("error parsing urn") + } + + fmt.Println(u.IsSCIM()) + scim := u.SCIM() + fmt.Println(scim.Type.String()) + fmt.Println(scim.Name) + fmt.Println(scim.Other) + + // Output: + // true + // api + // messages + // 2.0:ListResponse +} +``` \ No newline at end of file diff --git a/vendor/github.com/leodido/go-urn/kind.go b/vendor/github.com/leodido/go-urn/kind.go new file mode 100644 index 00000000..f5e140f0 --- /dev/null +++ b/vendor/github.com/leodido/go-urn/kind.go @@ -0,0 +1,10 @@ +package urn + +type Kind int + +const ( + NONE Kind = iota + RFC2141 + RFC7643 + RFC8141 +) diff --git a/vendor/github.com/leodido/go-urn/machine.go b/vendor/github.com/leodido/go-urn/machine.go new file mode 100644 index 00000000..aec1ba69 --- /dev/null +++ b/vendor/github.com/leodido/go-urn/machine.go @@ -0,0 +1,5046 @@ +package urn + +import ( + "fmt" + + scimschema "github.com/leodido/go-urn/scim/schema" +) + +var ( + errPrefix = "expecting the prefix to be the \"urn\" string (whatever case) [col %d]" + errIdentifier = "expecting the identifier to be string (1..31 alnum chars, also containing dashes but not at its beginning) [col %d]" + errSpecificString = "expecting the specific string to be a string containing alnum, hex, or others ([()+,-.:=@;$_!*']) chars [col %d]" + errNoUrnWithinID = "expecting the identifier to not contain the \"urn\" reserved string [col %d]" + errHex = "expecting the percent encoded chars to be well-formed (%%alnum{2}) [col %d]" + errSCIMNamespace = "expecing the SCIM namespace identifier (ietf:params:scim) [col %d]" + errSCIMType = "expecting a correct SCIM type (schemas, api, param) [col %d]" + errSCIMName = "expecting one or more alnum char in the SCIM name part [col %d]" + errSCIMOther = "expecting a well-formed other SCIM part [col %d]" + errSCIMOtherIncomplete = "expecting a not empty SCIM other part after colon [col %d]" + err8141InformalID = "informal URN namespace must be in the form urn-[1-9][0-9] [col %d]" + err8141SpecificString = "expecting the specific string to contain alnum, hex, or others ([~&()+,-.:=@;$_!*'] or [/?] not in first position) chars [col %d]" + err8141Identifier = "expecting the indentifier to be a string with (length 2 to 32 chars) containing alnum (or dashes) not starting or ending with a dash [col %d]" + err8141RComponentStart = "expecting only one r-component (starting with the ?+ sequence) [col %d]" + err8141QComponentStart = "expecting only one q-component (starting with the ?= sequence) [col %d]" + err8141MalformedRComp = "expecting a non-empty r-component containing alnum, hex, or others ([~&()+,-.:=@;$_!*'] or [/?] but not at its beginning) [col %d]" + err8141MalformedQComp = "expecting a non-empty q-component containing alnum, hex, or others ([~&()+,-.:=@;$_!*'] or [/?] but not at its beginning) [col %d]" +) +var _toStateActions []byte = []byte{ + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 33, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, +} + +var _eofActions []byte = []byte{ + 0, 1, 1, 1, 1, 4, 6, 6, + 6, 6, 6, 6, 6, 6, 6, 6, + 6, 6, 6, 6, 6, 6, 6, 6, + 6, 6, 6, 6, 6, 6, 6, 6, + 6, 6, 6, 6, 6, 6, 8, 9, + 9, 4, 4, 11, 1, 1, 1, 1, + 12, 12, 12, 12, 12, 12, 12, 12, + 12, 12, 12, 12, 12, 12, 12, 12, + 12, 14, 14, 14, 14, 16, 18, 20, + 20, 14, 14, 14, 14, 14, 14, 14, + 14, 14, 14, 1, 1, 1, 1, 21, + 22, 22, 22, 22, 22, 22, 22, 22, + 22, 22, 22, 22, 22, 22, 22, 22, + 22, 22, 22, 22, 22, 22, 22, 22, + 22, 22, 22, 22, 22, 22, 22, 22, + 23, 24, 24, 25, 25, 0, 26, 28, + 28, 29, 29, 30, 30, 26, 26, 31, + 31, 22, 22, 22, 22, 22, 22, 22, + 22, 22, 22, 22, 22, 22, 22, 22, + 22, 22, 22, 22, 22, 22, 22, 22, + 22, 22, 22, 22, 22, 22, 22, 21, + 21, 22, 22, 22, 34, 34, 35, 37, + 37, 38, 40, 41, 41, 38, 42, 42, + 42, 44, 42, 48, 48, 48, 50, 44, + 50, 0, +} + +const start int = 1 +const firstFinal int = 172 + +const enScimOnly int = 44 +const enRfc8141Only int = 83 +const enFail int = 193 +const enMain int = 1 + +// Machine is the interface representing the FSM +type Machine interface { + Error() error + Parse(input []byte) (*URN, error) + WithParsingMode(ParsingMode) +} + +type machine struct { + data []byte + cs int + p, pe, eof, pb int + err error + startParsingAt int + parsingMode ParsingMode + parsingModeSet bool +} + +// NewMachine creates a new FSM able to parse RFC 2141 strings. +func NewMachine(options ...Option) Machine { + m := &machine{ + parsingModeSet: false, + } + + for _, o := range options { + o(m) + } + // Set default parsing mode + if !m.parsingModeSet { + m.WithParsingMode(DefaultParsingMode) + } + + return m +} + +// Err returns the error that occurred on the last call to Parse. +// +// If the result is nil, then the line was parsed successfully. +func (m *machine) Error() error { + return m.err +} + +func (m *machine) text() []byte { + return m.data[m.pb:m.p] +} + +// Parse parses the input byte array as a RFC 2141 or RFC7643 string. +func (m *machine) Parse(input []byte) (*URN, error) { + m.data = input + m.p = 0 + m.pb = 0 + m.pe = len(input) + m.eof = len(input) + m.err = nil + m.cs = m.startParsingAt + output := &URN{ + tolower: []int{}, + } + { + if (m.p) == (m.pe) { + goto _testEof + } + if m.cs == 0 { + goto _out + } + _resume: + switch m.cs { + case 1: + switch (m.data)[(m.p)] { + case 85: + goto tr1 + case 117: + goto tr1 + } + goto tr0 + case 0: + goto _out + case 2: + switch (m.data)[(m.p)] { + case 82: + goto tr2 + case 114: + goto tr2 + } + goto tr0 + case 3: + switch (m.data)[(m.p)] { + case 78: + goto tr3 + case 110: + goto tr3 + } + goto tr0 + case 4: + if (m.data)[(m.p)] == 58 { + goto tr4 + } + goto tr0 + case 5: + switch (m.data)[(m.p)] { + case 85: + goto tr7 + case 117: + goto tr7 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr6 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr6 + } + default: + goto tr6 + } + goto tr5 + case 6: + switch (m.data)[(m.p)] { + case 45: + goto tr9 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr9 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr9 + } + default: + goto tr9 + } + goto tr8 + case 7: + switch (m.data)[(m.p)] { + case 45: + goto tr11 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr11 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr11 + } + default: + goto tr11 + } + goto tr8 + case 8: + switch (m.data)[(m.p)] { + case 45: + goto tr12 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr12 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr12 + } + default: + goto tr12 + } + goto tr8 + case 9: + switch (m.data)[(m.p)] { + case 45: + goto tr13 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr13 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr13 + } + default: + goto tr13 + } + goto tr8 + case 10: + switch (m.data)[(m.p)] { + case 45: + goto tr14 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr14 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr14 + } + default: + goto tr14 + } + goto tr8 + case 11: + switch (m.data)[(m.p)] { + case 45: + goto tr15 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr15 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr15 + } + default: + goto tr15 + } + goto tr8 + case 12: + switch (m.data)[(m.p)] { + case 45: + goto tr16 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr16 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr16 + } + default: + goto tr16 + } + goto tr8 + case 13: + switch (m.data)[(m.p)] { + case 45: + goto tr17 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr17 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr17 + } + default: + goto tr17 + } + goto tr8 + case 14: + switch (m.data)[(m.p)] { + case 45: + goto tr18 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr18 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr18 + } + default: + goto tr18 + } + goto tr8 + case 15: + switch (m.data)[(m.p)] { + case 45: + goto tr19 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr19 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr19 + } + default: + goto tr19 + } + goto tr8 + case 16: + switch (m.data)[(m.p)] { + case 45: + goto tr20 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr20 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr20 + } + default: + goto tr20 + } + goto tr8 + case 17: + switch (m.data)[(m.p)] { + case 45: + goto tr21 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr21 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr21 + } + default: + goto tr21 + } + goto tr8 + case 18: + switch (m.data)[(m.p)] { + case 45: + goto tr22 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr22 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr22 + } + default: + goto tr22 + } + goto tr8 + case 19: + switch (m.data)[(m.p)] { + case 45: + goto tr23 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr23 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr23 + } + default: + goto tr23 + } + goto tr8 + case 20: + switch (m.data)[(m.p)] { + case 45: + goto tr24 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr24 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr24 + } + default: + goto tr24 + } + goto tr8 + case 21: + switch (m.data)[(m.p)] { + case 45: + goto tr25 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr25 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr25 + } + default: + goto tr25 + } + goto tr8 + case 22: + switch (m.data)[(m.p)] { + case 45: + goto tr26 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr26 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr26 + } + default: + goto tr26 + } + goto tr8 + case 23: + switch (m.data)[(m.p)] { + case 45: + goto tr27 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr27 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr27 + } + default: + goto tr27 + } + goto tr8 + case 24: + switch (m.data)[(m.p)] { + case 45: + goto tr28 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr28 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr28 + } + default: + goto tr28 + } + goto tr8 + case 25: + switch (m.data)[(m.p)] { + case 45: + goto tr29 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr29 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr29 + } + default: + goto tr29 + } + goto tr8 + case 26: + switch (m.data)[(m.p)] { + case 45: + goto tr30 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr30 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr30 + } + default: + goto tr30 + } + goto tr8 + case 27: + switch (m.data)[(m.p)] { + case 45: + goto tr31 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr31 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr31 + } + default: + goto tr31 + } + goto tr8 + case 28: + switch (m.data)[(m.p)] { + case 45: + goto tr32 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr32 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr32 + } + default: + goto tr32 + } + goto tr8 + case 29: + switch (m.data)[(m.p)] { + case 45: + goto tr33 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr33 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr33 + } + default: + goto tr33 + } + goto tr8 + case 30: + switch (m.data)[(m.p)] { + case 45: + goto tr34 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr34 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr34 + } + default: + goto tr34 + } + goto tr8 + case 31: + switch (m.data)[(m.p)] { + case 45: + goto tr35 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr35 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr35 + } + default: + goto tr35 + } + goto tr8 + case 32: + switch (m.data)[(m.p)] { + case 45: + goto tr36 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr36 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr36 + } + default: + goto tr36 + } + goto tr8 + case 33: + switch (m.data)[(m.p)] { + case 45: + goto tr37 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr37 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr37 + } + default: + goto tr37 + } + goto tr8 + case 34: + switch (m.data)[(m.p)] { + case 45: + goto tr38 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr38 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr38 + } + default: + goto tr38 + } + goto tr8 + case 35: + switch (m.data)[(m.p)] { + case 45: + goto tr39 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr39 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr39 + } + default: + goto tr39 + } + goto tr8 + case 36: + switch (m.data)[(m.p)] { + case 45: + goto tr40 + case 58: + goto tr10 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr40 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr40 + } + default: + goto tr40 + } + goto tr8 + case 37: + if (m.data)[(m.p)] == 58 { + goto tr10 + } + goto tr8 + case 38: + switch (m.data)[(m.p)] { + case 33: + goto tr42 + case 36: + goto tr42 + case 37: + goto tr43 + case 61: + goto tr42 + case 95: + goto tr42 + } + switch { + case (m.data)[(m.p)] < 48: + if 39 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 46 { + goto tr42 + } + case (m.data)[(m.p)] > 59: + switch { + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr42 + } + case (m.data)[(m.p)] >= 64: + goto tr42 + } + default: + goto tr42 + } + goto tr41 + case 172: + switch (m.data)[(m.p)] { + case 33: + goto tr212 + case 36: + goto tr212 + case 37: + goto tr213 + case 61: + goto tr212 + case 95: + goto tr212 + } + switch { + case (m.data)[(m.p)] < 48: + if 39 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 46 { + goto tr212 + } + case (m.data)[(m.p)] > 59: + switch { + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr212 + } + case (m.data)[(m.p)] >= 64: + goto tr212 + } + default: + goto tr212 + } + goto tr41 + case 39: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr45 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr45 + } + default: + goto tr46 + } + goto tr44 + case 40: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr47 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr47 + } + default: + goto tr48 + } + goto tr44 + case 173: + switch (m.data)[(m.p)] { + case 33: + goto tr212 + case 36: + goto tr212 + case 37: + goto tr213 + case 61: + goto tr212 + case 95: + goto tr212 + } + switch { + case (m.data)[(m.p)] < 48: + if 39 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 46 { + goto tr212 + } + case (m.data)[(m.p)] > 59: + switch { + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr212 + } + case (m.data)[(m.p)] >= 64: + goto tr212 + } + default: + goto tr212 + } + goto tr44 + case 41: + switch (m.data)[(m.p)] { + case 45: + goto tr9 + case 58: + goto tr10 + case 82: + goto tr49 + case 114: + goto tr49 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr9 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr9 + } + default: + goto tr9 + } + goto tr5 + case 42: + switch (m.data)[(m.p)] { + case 45: + goto tr11 + case 58: + goto tr10 + case 78: + goto tr50 + case 110: + goto tr50 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr11 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr11 + } + default: + goto tr11 + } + goto tr5 + case 43: + if (m.data)[(m.p)] == 45 { + goto tr12 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr12 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr12 + } + default: + goto tr12 + } + goto tr51 + case 44: + switch (m.data)[(m.p)] { + case 85: + goto tr52 + case 117: + goto tr52 + } + goto tr0 + case 45: + switch (m.data)[(m.p)] { + case 82: + goto tr53 + case 114: + goto tr53 + } + goto tr0 + case 46: + switch (m.data)[(m.p)] { + case 78: + goto tr54 + case 110: + goto tr54 + } + goto tr0 + case 47: + if (m.data)[(m.p)] == 58 { + goto tr55 + } + goto tr0 + case 48: + if (m.data)[(m.p)] == 105 { + goto tr57 + } + goto tr56 + case 49: + if (m.data)[(m.p)] == 101 { + goto tr58 + } + goto tr56 + case 50: + if (m.data)[(m.p)] == 116 { + goto tr59 + } + goto tr56 + case 51: + if (m.data)[(m.p)] == 102 { + goto tr60 + } + goto tr56 + case 52: + if (m.data)[(m.p)] == 58 { + goto tr61 + } + goto tr56 + case 53: + if (m.data)[(m.p)] == 112 { + goto tr62 + } + goto tr56 + case 54: + if (m.data)[(m.p)] == 97 { + goto tr63 + } + goto tr56 + case 55: + if (m.data)[(m.p)] == 114 { + goto tr64 + } + goto tr56 + case 56: + if (m.data)[(m.p)] == 97 { + goto tr65 + } + goto tr56 + case 57: + if (m.data)[(m.p)] == 109 { + goto tr66 + } + goto tr56 + case 58: + if (m.data)[(m.p)] == 115 { + goto tr67 + } + goto tr56 + case 59: + if (m.data)[(m.p)] == 58 { + goto tr68 + } + goto tr56 + case 60: + if (m.data)[(m.p)] == 115 { + goto tr69 + } + goto tr56 + case 61: + if (m.data)[(m.p)] == 99 { + goto tr70 + } + goto tr56 + case 62: + if (m.data)[(m.p)] == 105 { + goto tr71 + } + goto tr56 + case 63: + if (m.data)[(m.p)] == 109 { + goto tr72 + } + goto tr56 + case 64: + if (m.data)[(m.p)] == 58 { + goto tr73 + } + goto tr56 + case 65: + switch (m.data)[(m.p)] { + case 97: + goto tr75 + case 112: + goto tr76 + case 115: + goto tr77 + } + goto tr74 + case 66: + if (m.data)[(m.p)] == 112 { + goto tr78 + } + goto tr74 + case 67: + if (m.data)[(m.p)] == 105 { + goto tr79 + } + goto tr74 + case 68: + if (m.data)[(m.p)] == 58 { + goto tr80 + } + goto tr74 + case 69: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr82 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr82 + } + default: + goto tr82 + } + goto tr81 + case 174: + if (m.data)[(m.p)] == 58 { + goto tr215 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr214 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr214 + } + default: + goto tr214 + } + goto tr81 + case 70: + switch (m.data)[(m.p)] { + case 33: + goto tr84 + case 36: + goto tr84 + case 37: + goto tr85 + case 61: + goto tr84 + case 95: + goto tr84 + } + switch { + case (m.data)[(m.p)] < 48: + if 39 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 46 { + goto tr84 + } + case (m.data)[(m.p)] > 59: + switch { + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr84 + } + case (m.data)[(m.p)] >= 64: + goto tr84 + } + default: + goto tr84 + } + goto tr83 + case 175: + switch (m.data)[(m.p)] { + case 33: + goto tr216 + case 36: + goto tr216 + case 37: + goto tr217 + case 61: + goto tr216 + case 95: + goto tr216 + } + switch { + case (m.data)[(m.p)] < 48: + if 39 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 46 { + goto tr216 + } + case (m.data)[(m.p)] > 59: + switch { + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr216 + } + case (m.data)[(m.p)] >= 64: + goto tr216 + } + default: + goto tr216 + } + goto tr83 + case 71: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr87 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr87 + } + default: + goto tr88 + } + goto tr86 + case 72: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr89 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr89 + } + default: + goto tr90 + } + goto tr86 + case 176: + switch (m.data)[(m.p)] { + case 33: + goto tr216 + case 36: + goto tr216 + case 37: + goto tr217 + case 61: + goto tr216 + case 95: + goto tr216 + } + switch { + case (m.data)[(m.p)] < 48: + if 39 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 46 { + goto tr216 + } + case (m.data)[(m.p)] > 59: + switch { + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr216 + } + case (m.data)[(m.p)] >= 64: + goto tr216 + } + default: + goto tr216 + } + goto tr86 + case 73: + if (m.data)[(m.p)] == 97 { + goto tr91 + } + goto tr74 + case 74: + if (m.data)[(m.p)] == 114 { + goto tr92 + } + goto tr74 + case 75: + if (m.data)[(m.p)] == 97 { + goto tr93 + } + goto tr74 + case 76: + if (m.data)[(m.p)] == 109 { + goto tr79 + } + goto tr74 + case 77: + if (m.data)[(m.p)] == 99 { + goto tr94 + } + goto tr74 + case 78: + if (m.data)[(m.p)] == 104 { + goto tr95 + } + goto tr74 + case 79: + if (m.data)[(m.p)] == 101 { + goto tr96 + } + goto tr74 + case 80: + if (m.data)[(m.p)] == 109 { + goto tr97 + } + goto tr74 + case 81: + if (m.data)[(m.p)] == 97 { + goto tr98 + } + goto tr74 + case 82: + if (m.data)[(m.p)] == 115 { + goto tr79 + } + goto tr74 + case 83: + switch (m.data)[(m.p)] { + case 85: + goto tr99 + case 117: + goto tr99 + } + goto tr0 + case 84: + switch (m.data)[(m.p)] { + case 82: + goto tr100 + case 114: + goto tr100 + } + goto tr0 + case 85: + switch (m.data)[(m.p)] { + case 78: + goto tr101 + case 110: + goto tr101 + } + goto tr0 + case 86: + if (m.data)[(m.p)] == 58 { + goto tr102 + } + goto tr0 + case 87: + switch (m.data)[(m.p)] { + case 85: + goto tr105 + case 117: + goto tr105 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr104 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr104 + } + default: + goto tr104 + } + goto tr103 + case 88: + if (m.data)[(m.p)] == 45 { + goto tr107 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr108 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr108 + } + default: + goto tr108 + } + goto tr106 + case 89: + if (m.data)[(m.p)] == 45 { + goto tr109 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr110 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr110 + } + default: + goto tr110 + } + goto tr106 + case 90: + if (m.data)[(m.p)] == 45 { + goto tr111 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr112 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr112 + } + default: + goto tr112 + } + goto tr106 + case 91: + if (m.data)[(m.p)] == 45 { + goto tr113 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr114 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr114 + } + default: + goto tr114 + } + goto tr106 + case 92: + if (m.data)[(m.p)] == 45 { + goto tr115 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr116 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr116 + } + default: + goto tr116 + } + goto tr106 + case 93: + if (m.data)[(m.p)] == 45 { + goto tr117 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr118 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr118 + } + default: + goto tr118 + } + goto tr106 + case 94: + if (m.data)[(m.p)] == 45 { + goto tr119 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr120 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr120 + } + default: + goto tr120 + } + goto tr106 + case 95: + if (m.data)[(m.p)] == 45 { + goto tr121 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr122 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr122 + } + default: + goto tr122 + } + goto tr106 + case 96: + if (m.data)[(m.p)] == 45 { + goto tr123 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr124 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr124 + } + default: + goto tr124 + } + goto tr106 + case 97: + if (m.data)[(m.p)] == 45 { + goto tr125 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr126 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr126 + } + default: + goto tr126 + } + goto tr106 + case 98: + if (m.data)[(m.p)] == 45 { + goto tr127 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr128 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr128 + } + default: + goto tr128 + } + goto tr106 + case 99: + if (m.data)[(m.p)] == 45 { + goto tr129 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr130 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr130 + } + default: + goto tr130 + } + goto tr106 + case 100: + if (m.data)[(m.p)] == 45 { + goto tr131 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr132 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr132 + } + default: + goto tr132 + } + goto tr106 + case 101: + if (m.data)[(m.p)] == 45 { + goto tr133 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr134 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr134 + } + default: + goto tr134 + } + goto tr106 + case 102: + if (m.data)[(m.p)] == 45 { + goto tr135 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr136 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr136 + } + default: + goto tr136 + } + goto tr106 + case 103: + if (m.data)[(m.p)] == 45 { + goto tr137 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr138 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr138 + } + default: + goto tr138 + } + goto tr106 + case 104: + if (m.data)[(m.p)] == 45 { + goto tr139 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr140 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr140 + } + default: + goto tr140 + } + goto tr106 + case 105: + if (m.data)[(m.p)] == 45 { + goto tr141 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr142 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr142 + } + default: + goto tr142 + } + goto tr106 + case 106: + if (m.data)[(m.p)] == 45 { + goto tr143 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr144 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr144 + } + default: + goto tr144 + } + goto tr106 + case 107: + if (m.data)[(m.p)] == 45 { + goto tr145 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr146 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr146 + } + default: + goto tr146 + } + goto tr106 + case 108: + if (m.data)[(m.p)] == 45 { + goto tr147 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr148 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr148 + } + default: + goto tr148 + } + goto tr106 + case 109: + if (m.data)[(m.p)] == 45 { + goto tr149 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr150 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr150 + } + default: + goto tr150 + } + goto tr106 + case 110: + if (m.data)[(m.p)] == 45 { + goto tr151 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr152 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr152 + } + default: + goto tr152 + } + goto tr106 + case 111: + if (m.data)[(m.p)] == 45 { + goto tr153 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr154 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr154 + } + default: + goto tr154 + } + goto tr106 + case 112: + if (m.data)[(m.p)] == 45 { + goto tr155 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr156 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr156 + } + default: + goto tr156 + } + goto tr106 + case 113: + if (m.data)[(m.p)] == 45 { + goto tr157 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr158 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr158 + } + default: + goto tr158 + } + goto tr106 + case 114: + if (m.data)[(m.p)] == 45 { + goto tr159 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr160 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr160 + } + default: + goto tr160 + } + goto tr106 + case 115: + if (m.data)[(m.p)] == 45 { + goto tr161 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr162 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr162 + } + default: + goto tr162 + } + goto tr106 + case 116: + if (m.data)[(m.p)] == 45 { + goto tr163 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr164 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr164 + } + default: + goto tr164 + } + goto tr106 + case 117: + if (m.data)[(m.p)] == 45 { + goto tr165 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr166 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr166 + } + default: + goto tr166 + } + goto tr106 + case 118: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr167 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr167 + } + default: + goto tr167 + } + goto tr106 + case 119: + if (m.data)[(m.p)] == 58 { + goto tr168 + } + goto tr106 + case 120: + switch (m.data)[(m.p)] { + case 33: + goto tr170 + case 37: + goto tr171 + case 61: + goto tr170 + case 95: + goto tr170 + case 126: + goto tr170 + } + switch { + case (m.data)[(m.p)] < 48: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 46 { + goto tr170 + } + case (m.data)[(m.p)] > 59: + switch { + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr170 + } + case (m.data)[(m.p)] >= 64: + goto tr170 + } + default: + goto tr170 + } + goto tr169 + case 177: + switch (m.data)[(m.p)] { + case 33: + goto tr218 + case 35: + goto tr219 + case 37: + goto tr220 + case 61: + goto tr218 + case 63: + goto tr221 + case 95: + goto tr218 + case 126: + goto tr218 + } + switch { + case (m.data)[(m.p)] < 64: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 59 { + goto tr218 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr218 + } + default: + goto tr218 + } + goto tr169 + case 178: + switch (m.data)[(m.p)] { + case 33: + goto tr222 + case 37: + goto tr223 + case 61: + goto tr222 + case 95: + goto tr222 + case 126: + goto tr222 + } + switch { + case (m.data)[(m.p)] < 63: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 59 { + goto tr222 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr222 + } + default: + goto tr222 + } + goto tr183 + case 179: + switch (m.data)[(m.p)] { + case 33: + goto tr224 + case 37: + goto tr225 + case 61: + goto tr224 + case 95: + goto tr224 + case 126: + goto tr224 + } + switch { + case (m.data)[(m.p)] < 63: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 59 { + goto tr224 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr224 + } + default: + goto tr224 + } + goto tr183 + case 121: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr173 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr173 + } + default: + goto tr174 + } + goto tr172 + case 122: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr175 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr175 + } + default: + goto tr176 + } + goto tr172 + case 180: + switch (m.data)[(m.p)] { + case 33: + goto tr224 + case 37: + goto tr225 + case 61: + goto tr224 + case 95: + goto tr224 + case 126: + goto tr224 + } + switch { + case (m.data)[(m.p)] < 63: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 59 { + goto tr224 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr224 + } + default: + goto tr224 + } + goto tr172 + case 123: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr178 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr178 + } + default: + goto tr179 + } + goto tr177 + case 124: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr180 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr180 + } + default: + goto tr181 + } + goto tr177 + case 181: + switch (m.data)[(m.p)] { + case 33: + goto tr218 + case 35: + goto tr219 + case 37: + goto tr220 + case 61: + goto tr218 + case 63: + goto tr221 + case 95: + goto tr218 + case 126: + goto tr218 + } + switch { + case (m.data)[(m.p)] < 64: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 59 { + goto tr218 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr218 + } + default: + goto tr218 + } + goto tr177 + case 125: + switch (m.data)[(m.p)] { + case 43: + goto tr182 + case 61: + goto tr184 + } + goto tr183 + case 126: + switch (m.data)[(m.p)] { + case 33: + goto tr186 + case 37: + goto tr187 + case 61: + goto tr186 + case 63: + goto tr188 + case 95: + goto tr186 + case 126: + goto tr186 + } + switch { + case (m.data)[(m.p)] < 48: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 46 { + goto tr186 + } + case (m.data)[(m.p)] > 59: + switch { + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr186 + } + case (m.data)[(m.p)] >= 64: + goto tr186 + } + default: + goto tr186 + } + goto tr185 + case 182: + switch (m.data)[(m.p)] { + case 33: + goto tr226 + case 35: + goto tr227 + case 37: + goto tr228 + case 61: + goto tr226 + case 63: + goto tr229 + case 95: + goto tr226 + case 126: + goto tr226 + } + switch { + case (m.data)[(m.p)] < 64: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 59 { + goto tr226 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr226 + } + default: + goto tr226 + } + goto tr185 + case 127: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr190 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr190 + } + default: + goto tr191 + } + goto tr189 + case 128: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr192 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr192 + } + default: + goto tr193 + } + goto tr189 + case 183: + switch (m.data)[(m.p)] { + case 33: + goto tr226 + case 35: + goto tr227 + case 37: + goto tr228 + case 61: + goto tr226 + case 63: + goto tr229 + case 95: + goto tr226 + case 126: + goto tr226 + } + switch { + case (m.data)[(m.p)] < 64: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 59 { + goto tr226 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr226 + } + default: + goto tr226 + } + goto tr189 + case 184: + switch (m.data)[(m.p)] { + case 33: + goto tr226 + case 35: + goto tr227 + case 37: + goto tr228 + case 43: + goto tr230 + case 61: + goto tr231 + case 63: + goto tr229 + case 95: + goto tr226 + case 126: + goto tr226 + } + switch { + case (m.data)[(m.p)] < 64: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 59 { + goto tr226 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr226 + } + default: + goto tr226 + } + goto tr185 + case 185: + switch (m.data)[(m.p)] { + case 33: + goto tr232 + case 35: + goto tr233 + case 37: + goto tr234 + case 47: + goto tr226 + case 61: + goto tr232 + case 63: + goto tr235 + case 95: + goto tr232 + case 126: + goto tr232 + } + switch { + case (m.data)[(m.p)] < 64: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 59 { + goto tr232 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr232 + } + default: + goto tr232 + } + goto tr185 + case 186: + switch (m.data)[(m.p)] { + case 33: + goto tr204 + case 35: + goto tr227 + case 37: + goto tr237 + case 47: + goto tr226 + case 61: + goto tr204 + case 63: + goto tr229 + case 95: + goto tr204 + case 126: + goto tr204 + } + switch { + case (m.data)[(m.p)] < 64: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 59 { + goto tr204 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr204 + } + default: + goto tr204 + } + goto tr236 + case 187: + switch (m.data)[(m.p)] { + case 33: + goto tr238 + case 35: + goto tr239 + case 37: + goto tr240 + case 61: + goto tr238 + case 63: + goto tr241 + case 95: + goto tr238 + case 126: + goto tr238 + } + switch { + case (m.data)[(m.p)] < 64: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 59 { + goto tr238 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr238 + } + default: + goto tr238 + } + goto tr203 + case 129: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr195 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr195 + } + default: + goto tr196 + } + goto tr194 + case 130: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr197 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr197 + } + default: + goto tr198 + } + goto tr194 + case 188: + switch (m.data)[(m.p)] { + case 33: + goto tr238 + case 35: + goto tr239 + case 37: + goto tr240 + case 61: + goto tr238 + case 63: + goto tr241 + case 95: + goto tr238 + case 126: + goto tr238 + } + switch { + case (m.data)[(m.p)] < 64: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 59 { + goto tr238 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr238 + } + default: + goto tr238 + } + goto tr194 + case 189: + switch (m.data)[(m.p)] { + case 33: + goto tr238 + case 35: + goto tr239 + case 37: + goto tr240 + case 61: + goto tr242 + case 63: + goto tr241 + case 95: + goto tr238 + case 126: + goto tr238 + } + switch { + case (m.data)[(m.p)] < 64: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 59 { + goto tr238 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr238 + } + default: + goto tr238 + } + goto tr203 + case 190: + switch (m.data)[(m.p)] { + case 33: + goto tr243 + case 35: + goto tr244 + case 37: + goto tr245 + case 47: + goto tr238 + case 61: + goto tr243 + case 63: + goto tr246 + case 95: + goto tr243 + case 126: + goto tr243 + } + switch { + case (m.data)[(m.p)] < 64: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 59 { + goto tr243 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr243 + } + default: + goto tr243 + } + goto tr203 + case 131: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr200 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr200 + } + default: + goto tr201 + } + goto tr199 + case 132: + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr197 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr197 + } + default: + goto tr198 + } + goto tr199 + case 133: + if (m.data)[(m.p)] == 43 { + goto tr202 + } + goto tr185 + case 191: + switch (m.data)[(m.p)] { + case 33: + goto tr232 + case 35: + goto tr233 + case 37: + goto tr234 + case 61: + goto tr232 + case 63: + goto tr247 + case 95: + goto tr232 + case 126: + goto tr232 + } + switch { + case (m.data)[(m.p)] < 48: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 46 { + goto tr232 + } + case (m.data)[(m.p)] > 59: + switch { + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr232 + } + case (m.data)[(m.p)] >= 64: + goto tr232 + } + default: + goto tr232 + } + goto tr185 + case 134: + switch (m.data)[(m.p)] { + case 43: + goto tr202 + case 61: + goto tr184 + } + goto tr185 + case 135: + switch (m.data)[(m.p)] { + case 33: + goto tr204 + case 37: + goto tr205 + case 61: + goto tr204 + case 63: + goto tr206 + case 95: + goto tr204 + case 126: + goto tr204 + } + switch { + case (m.data)[(m.p)] < 48: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 46 { + goto tr204 + } + case (m.data)[(m.p)] > 59: + switch { + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr204 + } + case (m.data)[(m.p)] >= 64: + goto tr204 + } + default: + goto tr204 + } + goto tr203 + case 136: + if (m.data)[(m.p)] == 61 { + goto tr207 + } + goto tr203 + case 192: + switch (m.data)[(m.p)] { + case 33: + goto tr243 + case 35: + goto tr244 + case 37: + goto tr245 + case 61: + goto tr243 + case 63: + goto tr248 + case 95: + goto tr243 + case 126: + goto tr243 + } + switch { + case (m.data)[(m.p)] < 48: + if 36 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 46 { + goto tr243 + } + case (m.data)[(m.p)] > 59: + switch { + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr243 + } + case (m.data)[(m.p)] >= 64: + goto tr243 + } + default: + goto tr243 + } + goto tr203 + case 137: + if (m.data)[(m.p)] == 58 { + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr167 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr167 + } + default: + goto tr167 + } + goto tr106 + case 138: + switch (m.data)[(m.p)] { + case 45: + goto tr165 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr166 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr166 + } + default: + goto tr166 + } + goto tr106 + case 139: + switch (m.data)[(m.p)] { + case 45: + goto tr163 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr164 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr164 + } + default: + goto tr164 + } + goto tr106 + case 140: + switch (m.data)[(m.p)] { + case 45: + goto tr161 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr162 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr162 + } + default: + goto tr162 + } + goto tr106 + case 141: + switch (m.data)[(m.p)] { + case 45: + goto tr159 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr160 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr160 + } + default: + goto tr160 + } + goto tr106 + case 142: + switch (m.data)[(m.p)] { + case 45: + goto tr157 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr158 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr158 + } + default: + goto tr158 + } + goto tr106 + case 143: + switch (m.data)[(m.p)] { + case 45: + goto tr155 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr156 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr156 + } + default: + goto tr156 + } + goto tr106 + case 144: + switch (m.data)[(m.p)] { + case 45: + goto tr153 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr154 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr154 + } + default: + goto tr154 + } + goto tr106 + case 145: + switch (m.data)[(m.p)] { + case 45: + goto tr151 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr152 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr152 + } + default: + goto tr152 + } + goto tr106 + case 146: + switch (m.data)[(m.p)] { + case 45: + goto tr149 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr150 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr150 + } + default: + goto tr150 + } + goto tr106 + case 147: + switch (m.data)[(m.p)] { + case 45: + goto tr147 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr148 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr148 + } + default: + goto tr148 + } + goto tr106 + case 148: + switch (m.data)[(m.p)] { + case 45: + goto tr145 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr146 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr146 + } + default: + goto tr146 + } + goto tr106 + case 149: + switch (m.data)[(m.p)] { + case 45: + goto tr143 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr144 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr144 + } + default: + goto tr144 + } + goto tr106 + case 150: + switch (m.data)[(m.p)] { + case 45: + goto tr141 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr142 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr142 + } + default: + goto tr142 + } + goto tr106 + case 151: + switch (m.data)[(m.p)] { + case 45: + goto tr139 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr140 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr140 + } + default: + goto tr140 + } + goto tr106 + case 152: + switch (m.data)[(m.p)] { + case 45: + goto tr137 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr138 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr138 + } + default: + goto tr138 + } + goto tr106 + case 153: + switch (m.data)[(m.p)] { + case 45: + goto tr135 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr136 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr136 + } + default: + goto tr136 + } + goto tr106 + case 154: + switch (m.data)[(m.p)] { + case 45: + goto tr133 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr134 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr134 + } + default: + goto tr134 + } + goto tr106 + case 155: + switch (m.data)[(m.p)] { + case 45: + goto tr131 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr132 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr132 + } + default: + goto tr132 + } + goto tr106 + case 156: + switch (m.data)[(m.p)] { + case 45: + goto tr129 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr130 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr130 + } + default: + goto tr130 + } + goto tr106 + case 157: + switch (m.data)[(m.p)] { + case 45: + goto tr127 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr128 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr128 + } + default: + goto tr128 + } + goto tr106 + case 158: + switch (m.data)[(m.p)] { + case 45: + goto tr125 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr126 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr126 + } + default: + goto tr126 + } + goto tr106 + case 159: + switch (m.data)[(m.p)] { + case 45: + goto tr123 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr124 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr124 + } + default: + goto tr124 + } + goto tr106 + case 160: + switch (m.data)[(m.p)] { + case 45: + goto tr121 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr122 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr122 + } + default: + goto tr122 + } + goto tr106 + case 161: + switch (m.data)[(m.p)] { + case 45: + goto tr119 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr120 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr120 + } + default: + goto tr120 + } + goto tr106 + case 162: + switch (m.data)[(m.p)] { + case 45: + goto tr117 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr118 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr118 + } + default: + goto tr118 + } + goto tr106 + case 163: + switch (m.data)[(m.p)] { + case 45: + goto tr115 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr116 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr116 + } + default: + goto tr116 + } + goto tr106 + case 164: + switch (m.data)[(m.p)] { + case 45: + goto tr113 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr114 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr114 + } + default: + goto tr114 + } + goto tr106 + case 165: + switch (m.data)[(m.p)] { + case 45: + goto tr111 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr112 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr112 + } + default: + goto tr112 + } + goto tr106 + case 166: + switch (m.data)[(m.p)] { + case 45: + goto tr109 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr110 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr110 + } + default: + goto tr110 + } + goto tr106 + case 167: + switch (m.data)[(m.p)] { + case 45: + goto tr107 + case 82: + goto tr208 + case 114: + goto tr208 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr108 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr108 + } + default: + goto tr108 + } + goto tr103 + case 168: + switch (m.data)[(m.p)] { + case 45: + goto tr109 + case 58: + goto tr168 + case 78: + goto tr209 + case 110: + goto tr209 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr110 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr110 + } + default: + goto tr110 + } + goto tr103 + case 169: + switch (m.data)[(m.p)] { + case 45: + goto tr210 + case 58: + goto tr168 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr112 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr112 + } + default: + goto tr112 + } + goto tr106 + case 170: + switch (m.data)[(m.p)] { + case 45: + goto tr113 + case 48: + goto tr211 + } + switch { + case (m.data)[(m.p)] < 65: + if 49 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr114 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr211 + } + default: + goto tr211 + } + goto tr106 + case 171: + if (m.data)[(m.p)] == 45 { + goto tr115 + } + switch { + case (m.data)[(m.p)] < 65: + if 48 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 57 { + goto tr116 + } + case (m.data)[(m.p)] > 90: + if 97 <= (m.data)[(m.p)] && (m.data)[(m.p)] <= 122 { + goto tr116 + } + default: + goto tr116 + } + goto tr106 + case 193: + switch (m.data)[(m.p)] { + case 10: + goto tr183 + case 13: + goto tr183 + } + goto tr249 + } + + tr183: + m.cs = 0 + goto _again + tr0: + m.cs = 0 + goto f0 + tr5: + m.cs = 0 + goto f3 + tr8: + m.cs = 0 + goto f5 + tr41: + m.cs = 0 + goto f7 + tr44: + m.cs = 0 + goto f8 + tr51: + m.cs = 0 + goto f10 + tr56: + m.cs = 0 + goto f11 + tr74: + m.cs = 0 + goto f13 + tr81: + m.cs = 0 + goto f15 + tr83: + m.cs = 0 + goto f17 + tr86: + m.cs = 0 + goto f19 + tr103: + m.cs = 0 + goto f20 + tr106: + m.cs = 0 + goto f21 + tr169: + m.cs = 0 + goto f22 + tr172: + m.cs = 0 + goto f23 + tr177: + m.cs = 0 + goto f24 + tr185: + m.cs = 0 + goto f25 + tr189: + m.cs = 0 + goto f27 + tr194: + m.cs = 0 + goto f28 + tr199: + m.cs = 0 + goto f29 + tr203: + m.cs = 0 + goto f30 + tr236: + m.cs = 0 + goto f46 + tr1: + m.cs = 2 + goto f1 + tr2: + m.cs = 3 + goto _again + tr3: + m.cs = 4 + goto _again + tr4: + m.cs = 5 + goto f2 + tr6: + m.cs = 6 + goto f4 + tr9: + m.cs = 7 + goto _again + tr11: + m.cs = 8 + goto _again + tr12: + m.cs = 9 + goto _again + tr13: + m.cs = 10 + goto _again + tr14: + m.cs = 11 + goto _again + tr15: + m.cs = 12 + goto _again + tr16: + m.cs = 13 + goto _again + tr17: + m.cs = 14 + goto _again + tr18: + m.cs = 15 + goto _again + tr19: + m.cs = 16 + goto _again + tr20: + m.cs = 17 + goto _again + tr21: + m.cs = 18 + goto _again + tr22: + m.cs = 19 + goto _again + tr23: + m.cs = 20 + goto _again + tr24: + m.cs = 21 + goto _again + tr25: + m.cs = 22 + goto _again + tr26: + m.cs = 23 + goto _again + tr27: + m.cs = 24 + goto _again + tr28: + m.cs = 25 + goto _again + tr29: + m.cs = 26 + goto _again + tr30: + m.cs = 27 + goto _again + tr31: + m.cs = 28 + goto _again + tr32: + m.cs = 29 + goto _again + tr33: + m.cs = 30 + goto _again + tr34: + m.cs = 31 + goto _again + tr35: + m.cs = 32 + goto _again + tr36: + m.cs = 33 + goto _again + tr37: + m.cs = 34 + goto _again + tr38: + m.cs = 35 + goto _again + tr39: + m.cs = 36 + goto _again + tr40: + m.cs = 37 + goto _again + tr10: + m.cs = 38 + goto f6 + tr213: + m.cs = 39 + goto _again + tr43: + m.cs = 39 + goto f4 + tr45: + m.cs = 40 + goto _again + tr46: + m.cs = 40 + goto f9 + tr7: + m.cs = 41 + goto f1 + tr49: + m.cs = 42 + goto _again + tr50: + m.cs = 43 + goto _again + tr52: + m.cs = 45 + goto f1 + tr53: + m.cs = 46 + goto _again + tr54: + m.cs = 47 + goto _again + tr55: + m.cs = 48 + goto f2 + tr57: + m.cs = 49 + goto f4 + tr58: + m.cs = 50 + goto _again + tr59: + m.cs = 51 + goto _again + tr60: + m.cs = 52 + goto _again + tr61: + m.cs = 53 + goto _again + tr62: + m.cs = 54 + goto _again + tr63: + m.cs = 55 + goto _again + tr64: + m.cs = 56 + goto _again + tr65: + m.cs = 57 + goto _again + tr66: + m.cs = 58 + goto _again + tr67: + m.cs = 59 + goto _again + tr68: + m.cs = 60 + goto _again + tr69: + m.cs = 61 + goto _again + tr70: + m.cs = 62 + goto _again + tr71: + m.cs = 63 + goto _again + tr72: + m.cs = 64 + goto _again + tr73: + m.cs = 65 + goto f12 + tr75: + m.cs = 66 + goto f4 + tr78: + m.cs = 67 + goto _again + tr79: + m.cs = 68 + goto _again + tr80: + m.cs = 69 + goto f14 + tr215: + m.cs = 70 + goto f35 + tr217: + m.cs = 71 + goto _again + tr85: + m.cs = 71 + goto f18 + tr87: + m.cs = 72 + goto _again + tr88: + m.cs = 72 + goto f9 + tr76: + m.cs = 73 + goto f4 + tr91: + m.cs = 74 + goto _again + tr92: + m.cs = 75 + goto _again + tr93: + m.cs = 76 + goto _again + tr77: + m.cs = 77 + goto f4 + tr94: + m.cs = 78 + goto _again + tr95: + m.cs = 79 + goto _again + tr96: + m.cs = 80 + goto _again + tr97: + m.cs = 81 + goto _again + tr98: + m.cs = 82 + goto _again + tr99: + m.cs = 84 + goto f1 + tr100: + m.cs = 85 + goto _again + tr101: + m.cs = 86 + goto _again + tr102: + m.cs = 87 + goto f2 + tr104: + m.cs = 88 + goto f4 + tr107: + m.cs = 89 + goto _again + tr109: + m.cs = 90 + goto _again + tr111: + m.cs = 91 + goto _again + tr113: + m.cs = 92 + goto _again + tr115: + m.cs = 93 + goto _again + tr117: + m.cs = 94 + goto _again + tr119: + m.cs = 95 + goto _again + tr121: + m.cs = 96 + goto _again + tr123: + m.cs = 97 + goto _again + tr125: + m.cs = 98 + goto _again + tr127: + m.cs = 99 + goto _again + tr129: + m.cs = 100 + goto _again + tr131: + m.cs = 101 + goto _again + tr133: + m.cs = 102 + goto _again + tr135: + m.cs = 103 + goto _again + tr137: + m.cs = 104 + goto _again + tr139: + m.cs = 105 + goto _again + tr141: + m.cs = 106 + goto _again + tr143: + m.cs = 107 + goto _again + tr145: + m.cs = 108 + goto _again + tr147: + m.cs = 109 + goto _again + tr149: + m.cs = 110 + goto _again + tr151: + m.cs = 111 + goto _again + tr153: + m.cs = 112 + goto _again + tr155: + m.cs = 113 + goto _again + tr157: + m.cs = 114 + goto _again + tr159: + m.cs = 115 + goto _again + tr161: + m.cs = 116 + goto _again + tr163: + m.cs = 117 + goto _again + tr165: + m.cs = 118 + goto _again + tr167: + m.cs = 119 + goto _again + tr168: + m.cs = 120 + goto f6 + tr225: + m.cs = 121 + goto _again + tr223: + m.cs = 121 + goto f4 + tr173: + m.cs = 122 + goto _again + tr174: + m.cs = 122 + goto f9 + tr220: + m.cs = 123 + goto _again + tr171: + m.cs = 123 + goto f4 + tr178: + m.cs = 124 + goto _again + tr179: + m.cs = 124 + goto f9 + tr221: + m.cs = 125 + goto f38 + tr182: + m.cs = 126 + goto _again + tr228: + m.cs = 127 + goto _again + tr187: + m.cs = 127 + goto f26 + tr234: + m.cs = 127 + goto f44 + tr190: + m.cs = 128 + goto _again + tr191: + m.cs = 128 + goto f9 + tr240: + m.cs = 129 + goto _again + tr205: + m.cs = 129 + goto f31 + tr245: + m.cs = 129 + goto f50 + tr195: + m.cs = 130 + goto _again + tr196: + m.cs = 130 + goto f9 + tr237: + m.cs = 131 + goto f31 + tr200: + m.cs = 132 + goto _again + tr201: + m.cs = 132 + goto f9 + tr188: + m.cs = 133 + goto f26 + tr247: + m.cs = 134 + goto f45 + tr184: + m.cs = 135 + goto _again + tr206: + m.cs = 136 + goto f31 + tr248: + m.cs = 136 + goto f50 + tr166: + m.cs = 137 + goto _again + tr164: + m.cs = 138 + goto _again + tr162: + m.cs = 139 + goto _again + tr160: + m.cs = 140 + goto _again + tr158: + m.cs = 141 + goto _again + tr156: + m.cs = 142 + goto _again + tr154: + m.cs = 143 + goto _again + tr152: + m.cs = 144 + goto _again + tr150: + m.cs = 145 + goto _again + tr148: + m.cs = 146 + goto _again + tr146: + m.cs = 147 + goto _again + tr144: + m.cs = 148 + goto _again + tr142: + m.cs = 149 + goto _again + tr140: + m.cs = 150 + goto _again + tr138: + m.cs = 151 + goto _again + tr136: + m.cs = 152 + goto _again + tr134: + m.cs = 153 + goto _again + tr132: + m.cs = 154 + goto _again + tr130: + m.cs = 155 + goto _again + tr128: + m.cs = 156 + goto _again + tr126: + m.cs = 157 + goto _again + tr124: + m.cs = 158 + goto _again + tr122: + m.cs = 159 + goto _again + tr120: + m.cs = 160 + goto _again + tr118: + m.cs = 161 + goto _again + tr116: + m.cs = 162 + goto _again + tr114: + m.cs = 163 + goto _again + tr112: + m.cs = 164 + goto _again + tr110: + m.cs = 165 + goto _again + tr108: + m.cs = 166 + goto _again + tr105: + m.cs = 167 + goto f1 + tr208: + m.cs = 168 + goto _again + tr209: + m.cs = 169 + goto _again + tr210: + m.cs = 170 + goto f2 + tr211: + m.cs = 171 + goto _again + tr212: + m.cs = 172 + goto _again + tr42: + m.cs = 172 + goto f4 + tr47: + m.cs = 173 + goto _again + tr48: + m.cs = 173 + goto f9 + tr214: + m.cs = 174 + goto _again + tr82: + m.cs = 174 + goto f16 + tr216: + m.cs = 175 + goto _again + tr84: + m.cs = 175 + goto f18 + tr89: + m.cs = 176 + goto _again + tr90: + m.cs = 176 + goto f9 + tr218: + m.cs = 177 + goto _again + tr170: + m.cs = 177 + goto f4 + tr219: + m.cs = 178 + goto f38 + tr227: + m.cs = 178 + goto f42 + tr233: + m.cs = 178 + goto f45 + tr239: + m.cs = 178 + goto f48 + tr244: + m.cs = 178 + goto f51 + tr224: + m.cs = 179 + goto _again + tr222: + m.cs = 179 + goto f4 + tr175: + m.cs = 180 + goto _again + tr176: + m.cs = 180 + goto f9 + tr180: + m.cs = 181 + goto _again + tr181: + m.cs = 181 + goto f9 + tr226: + m.cs = 182 + goto _again + tr186: + m.cs = 182 + goto f26 + tr232: + m.cs = 182 + goto f44 + tr192: + m.cs = 183 + goto _again + tr193: + m.cs = 183 + goto f9 + tr229: + m.cs = 184 + goto f42 + tr235: + m.cs = 184 + goto f45 + tr230: + m.cs = 185 + goto _again + tr231: + m.cs = 186 + goto _again + tr238: + m.cs = 187 + goto _again + tr204: + m.cs = 187 + goto f31 + tr243: + m.cs = 187 + goto f50 + tr197: + m.cs = 188 + goto _again + tr198: + m.cs = 188 + goto f9 + tr241: + m.cs = 189 + goto _again + tr246: + m.cs = 189 + goto f50 + tr242: + m.cs = 190 + goto _again + tr202: + m.cs = 191 + goto _again + tr207: + m.cs = 192 + goto _again + tr249: + m.cs = 193 + goto _again + + f4: + + m.pb = m.p + + goto _again + f9: + + // List of positions in the buffer to later lowercase + output.tolower = append(output.tolower, m.p-m.pb) + + goto _again + f2: + + output.prefix = string(m.text()) + + goto _again + f6: + + output.ID = string(m.text()) + + goto _again + f38: + + output.SS = string(m.text()) + // Iterate upper letters lowering them + for _, i := range output.tolower { + m.data[m.pb+i] = m.data[m.pb+i] + 32 + } + output.norm = string(m.text()) + // Revert the buffer to the original + for _, i := range output.tolower { + m.data[m.pb+i] = m.data[m.pb+i] - 32 + } + + goto _again + f0: + + m.err = fmt.Errorf(errPrefix, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f5: + + m.err = fmt.Errorf(errIdentifier, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f7: + + m.err = fmt.Errorf(errSpecificString, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f23: + + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } + + goto _again + f11: + + m.err = fmt.Errorf(errSCIMNamespace, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f13: + + m.err = fmt.Errorf(errSCIMType, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f15: + + m.err = fmt.Errorf(errSCIMName, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f17: + + if m.p == m.pe { + m.err = fmt.Errorf(errSCIMOtherIncomplete, m.p-1) + } else { + m.err = fmt.Errorf(errSCIMOther, m.p) + } + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f14: + + output.scim.Type = scimschema.TypeFromString(string(m.text())) + + goto _again + f16: + + output.scim.pos = m.p + + goto _again + f35: + + output.scim.Name = string(m.data[output.scim.pos:m.p]) + + goto _again + f18: + + output.scim.pos = m.p + + goto _again + f22: + + m.err = fmt.Errorf(err8141SpecificString, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f21: + + m.err = fmt.Errorf(err8141Identifier, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f42: + + output.rComponent = string(m.text()) + + goto _again + f48: + + output.qComponent = string(m.text()) + + goto _again + f44: + + if output.rStart { + m.err = fmt.Errorf(err8141RComponentStart, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } + output.rStart = true + + goto _again + f50: + + if output.qStart { + m.err = fmt.Errorf(err8141QComponentStart, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } + output.qStart = true + + goto _again + f25: + + m.err = fmt.Errorf(err8141MalformedRComp, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f30: + + m.err = fmt.Errorf(err8141MalformedQComp, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f1: + + m.pb = m.p + + if m.parsingMode != RFC8141Only { + // Throw an error when: + // - we are entering here matching the the prefix in the namespace identifier part + // - looking ahead (3 chars) we find a colon + if pos := m.p + 3; pos < m.pe && m.data[pos] == 58 && output.prefix != "" { + m.err = fmt.Errorf(errNoUrnWithinID, pos) + (m.p)-- + + m.cs = 193 + goto _again + + } + } + + goto _again + f12: + + output.ID = string(m.text()) + + output.scim = &SCIM{} + + goto _again + f3: + + m.err = fmt.Errorf(errIdentifier, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + m.err = fmt.Errorf(errPrefix, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f10: + + m.err = fmt.Errorf(errIdentifier, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + m.err = fmt.Errorf(errNoUrnWithinID, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f8: + + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } + + m.err = fmt.Errorf(errSpecificString, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f19: + + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } + + if m.p == m.pe { + m.err = fmt.Errorf(errSCIMOtherIncomplete, m.p-1) + } else { + m.err = fmt.Errorf(errSCIMOther, m.p) + } + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f24: + + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } + + m.err = fmt.Errorf(err8141SpecificString, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f27: + + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } + + m.err = fmt.Errorf(err8141MalformedRComp, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f28: + + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } + + m.err = fmt.Errorf(err8141MalformedQComp, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f20: + + m.err = fmt.Errorf(err8141Identifier, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + m.err = fmt.Errorf(errPrefix, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f26: + + if output.rStart { + m.err = fmt.Errorf(err8141RComponentStart, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } + output.rStart = true + + m.pb = m.p + + goto _again + f45: + + if output.rStart { + m.err = fmt.Errorf(err8141RComponentStart, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } + output.rStart = true + + output.rComponent = string(m.text()) + + goto _again + f31: + + if output.qStart { + m.err = fmt.Errorf(err8141QComponentStart, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } + output.qStart = true + + m.pb = m.p + + goto _again + f51: + + if output.qStart { + m.err = fmt.Errorf(err8141QComponentStart, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } + output.qStart = true + + output.qComponent = string(m.text()) + + goto _again + f46: + + m.err = fmt.Errorf(err8141MalformedRComp, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + m.err = fmt.Errorf(err8141MalformedQComp, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + f29: + + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } + + m.err = fmt.Errorf(err8141MalformedRComp, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + m.err = fmt.Errorf(err8141MalformedQComp, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + goto _again + + _again: + switch _toStateActions[m.cs] { + case 33: + + (m.p)-- + + m.err = fmt.Errorf(err8141InformalID, m.p) + m.cs = 193 + goto _again + } + + if m.cs == 0 { + goto _out + } + if (m.p)++; (m.p) != (m.pe) { + goto _resume + } + _testEof: + { + } + if (m.p) == (m.eof) { + switch _eofActions[m.cs] { + case 1: + + m.err = fmt.Errorf(errPrefix, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + case 6: + + m.err = fmt.Errorf(errIdentifier, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + case 8: + + m.err = fmt.Errorf(errSpecificString, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + case 24: + + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } + + case 12: + + m.err = fmt.Errorf(errSCIMNamespace, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + case 14: + + m.err = fmt.Errorf(errSCIMType, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + case 16: + + m.err = fmt.Errorf(errSCIMName, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + case 18: + + if m.p == m.pe { + m.err = fmt.Errorf(errSCIMOtherIncomplete, m.p-1) + } else { + m.err = fmt.Errorf(errSCIMOther, m.p) + } + (m.p)-- + + m.cs = 193 + goto _again + + case 23: + + m.err = fmt.Errorf(err8141SpecificString, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + case 22: + + m.err = fmt.Errorf(err8141Identifier, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + case 26: + + m.err = fmt.Errorf(err8141MalformedRComp, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + case 31: + + m.err = fmt.Errorf(err8141MalformedQComp, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + case 34: + + output.SS = string(m.text()) + // Iterate upper letters lowering them + for _, i := range output.tolower { + m.data[m.pb+i] = m.data[m.pb+i] + 32 + } + output.norm = string(m.text()) + // Revert the buffer to the original + for _, i := range output.tolower { + m.data[m.pb+i] = m.data[m.pb+i] - 32 + } + + output.kind = RFC2141 + + case 38: + + output.SS = string(m.text()) + // Iterate upper letters lowering them + for _, i := range output.tolower { + m.data[m.pb+i] = m.data[m.pb+i] + 32 + } + output.norm = string(m.text()) + // Revert the buffer to the original + for _, i := range output.tolower { + m.data[m.pb+i] = m.data[m.pb+i] - 32 + } + + output.kind = RFC8141 + + case 4: + + m.err = fmt.Errorf(errIdentifier, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + m.err = fmt.Errorf(errPrefix, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + case 11: + + m.err = fmt.Errorf(errIdentifier, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + m.err = fmt.Errorf(errNoUrnWithinID, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + case 9: + + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } + + m.err = fmt.Errorf(errSpecificString, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + case 20: + + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } + + if m.p == m.pe { + m.err = fmt.Errorf(errSCIMOtherIncomplete, m.p-1) + } else { + m.err = fmt.Errorf(errSCIMOther, m.p) + } + (m.p)-- + + m.cs = 193 + goto _again + + case 25: + + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } + + m.err = fmt.Errorf(err8141SpecificString, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + case 28: + + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } + + m.err = fmt.Errorf(err8141MalformedRComp, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + case 29: + + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } + + m.err = fmt.Errorf(err8141MalformedQComp, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + case 21: + + m.err = fmt.Errorf(err8141Identifier, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + m.err = fmt.Errorf(errPrefix, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + case 42: + + output.rComponent = string(m.text()) + + output.kind = RFC8141 + + case 48: + + output.qComponent = string(m.text()) + + output.kind = RFC8141 + + case 41: + + output.fComponent = string(m.text()) + + output.kind = RFC8141 + + case 40: + + m.pb = m.p + + output.fComponent = string(m.text()) + + output.kind = RFC8141 + + case 30: + + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } + + m.err = fmt.Errorf(err8141MalformedRComp, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + m.err = fmt.Errorf(err8141MalformedQComp, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + case 35: + + output.scim.Name = string(m.data[output.scim.pos:m.p]) + + output.SS = string(m.text()) + // Iterate upper letters lowering them + for _, i := range output.tolower { + m.data[m.pb+i] = m.data[m.pb+i] + 32 + } + output.norm = string(m.text()) + // Revert the buffer to the original + for _, i := range output.tolower { + m.data[m.pb+i] = m.data[m.pb+i] - 32 + } + + output.kind = RFC7643 + + case 37: + + output.scim.Other = string(m.data[output.scim.pos:m.p]) + + output.SS = string(m.text()) + // Iterate upper letters lowering them + for _, i := range output.tolower { + m.data[m.pb+i] = m.data[m.pb+i] + 32 + } + output.norm = string(m.text()) + // Revert the buffer to the original + for _, i := range output.tolower { + m.data[m.pb+i] = m.data[m.pb+i] - 32 + } + + output.kind = RFC7643 + + case 44: + + if output.rStart { + m.err = fmt.Errorf(err8141RComponentStart, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } + output.rStart = true + + output.rComponent = string(m.text()) + + output.kind = RFC8141 + + case 50: + + if output.qStart { + m.err = fmt.Errorf(err8141QComponentStart, m.p) + (m.p)-- + + m.cs = 193 + goto _again + + } + output.qStart = true + + output.qComponent = string(m.text()) + + output.kind = RFC8141 + } + } + + _out: + { + } + } + + if m.cs < firstFinal || m.cs == enFail { + return nil, m.err + } + + return output, nil +} + +func (m *machine) WithParsingMode(x ParsingMode) { + m.parsingMode = x + switch m.parsingMode { + case RFC2141Only: + m.startParsingAt = enMain + case RFC8141Only: + m.startParsingAt = enRfc8141Only + case RFC7643Only: + m.startParsingAt = enScimOnly + } + m.parsingModeSet = true +} diff --git a/vendor/github.com/leodido/go-urn/machine.go.rl b/vendor/github.com/leodido/go-urn/machine.go.rl new file mode 100644 index 00000000..0a174219 --- /dev/null +++ b/vendor/github.com/leodido/go-urn/machine.go.rl @@ -0,0 +1,386 @@ +package urn + +import ( + "fmt" + + scimschema "github.com/leodido/go-urn/scim/schema" +) + +var ( + errPrefix = "expecting the prefix to be the \"urn\" string (whatever case) [col %d]" + errIdentifier = "expecting the identifier to be string (1..31 alnum chars, also containing dashes but not at its beginning) [col %d]" + errSpecificString = "expecting the specific string to be a string containing alnum, hex, or others ([()+,-.:=@;$_!*']) chars [col %d]" + errNoUrnWithinID = "expecting the identifier to not contain the \"urn\" reserved string [col %d]" + errHex = "expecting the percent encoded chars to be well-formed (%%alnum{2}) [col %d]" + errSCIMNamespace = "expecing the SCIM namespace identifier (ietf:params:scim) [col %d]" + errSCIMType = "expecting a correct SCIM type (schemas, api, param) [col %d]" + errSCIMName = "expecting one or more alnum char in the SCIM name part [col %d]" + errSCIMOther = "expecting a well-formed other SCIM part [col %d]" + errSCIMOtherIncomplete = "expecting a not empty SCIM other part after colon [col %d]" + err8141InformalID = "informal URN namespace must be in the form urn-[1-9][0-9] [col %d]" + err8141SpecificString = "expecting the specific string to contain alnum, hex, or others ([~&()+,-.:=@;$_!*'] or [/?] not in first position) chars [col %d]" + err8141Identifier = "expecting the indentifier to be a string with (length 2 to 32 chars) containing alnum (or dashes) not starting or ending with a dash [col %d]" + err8141RComponentStart = "expecting only one r-component (starting with the ?+ sequence) [col %d]" + err8141QComponentStart = "expecting only one q-component (starting with the ?= sequence) [col %d]" + err8141MalformedRComp = "expecting a non-empty r-component containing alnum, hex, or others ([~&()+,-.:=@;$_!*'] or [/?] but not at its beginning) [col %d]" + err8141MalformedQComp = "expecting a non-empty q-component containing alnum, hex, or others ([~&()+,-.:=@;$_!*'] or [/?] but not at its beginning) [col %d]" +) + +%%{ +machine urn; + +# unsigned alphabet +alphtype uint8; + +action mark { + m.pb = m.p +} + +action tolower { + // List of positions in the buffer to later lowercase + output.tolower = append(output.tolower, m.p - m.pb) +} + +action set_pre { + output.prefix = string(m.text()) +} + +action throw_pre_urn_err { + if m.parsingMode != RFC8141Only { + // Throw an error when: + // - we are entering here matching the the prefix in the namespace identifier part + // - looking ahead (3 chars) we find a colon + if pos := m.p + 3; pos < m.pe && m.data[pos] == 58 && output.prefix != "" { + m.err = fmt.Errorf(errNoUrnWithinID, pos) + fhold; + fgoto fail; + } + } +} + +action set_nid { + output.ID = string(m.text()) +} + +action set_nss { + output.SS = string(m.text()) + // Iterate upper letters lowering them + for _, i := range output.tolower { + m.data[m.pb+i] = m.data[m.pb+i] + 32 + } + output.norm = string(m.text()) + // Revert the buffer to the original + for _, i := range output.tolower { + m.data[m.pb+i] = m.data[m.pb+i] - 32 + } +} + +action err_pre { + m.err = fmt.Errorf(errPrefix, m.p) + fhold; + fgoto fail; +} + +action err_nid { + m.err = fmt.Errorf(errIdentifier, m.p) + fhold; + fgoto fail; +} + +action err_nss { + m.err = fmt.Errorf(errSpecificString, m.p) + fhold; + fgoto fail; +} + +action err_urn { + m.err = fmt.Errorf(errNoUrnWithinID, m.p) + fhold; + fgoto fail; +} + +action err_hex { + if m.parsingMode == RFC2141Only || m.parsingMode == RFC8141Only { + m.err = fmt.Errorf(errHex, m.p) + fhold; + fgoto fail; + } +} + +action base_type { + output.kind = RFC2141; +} + +pre = ([uU] @err(err_pre) [rR] @err(err_pre) [nN] @err(err_pre)) >mark >throw_pre_urn_err %set_pre; + +nid = (alnum >mark (alnum | '-'){0,31}) $err(err_nid) %set_nid; + +hex = '%' (digit | lower | upper >tolower){2} $err(err_hex); + +sss = (alnum | [()+,\-.:=@;$_!*']); + +nss = (sss | hex)+ $err(err_nss); + +nid_not_urn = (nid - pre %err(err_urn)); + +urn = pre ':' @err(err_pre) (nid_not_urn ':' nss >mark %set_nss) %eof(base_type); + +### SCIM BEG + +action err_scim_nid { + m.err = fmt.Errorf(errSCIMNamespace, m.p) + fhold; + fgoto fail; +} + +action err_scim_type { + m.err = fmt.Errorf(errSCIMType, m.p) + fhold; + fgoto fail; +} + +action err_scim_name { + m.err = fmt.Errorf(errSCIMName, m.p) + fhold; + fgoto fail; +} + +action err_scim_other { + if m.p == m.pe { + m.err = fmt.Errorf(errSCIMOtherIncomplete, m.p-1) + } else { + m.err = fmt.Errorf(errSCIMOther, m.p) + } + fhold; + fgoto fail; +} + +action scim_type { + output.kind = RFC7643; +} + +action create_scim { + output.scim = &SCIM{}; +} + +action set_scim_type { + output.scim.Type = scimschema.TypeFromString(string(m.text())) +} + +action mark_scim_name { + output.scim.pos = m.p +} + +action set_scim_name { + output.scim.Name = string(m.data[output.scim.pos:m.p]) +} + +action mark_scim_other { + output.scim.pos = m.p +} + +action set_scim_other { + output.scim.Other = string(m.data[output.scim.pos:m.p]) +} + +scim_nid = 'ietf:params:scim' >mark %set_nid %create_scim $err(err_scim_nid); + +scim_other = ':' (sss | hex)+ >mark_scim_other %set_scim_other $err(err_scim_other); + +scim_name = (alnum)+ >mark_scim_name %set_scim_name $err(err_scim_name); + +scim_type = ('schemas' | 'api' | 'param') >mark %set_scim_type $err(err_scim_type); + +scim_only := pre ':' @err(err_pre) (scim_nid ':' scim_type ':' scim_name scim_other? %set_nss) %eof(scim_type); + +### SCIM END + +### 8141 BEG + +action err_nss_8141 { + m.err = fmt.Errorf(err8141SpecificString, m.p) + fhold; + fgoto fail; +} + +action err_nid_8141 { + m.err = fmt.Errorf(err8141Identifier, m.p) + fhold; + fgoto fail; +} + +action rfc8141_type { + output.kind = RFC8141; +} + +action set_r_component { + output.rComponent = string(m.text()) +} + +action set_q_component { + output.qComponent = string(m.text()) +} + +action set_f_component { + output.fComponent = string(m.text()) +} + +action informal_nid_match { + fhold; + m.err = fmt.Errorf(err8141InformalID, m.p); + fgoto fail; +} + +action mark_r_start { + if output.rStart { + m.err = fmt.Errorf(err8141RComponentStart, m.p) + fhold; + fgoto fail; + } + output.rStart = true +} + +action mark_q_start { + if output.qStart { + m.err = fmt.Errorf(err8141QComponentStart, m.p) + fhold; + fgoto fail; + } + output.qStart = true +} + +action err_malformed_r_component { + m.err = fmt.Errorf(err8141MalformedRComp, m.p) + fhold; + fgoto fail; +} + +action err_malformed_q_component { + m.err = fmt.Errorf(err8141MalformedQComp, m.p) + fhold; + fgoto fail; +} + +pchar = (sss | '~' | '&' | hex); + +component = pchar (pchar | '/' | '?')*; + +r_start = ('?+') %mark_r_start; + +r_component = r_start <: (r_start | component)+ $err(err_malformed_r_component) >mark %set_r_component; + +q_start = ('?=') %mark_q_start; + +q_component = q_start <: (q_start | component)+ $err(err_malformed_q_component) >mark %set_q_component; + +rq_components = (r_component :>> q_component? | q_component); + +fragment = (pchar | '/' | '?')*; + +f_component = '#' fragment >mark %set_f_component; + +nss_rfc8141 = (pchar >mark (pchar | '/')*) $err(err_nss_8141) %set_nss; + +nid_rfc8141 = (alnum >mark (alnum | '-'){0,30} alnum) $err(err_nid_8141) %set_nid; + +informal_id = pre ('-' [a-zA-z0] %to(informal_nid_match)); + +nid_rfc8141_not_urn = (nid_rfc8141 - informal_id?); + +rfc8141_only := pre ':' @err(err_pre) nid_rfc8141_not_urn ':' nss_rfc8141 rq_components? f_component? %eof(rfc8141_type); + +### 8141 END + +fail := (any - [\n\r])* @err{ fgoto main; }; + +main := urn; + +}%% + +%% write data noerror noprefix; + +// Machine is the interface representing the FSM +type Machine interface { + Error() error + Parse(input []byte) (*URN, error) + WithParsingMode(ParsingMode) +} + +type machine struct { + data []byte + cs int + p, pe, eof, pb int + err error + startParsingAt int + parsingMode ParsingMode + parsingModeSet bool +} + +// NewMachine creates a new FSM able to parse RFC 2141 strings. +func NewMachine(options ...Option) Machine { + m := &machine{ + parsingModeSet: false, + } + + for _, o := range options { + o(m) + } + // Set default parsing mode + if !m.parsingModeSet { + m.WithParsingMode(DefaultParsingMode) + } + + %% access m.; + %% variable p m.p; + %% variable pe m.pe; + %% variable eof m.eof; + %% variable data m.data; + + return m +} + +// Err returns the error that occurred on the last call to Parse. +// +// If the result is nil, then the line was parsed successfully. +func (m *machine) Error() error { + return m.err +} + +func (m *machine) text() []byte { + return m.data[m.pb:m.p] +} + +// Parse parses the input byte array as a RFC 2141 or RFC7643 string. +func (m *machine) Parse(input []byte) (*URN, error) { + m.data = input + m.p = 0 + m.pb = 0 + m.pe = len(input) + m.eof = len(input) + m.err = nil + m.cs = m.startParsingAt + output := &URN{ + tolower: []int{}, + } + + %% write exec; + + if m.cs < first_final || m.cs == en_fail { + return nil, m.err + } + + return output, nil +} + +func (m *machine) WithParsingMode(x ParsingMode) { + m.parsingMode = x + switch m.parsingMode { + case RFC2141Only: + m.startParsingAt = en_main + case RFC8141Only: + m.startParsingAt = en_rfc8141_only + case RFC7643Only: + m.startParsingAt = en_scim_only + } + m.parsingModeSet = true +} \ No newline at end of file diff --git a/vendor/github.com/leodido/go-urn/makefile b/vendor/github.com/leodido/go-urn/makefile new file mode 100644 index 00000000..68d5dd0f --- /dev/null +++ b/vendor/github.com/leodido/go-urn/makefile @@ -0,0 +1,51 @@ +SHELL := /bin/bash +RAGEL := ragel +GOFMT := go fmt + +export GO_TEST=env GOTRACEBACK=all go test $(GO_ARGS) + +.PHONY: build +build: machine.go + +.PHONY: clean +clean: + @rm -rf docs + @rm -f machine.go + +.PHONY: images +images: docs/urn.png + +.PHONY: snake2camel +snake2camel: + @cd ./tools/snake2camel; go build -o ../../snake2camel . + +.PHONY: removecomments +removecomments: + @cd ./tools/removecomments; go build -o ../../removecomments . + +machine.go: machine.go.rl + +machine.go: snake2camel + +machine.go: removecomments + +machine.go: + $(RAGEL) -Z -G1 -e -o $@ $< + @./removecomments $@ + @./snake2camel $@ + $(GOFMT) $@ + +docs/urn.dot: machine.go.rl + @mkdir -p docs + $(RAGEL) -Z -e -Vp $< -o $@ + +docs/urn.png: docs/urn.dot + dot $< -Tpng -o $@ + +.PHONY: bench +bench: *_test.go machine.go + go test -bench=. -benchmem -benchtime=5s ./... + +.PHONY: tests +tests: *_test.go + $(GO_TEST) ./... diff --git a/vendor/github.com/leodido/go-urn/options.go b/vendor/github.com/leodido/go-urn/options.go new file mode 100644 index 00000000..c543835a --- /dev/null +++ b/vendor/github.com/leodido/go-urn/options.go @@ -0,0 +1,9 @@ +package urn + +type Option func(Machine) + +func WithParsingMode(mode ParsingMode) Option { + return func(m Machine) { + m.WithParsingMode(mode) + } +} diff --git a/vendor/github.com/leodido/go-urn/parsing_mode.go b/vendor/github.com/leodido/go-urn/parsing_mode.go new file mode 100644 index 00000000..fce5aadc --- /dev/null +++ b/vendor/github.com/leodido/go-urn/parsing_mode.go @@ -0,0 +1,12 @@ +package urn + +type ParsingMode int + +const ( + Default ParsingMode = iota + RFC2141Only + RFC7643Only + RFC8141Only +) + +const DefaultParsingMode = RFC2141Only diff --git a/vendor/github.com/leodido/go-urn/scim.go b/vendor/github.com/leodido/go-urn/scim.go new file mode 100644 index 00000000..f6b7aefb --- /dev/null +++ b/vendor/github.com/leodido/go-urn/scim.go @@ -0,0 +1,48 @@ +package urn + +import ( + "encoding/json" + "fmt" + + scimschema "github.com/leodido/go-urn/scim/schema" +) + +const errInvalidSCIMURN = "invalid SCIM URN: %s" + +type SCIM struct { + Type scimschema.Type + Name string + Other string + pos int +} + +func (s SCIM) MarshalJSON() ([]byte, error) { + return json.Marshal(s.String()) +} + +func (s *SCIM) UnmarshalJSON(bytes []byte) error { + var str string + if err := json.Unmarshal(bytes, &str); err != nil { + return err + } + // Parse as SCIM + value, ok := Parse([]byte(str), WithParsingMode(RFC7643Only)) + if !ok { + return fmt.Errorf(errInvalidSCIMURN, str) + } + if value.RFC() != RFC7643 { + return fmt.Errorf(errInvalidSCIMURN, str) + } + *s = *value.SCIM() + + return nil +} + +func (s *SCIM) String() string { + ret := fmt.Sprintf("urn:ietf:params:scim:%s:%s", s.Type.String(), s.Name) + if s.Other != "" { + ret += fmt.Sprintf(":%s", s.Other) + } + + return ret +} diff --git a/vendor/github.com/leodido/go-urn/scim/schema/type.go b/vendor/github.com/leodido/go-urn/scim/schema/type.go new file mode 100644 index 00000000..13491823 --- /dev/null +++ b/vendor/github.com/leodido/go-urn/scim/schema/type.go @@ -0,0 +1,36 @@ +package scimschema + +type Type int + +const ( + Unsupported Type = iota + Schemas + API + Param +) + +func (t Type) String() string { + switch t { + case Schemas: + return "schemas" + case API: + return "api" + case Param: + return "param" + } + + return "" +} + +func TypeFromString(input string) Type { + switch input { + case "schemas": + return Schemas + case "api": + return API + case "param": + return Param + } + + return Unsupported +} diff --git a/vendor/github.com/leodido/go-urn/urn.go b/vendor/github.com/leodido/go-urn/urn.go new file mode 100644 index 00000000..894d6258 --- /dev/null +++ b/vendor/github.com/leodido/go-urn/urn.go @@ -0,0 +1,141 @@ +package urn + +import ( + "encoding/json" + "fmt" + "strings" +) + +const errInvalidURN = "invalid URN: %s" + +// URN represents an Uniform Resource Name. +// +// The general form represented is: +// +// urn:: +// +// Details at https://tools.ietf.org/html/rfc2141. +type URN struct { + prefix string // Static prefix. Equal to "urn" when empty. + ID string // Namespace identifier (NID) + SS string // Namespace specific string (NSS) + norm string // Normalized namespace specific string + kind Kind + scim *SCIM + rComponent string // RFC8141 + qComponent string // RFC8141 + fComponent string // RFC8141 + rStart bool // RFC8141 + qStart bool // RFC8141 + tolower []int +} + +// Normalize turns the receiving URN into its norm version. +// +// Which means: lowercase prefix, lowercase namespace identifier, and immutate namespace specific string chars (except tokens which are lowercased). +func (u *URN) Normalize() *URN { + return &URN{ + prefix: "urn", + ID: strings.ToLower(u.ID), + SS: u.norm, + // rComponent: u.rComponent, + // qComponent: u.qComponent, + // fComponent: u.fComponent, + } +} + +// Equal checks the lexical equivalence of the current URN with another one. +func (u *URN) Equal(x *URN) bool { + if x == nil { + return false + } + nu := u.Normalize() + nx := x.Normalize() + + return nu.prefix == nx.prefix && nu.ID == nx.ID && nu.SS == nx.SS +} + +// String reassembles the URN into a valid URN string. +// +// This requires both ID and SS fields to be non-empty. +// Otherwise it returns an empty string. +// +// Default URN prefix is "urn". +func (u *URN) String() string { + var res string + if u.ID != "" && u.SS != "" { + if u.prefix == "" { + res += "urn" + } + res += u.prefix + ":" + u.ID + ":" + u.SS + if u.rComponent != "" { + res += "?+" + u.rComponent + } + if u.qComponent != "" { + res += "?=" + u.qComponent + } + if u.fComponent != "" { + res += "#" + u.fComponent + } + } + + return res +} + +// Parse is responsible to create an URN instance from a byte array matching the correct URN syntax (RFC 2141). +func Parse(u []byte, options ...Option) (*URN, bool) { + urn, err := NewMachine(options...).Parse(u) + if err != nil { + return nil, false + } + + return urn, true +} + +// MarshalJSON marshals the URN to JSON string form (e.g. `"urn:oid:1.2.3.4"`). +func (u URN) MarshalJSON() ([]byte, error) { + return json.Marshal(u.String()) +} + +// UnmarshalJSON unmarshals a URN from JSON string form (e.g. `"urn:oid:1.2.3.4"`). +func (u *URN) UnmarshalJSON(bytes []byte) error { + var str string + if err := json.Unmarshal(bytes, &str); err != nil { + return err + } + if value, ok := Parse([]byte(str)); !ok { + return fmt.Errorf(errInvalidURN, str) + } else { + *u = *value + } + + return nil +} + +func (u *URN) IsSCIM() bool { + return u.kind == RFC7643 +} + +func (u *URN) SCIM() *SCIM { + if u.kind != RFC7643 { + return nil + } + + return u.scim +} + +func (u *URN) RFC() Kind { + return u.kind +} + +func (u *URN) FComponent() string { + return u.fComponent +} + +func (u *URN) QComponent() string { + return u.qComponent +} + +func (u *URN) RComponent() string { + return u.rComponent +} diff --git a/vendor/github.com/leodido/go-urn/urn8141.go b/vendor/github.com/leodido/go-urn/urn8141.go new file mode 100644 index 00000000..da4dd062 --- /dev/null +++ b/vendor/github.com/leodido/go-urn/urn8141.go @@ -0,0 +1,30 @@ +package urn + +import ( + "encoding/json" + "fmt" +) + +const errInvalidURN8141 = "invalid URN per RFC 8141: %s" + +type URN8141 struct { + *URN +} + +func (u URN8141) MarshalJSON() ([]byte, error) { + return json.Marshal(u.String()) +} + +func (u *URN8141) UnmarshalJSON(bytes []byte) error { + var str string + if err := json.Unmarshal(bytes, &str); err != nil { + return err + } + if value, ok := Parse([]byte(str), WithParsingMode(RFC8141Only)); !ok { + return fmt.Errorf(errInvalidURN8141, str) + } else { + *u = URN8141{value} + } + + return nil +} diff --git a/vendor/golang.org/x/crypto/LICENSE b/vendor/golang.org/x/crypto/LICENSE new file mode 100644 index 00000000..2a7cf70d --- /dev/null +++ b/vendor/golang.org/x/crypto/LICENSE @@ -0,0 +1,27 @@ +Copyright 2009 The Go Authors. + +Redistribution and use in source and binary forms, with or without +modification, are permitted provided that the following conditions are +met: + + * Redistributions of source code must retain the above copyright +notice, this list of conditions and the following disclaimer. + * Redistributions in binary form must reproduce the above +copyright notice, this list of conditions and the following disclaimer +in the documentation and/or other materials provided with the +distribution. + * Neither the name of Google LLC nor the names of its +contributors may be used to endorse or promote products derived from +this software without specific prior written permission. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. diff --git a/vendor/golang.org/x/crypto/PATENTS b/vendor/golang.org/x/crypto/PATENTS new file mode 100644 index 00000000..73309904 --- /dev/null +++ b/vendor/golang.org/x/crypto/PATENTS @@ -0,0 +1,22 @@ +Additional IP Rights Grant (Patents) + +"This implementation" means the copyrightable works distributed by +Google as part of the Go project. + +Google hereby grants to You a perpetual, worldwide, non-exclusive, +no-charge, royalty-free, irrevocable (except as stated in this section) +patent license to make, have made, use, offer to sell, sell, import, +transfer and otherwise run, modify and propagate the contents of this +implementation of Go, where such license applies only to those patent +claims, both currently owned or controlled by Google and acquired in +the future, licensable by Google that are necessarily infringed by this +implementation of Go. This grant does not include claims that would be +infringed only as a consequence of further modification of this +implementation. If you or your agent or exclusive licensee institute or +order or agree to the institution of patent litigation against any +entity (including a cross-claim or counterclaim in a lawsuit) alleging +that this implementation of Go or any code incorporated within this +implementation of Go constitutes direct or contributory patent +infringement, or inducement of patent infringement, then any patent +rights granted to you under this License for this implementation of Go +shall terminate as of the date such litigation is filed. diff --git a/vendor/golang.org/x/crypto/sha3/doc.go b/vendor/golang.org/x/crypto/sha3/doc.go new file mode 100644 index 00000000..bbf391fe --- /dev/null +++ b/vendor/golang.org/x/crypto/sha3/doc.go @@ -0,0 +1,66 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package sha3 implements the SHA-3 fixed-output-length hash functions and +// the SHAKE variable-output-length hash functions defined by FIPS-202. +// +// All types in this package also implement [encoding.BinaryMarshaler], +// [encoding.BinaryAppender] and [encoding.BinaryUnmarshaler] to marshal and +// unmarshal the internal state of the hash. +// +// Both types of hash function use the "sponge" construction and the Keccak +// permutation. For a detailed specification see http://keccak.noekeon.org/ +// +// # Guidance +// +// If you aren't sure what function you need, use SHAKE256 with at least 64 +// bytes of output. The SHAKE instances are faster than the SHA3 instances; +// the latter have to allocate memory to conform to the hash.Hash interface. +// +// If you need a secret-key MAC (message authentication code), prepend the +// secret key to the input, hash with SHAKE256 and read at least 32 bytes of +// output. +// +// # Security strengths +// +// The SHA3-x (x equals 224, 256, 384, or 512) functions have a security +// strength against preimage attacks of x bits. Since they only produce "x" +// bits of output, their collision-resistance is only "x/2" bits. +// +// The SHAKE-256 and -128 functions have a generic security strength of 256 and +// 128 bits against all attacks, provided that at least 2x bits of their output +// is used. Requesting more than 64 or 32 bytes of output, respectively, does +// not increase the collision-resistance of the SHAKE functions. +// +// # The sponge construction +// +// A sponge builds a pseudo-random function from a public pseudo-random +// permutation, by applying the permutation to a state of "rate + capacity" +// bytes, but hiding "capacity" of the bytes. +// +// A sponge starts out with a zero state. To hash an input using a sponge, up +// to "rate" bytes of the input are XORed into the sponge's state. The sponge +// is then "full" and the permutation is applied to "empty" it. This process is +// repeated until all the input has been "absorbed". The input is then padded. +// The digest is "squeezed" from the sponge in the same way, except that output +// is copied out instead of input being XORed in. +// +// A sponge is parameterized by its generic security strength, which is equal +// to half its capacity; capacity + rate is equal to the permutation's width. +// Since the KeccakF-1600 permutation is 1600 bits (200 bytes) wide, this means +// that the security strength of a sponge instance is equal to (1600 - bitrate) / 2. +// +// # Recommendations +// +// The SHAKE functions are recommended for most new uses. They can produce +// output of arbitrary length. SHAKE256, with an output length of at least +// 64 bytes, provides 256-bit security against all attacks. The Keccak team +// recommends it for most applications upgrading from SHA2-512. (NIST chose a +// much stronger, but much slower, sponge instance for SHA3-512.) +// +// The SHA-3 functions are "drop-in" replacements for the SHA-2 functions. +// They produce output of the same length, with the same security strengths +// against all attacks. This means, in particular, that SHA3-256 only has +// 128-bit collision resistance, because its output length is 32 bytes. +package sha3 diff --git a/vendor/golang.org/x/crypto/sha3/hashes.go b/vendor/golang.org/x/crypto/sha3/hashes.go new file mode 100644 index 00000000..31fffbe0 --- /dev/null +++ b/vendor/golang.org/x/crypto/sha3/hashes.go @@ -0,0 +1,128 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package sha3 + +// This file provides functions for creating instances of the SHA-3 +// and SHAKE hash functions, as well as utility functions for hashing +// bytes. + +import ( + "crypto" + "hash" +) + +// New224 creates a new SHA3-224 hash. +// Its generic security strength is 224 bits against preimage attacks, +// and 112 bits against collision attacks. +func New224() hash.Hash { + return new224() +} + +// New256 creates a new SHA3-256 hash. +// Its generic security strength is 256 bits against preimage attacks, +// and 128 bits against collision attacks. +func New256() hash.Hash { + return new256() +} + +// New384 creates a new SHA3-384 hash. +// Its generic security strength is 384 bits against preimage attacks, +// and 192 bits against collision attacks. +func New384() hash.Hash { + return new384() +} + +// New512 creates a new SHA3-512 hash. +// Its generic security strength is 512 bits against preimage attacks, +// and 256 bits against collision attacks. +func New512() hash.Hash { + return new512() +} + +func init() { + crypto.RegisterHash(crypto.SHA3_224, New224) + crypto.RegisterHash(crypto.SHA3_256, New256) + crypto.RegisterHash(crypto.SHA3_384, New384) + crypto.RegisterHash(crypto.SHA3_512, New512) +} + +const ( + dsbyteSHA3 = 0b00000110 + dsbyteKeccak = 0b00000001 + dsbyteShake = 0b00011111 + dsbyteCShake = 0b00000100 + + // rateK[c] is the rate in bytes for Keccak[c] where c is the capacity in + // bits. Given the sponge size is 1600 bits, the rate is 1600 - c bits. + rateK256 = (1600 - 256) / 8 + rateK448 = (1600 - 448) / 8 + rateK512 = (1600 - 512) / 8 + rateK768 = (1600 - 768) / 8 + rateK1024 = (1600 - 1024) / 8 +) + +func new224Generic() *state { + return &state{rate: rateK448, outputLen: 28, dsbyte: dsbyteSHA3} +} + +func new256Generic() *state { + return &state{rate: rateK512, outputLen: 32, dsbyte: dsbyteSHA3} +} + +func new384Generic() *state { + return &state{rate: rateK768, outputLen: 48, dsbyte: dsbyteSHA3} +} + +func new512Generic() *state { + return &state{rate: rateK1024, outputLen: 64, dsbyte: dsbyteSHA3} +} + +// NewLegacyKeccak256 creates a new Keccak-256 hash. +// +// Only use this function if you require compatibility with an existing cryptosystem +// that uses non-standard padding. All other users should use New256 instead. +func NewLegacyKeccak256() hash.Hash { + return &state{rate: rateK512, outputLen: 32, dsbyte: dsbyteKeccak} +} + +// NewLegacyKeccak512 creates a new Keccak-512 hash. +// +// Only use this function if you require compatibility with an existing cryptosystem +// that uses non-standard padding. All other users should use New512 instead. +func NewLegacyKeccak512() hash.Hash { + return &state{rate: rateK1024, outputLen: 64, dsbyte: dsbyteKeccak} +} + +// Sum224 returns the SHA3-224 digest of the data. +func Sum224(data []byte) (digest [28]byte) { + h := New224() + h.Write(data) + h.Sum(digest[:0]) + return +} + +// Sum256 returns the SHA3-256 digest of the data. +func Sum256(data []byte) (digest [32]byte) { + h := New256() + h.Write(data) + h.Sum(digest[:0]) + return +} + +// Sum384 returns the SHA3-384 digest of the data. +func Sum384(data []byte) (digest [48]byte) { + h := New384() + h.Write(data) + h.Sum(digest[:0]) + return +} + +// Sum512 returns the SHA3-512 digest of the data. +func Sum512(data []byte) (digest [64]byte) { + h := New512() + h.Write(data) + h.Sum(digest[:0]) + return +} diff --git a/vendor/golang.org/x/crypto/sha3/hashes_noasm.go b/vendor/golang.org/x/crypto/sha3/hashes_noasm.go new file mode 100644 index 00000000..9d85fb62 --- /dev/null +++ b/vendor/golang.org/x/crypto/sha3/hashes_noasm.go @@ -0,0 +1,23 @@ +// Copyright 2023 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build !gc || purego || !s390x + +package sha3 + +func new224() *state { + return new224Generic() +} + +func new256() *state { + return new256Generic() +} + +func new384() *state { + return new384Generic() +} + +func new512() *state { + return new512Generic() +} diff --git a/vendor/golang.org/x/crypto/sha3/keccakf.go b/vendor/golang.org/x/crypto/sha3/keccakf.go new file mode 100644 index 00000000..ce48b1dd --- /dev/null +++ b/vendor/golang.org/x/crypto/sha3/keccakf.go @@ -0,0 +1,414 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build !amd64 || purego || !gc + +package sha3 + +import "math/bits" + +// rc stores the round constants for use in the ι step. +var rc = [24]uint64{ + 0x0000000000000001, + 0x0000000000008082, + 0x800000000000808A, + 0x8000000080008000, + 0x000000000000808B, + 0x0000000080000001, + 0x8000000080008081, + 0x8000000000008009, + 0x000000000000008A, + 0x0000000000000088, + 0x0000000080008009, + 0x000000008000000A, + 0x000000008000808B, + 0x800000000000008B, + 0x8000000000008089, + 0x8000000000008003, + 0x8000000000008002, + 0x8000000000000080, + 0x000000000000800A, + 0x800000008000000A, + 0x8000000080008081, + 0x8000000000008080, + 0x0000000080000001, + 0x8000000080008008, +} + +// keccakF1600 applies the Keccak permutation to a 1600b-wide +// state represented as a slice of 25 uint64s. +func keccakF1600(a *[25]uint64) { + // Implementation translated from Keccak-inplace.c + // in the keccak reference code. + var t, bc0, bc1, bc2, bc3, bc4, d0, d1, d2, d3, d4 uint64 + + for i := 0; i < 24; i += 4 { + // Combines the 5 steps in each round into 2 steps. + // Unrolls 4 rounds per loop and spreads some steps across rounds. + + // Round 1 + bc0 = a[0] ^ a[5] ^ a[10] ^ a[15] ^ a[20] + bc1 = a[1] ^ a[6] ^ a[11] ^ a[16] ^ a[21] + bc2 = a[2] ^ a[7] ^ a[12] ^ a[17] ^ a[22] + bc3 = a[3] ^ a[8] ^ a[13] ^ a[18] ^ a[23] + bc4 = a[4] ^ a[9] ^ a[14] ^ a[19] ^ a[24] + d0 = bc4 ^ (bc1<<1 | bc1>>63) + d1 = bc0 ^ (bc2<<1 | bc2>>63) + d2 = bc1 ^ (bc3<<1 | bc3>>63) + d3 = bc2 ^ (bc4<<1 | bc4>>63) + d4 = bc3 ^ (bc0<<1 | bc0>>63) + + bc0 = a[0] ^ d0 + t = a[6] ^ d1 + bc1 = bits.RotateLeft64(t, 44) + t = a[12] ^ d2 + bc2 = bits.RotateLeft64(t, 43) + t = a[18] ^ d3 + bc3 = bits.RotateLeft64(t, 21) + t = a[24] ^ d4 + bc4 = bits.RotateLeft64(t, 14) + a[0] = bc0 ^ (bc2 &^ bc1) ^ rc[i] + a[6] = bc1 ^ (bc3 &^ bc2) + a[12] = bc2 ^ (bc4 &^ bc3) + a[18] = bc3 ^ (bc0 &^ bc4) + a[24] = bc4 ^ (bc1 &^ bc0) + + t = a[10] ^ d0 + bc2 = bits.RotateLeft64(t, 3) + t = a[16] ^ d1 + bc3 = bits.RotateLeft64(t, 45) + t = a[22] ^ d2 + bc4 = bits.RotateLeft64(t, 61) + t = a[3] ^ d3 + bc0 = bits.RotateLeft64(t, 28) + t = a[9] ^ d4 + bc1 = bits.RotateLeft64(t, 20) + a[10] = bc0 ^ (bc2 &^ bc1) + a[16] = bc1 ^ (bc3 &^ bc2) + a[22] = bc2 ^ (bc4 &^ bc3) + a[3] = bc3 ^ (bc0 &^ bc4) + a[9] = bc4 ^ (bc1 &^ bc0) + + t = a[20] ^ d0 + bc4 = bits.RotateLeft64(t, 18) + t = a[1] ^ d1 + bc0 = bits.RotateLeft64(t, 1) + t = a[7] ^ d2 + bc1 = bits.RotateLeft64(t, 6) + t = a[13] ^ d3 + bc2 = bits.RotateLeft64(t, 25) + t = a[19] ^ d4 + bc3 = bits.RotateLeft64(t, 8) + a[20] = bc0 ^ (bc2 &^ bc1) + a[1] = bc1 ^ (bc3 &^ bc2) + a[7] = bc2 ^ (bc4 &^ bc3) + a[13] = bc3 ^ (bc0 &^ bc4) + a[19] = bc4 ^ (bc1 &^ bc0) + + t = a[5] ^ d0 + bc1 = bits.RotateLeft64(t, 36) + t = a[11] ^ d1 + bc2 = bits.RotateLeft64(t, 10) + t = a[17] ^ d2 + bc3 = bits.RotateLeft64(t, 15) + t = a[23] ^ d3 + bc4 = bits.RotateLeft64(t, 56) + t = a[4] ^ d4 + bc0 = bits.RotateLeft64(t, 27) + a[5] = bc0 ^ (bc2 &^ bc1) + a[11] = bc1 ^ (bc3 &^ bc2) + a[17] = bc2 ^ (bc4 &^ bc3) + a[23] = bc3 ^ (bc0 &^ bc4) + a[4] = bc4 ^ (bc1 &^ bc0) + + t = a[15] ^ d0 + bc3 = bits.RotateLeft64(t, 41) + t = a[21] ^ d1 + bc4 = bits.RotateLeft64(t, 2) + t = a[2] ^ d2 + bc0 = bits.RotateLeft64(t, 62) + t = a[8] ^ d3 + bc1 = bits.RotateLeft64(t, 55) + t = a[14] ^ d4 + bc2 = bits.RotateLeft64(t, 39) + a[15] = bc0 ^ (bc2 &^ bc1) + a[21] = bc1 ^ (bc3 &^ bc2) + a[2] = bc2 ^ (bc4 &^ bc3) + a[8] = bc3 ^ (bc0 &^ bc4) + a[14] = bc4 ^ (bc1 &^ bc0) + + // Round 2 + bc0 = a[0] ^ a[5] ^ a[10] ^ a[15] ^ a[20] + bc1 = a[1] ^ a[6] ^ a[11] ^ a[16] ^ a[21] + bc2 = a[2] ^ a[7] ^ a[12] ^ a[17] ^ a[22] + bc3 = a[3] ^ a[8] ^ a[13] ^ a[18] ^ a[23] + bc4 = a[4] ^ a[9] ^ a[14] ^ a[19] ^ a[24] + d0 = bc4 ^ (bc1<<1 | bc1>>63) + d1 = bc0 ^ (bc2<<1 | bc2>>63) + d2 = bc1 ^ (bc3<<1 | bc3>>63) + d3 = bc2 ^ (bc4<<1 | bc4>>63) + d4 = bc3 ^ (bc0<<1 | bc0>>63) + + bc0 = a[0] ^ d0 + t = a[16] ^ d1 + bc1 = bits.RotateLeft64(t, 44) + t = a[7] ^ d2 + bc2 = bits.RotateLeft64(t, 43) + t = a[23] ^ d3 + bc3 = bits.RotateLeft64(t, 21) + t = a[14] ^ d4 + bc4 = bits.RotateLeft64(t, 14) + a[0] = bc0 ^ (bc2 &^ bc1) ^ rc[i+1] + a[16] = bc1 ^ (bc3 &^ bc2) + a[7] = bc2 ^ (bc4 &^ bc3) + a[23] = bc3 ^ (bc0 &^ bc4) + a[14] = bc4 ^ (bc1 &^ bc0) + + t = a[20] ^ d0 + bc2 = bits.RotateLeft64(t, 3) + t = a[11] ^ d1 + bc3 = bits.RotateLeft64(t, 45) + t = a[2] ^ d2 + bc4 = bits.RotateLeft64(t, 61) + t = a[18] ^ d3 + bc0 = bits.RotateLeft64(t, 28) + t = a[9] ^ d4 + bc1 = bits.RotateLeft64(t, 20) + a[20] = bc0 ^ (bc2 &^ bc1) + a[11] = bc1 ^ (bc3 &^ bc2) + a[2] = bc2 ^ (bc4 &^ bc3) + a[18] = bc3 ^ (bc0 &^ bc4) + a[9] = bc4 ^ (bc1 &^ bc0) + + t = a[15] ^ d0 + bc4 = bits.RotateLeft64(t, 18) + t = a[6] ^ d1 + bc0 = bits.RotateLeft64(t, 1) + t = a[22] ^ d2 + bc1 = bits.RotateLeft64(t, 6) + t = a[13] ^ d3 + bc2 = bits.RotateLeft64(t, 25) + t = a[4] ^ d4 + bc3 = bits.RotateLeft64(t, 8) + a[15] = bc0 ^ (bc2 &^ bc1) + a[6] = bc1 ^ (bc3 &^ bc2) + a[22] = bc2 ^ (bc4 &^ bc3) + a[13] = bc3 ^ (bc0 &^ bc4) + a[4] = bc4 ^ (bc1 &^ bc0) + + t = a[10] ^ d0 + bc1 = bits.RotateLeft64(t, 36) + t = a[1] ^ d1 + bc2 = bits.RotateLeft64(t, 10) + t = a[17] ^ d2 + bc3 = bits.RotateLeft64(t, 15) + t = a[8] ^ d3 + bc4 = bits.RotateLeft64(t, 56) + t = a[24] ^ d4 + bc0 = bits.RotateLeft64(t, 27) + a[10] = bc0 ^ (bc2 &^ bc1) + a[1] = bc1 ^ (bc3 &^ bc2) + a[17] = bc2 ^ (bc4 &^ bc3) + a[8] = bc3 ^ (bc0 &^ bc4) + a[24] = bc4 ^ (bc1 &^ bc0) + + t = a[5] ^ d0 + bc3 = bits.RotateLeft64(t, 41) + t = a[21] ^ d1 + bc4 = bits.RotateLeft64(t, 2) + t = a[12] ^ d2 + bc0 = bits.RotateLeft64(t, 62) + t = a[3] ^ d3 + bc1 = bits.RotateLeft64(t, 55) + t = a[19] ^ d4 + bc2 = bits.RotateLeft64(t, 39) + a[5] = bc0 ^ (bc2 &^ bc1) + a[21] = bc1 ^ (bc3 &^ bc2) + a[12] = bc2 ^ (bc4 &^ bc3) + a[3] = bc3 ^ (bc0 &^ bc4) + a[19] = bc4 ^ (bc1 &^ bc0) + + // Round 3 + bc0 = a[0] ^ a[5] ^ a[10] ^ a[15] ^ a[20] + bc1 = a[1] ^ a[6] ^ a[11] ^ a[16] ^ a[21] + bc2 = a[2] ^ a[7] ^ a[12] ^ a[17] ^ a[22] + bc3 = a[3] ^ a[8] ^ a[13] ^ a[18] ^ a[23] + bc4 = a[4] ^ a[9] ^ a[14] ^ a[19] ^ a[24] + d0 = bc4 ^ (bc1<<1 | bc1>>63) + d1 = bc0 ^ (bc2<<1 | bc2>>63) + d2 = bc1 ^ (bc3<<1 | bc3>>63) + d3 = bc2 ^ (bc4<<1 | bc4>>63) + d4 = bc3 ^ (bc0<<1 | bc0>>63) + + bc0 = a[0] ^ d0 + t = a[11] ^ d1 + bc1 = bits.RotateLeft64(t, 44) + t = a[22] ^ d2 + bc2 = bits.RotateLeft64(t, 43) + t = a[8] ^ d3 + bc3 = bits.RotateLeft64(t, 21) + t = a[19] ^ d4 + bc4 = bits.RotateLeft64(t, 14) + a[0] = bc0 ^ (bc2 &^ bc1) ^ rc[i+2] + a[11] = bc1 ^ (bc3 &^ bc2) + a[22] = bc2 ^ (bc4 &^ bc3) + a[8] = bc3 ^ (bc0 &^ bc4) + a[19] = bc4 ^ (bc1 &^ bc0) + + t = a[15] ^ d0 + bc2 = bits.RotateLeft64(t, 3) + t = a[1] ^ d1 + bc3 = bits.RotateLeft64(t, 45) + t = a[12] ^ d2 + bc4 = bits.RotateLeft64(t, 61) + t = a[23] ^ d3 + bc0 = bits.RotateLeft64(t, 28) + t = a[9] ^ d4 + bc1 = bits.RotateLeft64(t, 20) + a[15] = bc0 ^ (bc2 &^ bc1) + a[1] = bc1 ^ (bc3 &^ bc2) + a[12] = bc2 ^ (bc4 &^ bc3) + a[23] = bc3 ^ (bc0 &^ bc4) + a[9] = bc4 ^ (bc1 &^ bc0) + + t = a[5] ^ d0 + bc4 = bits.RotateLeft64(t, 18) + t = a[16] ^ d1 + bc0 = bits.RotateLeft64(t, 1) + t = a[2] ^ d2 + bc1 = bits.RotateLeft64(t, 6) + t = a[13] ^ d3 + bc2 = bits.RotateLeft64(t, 25) + t = a[24] ^ d4 + bc3 = bits.RotateLeft64(t, 8) + a[5] = bc0 ^ (bc2 &^ bc1) + a[16] = bc1 ^ (bc3 &^ bc2) + a[2] = bc2 ^ (bc4 &^ bc3) + a[13] = bc3 ^ (bc0 &^ bc4) + a[24] = bc4 ^ (bc1 &^ bc0) + + t = a[20] ^ d0 + bc1 = bits.RotateLeft64(t, 36) + t = a[6] ^ d1 + bc2 = bits.RotateLeft64(t, 10) + t = a[17] ^ d2 + bc3 = bits.RotateLeft64(t, 15) + t = a[3] ^ d3 + bc4 = bits.RotateLeft64(t, 56) + t = a[14] ^ d4 + bc0 = bits.RotateLeft64(t, 27) + a[20] = bc0 ^ (bc2 &^ bc1) + a[6] = bc1 ^ (bc3 &^ bc2) + a[17] = bc2 ^ (bc4 &^ bc3) + a[3] = bc3 ^ (bc0 &^ bc4) + a[14] = bc4 ^ (bc1 &^ bc0) + + t = a[10] ^ d0 + bc3 = bits.RotateLeft64(t, 41) + t = a[21] ^ d1 + bc4 = bits.RotateLeft64(t, 2) + t = a[7] ^ d2 + bc0 = bits.RotateLeft64(t, 62) + t = a[18] ^ d3 + bc1 = bits.RotateLeft64(t, 55) + t = a[4] ^ d4 + bc2 = bits.RotateLeft64(t, 39) + a[10] = bc0 ^ (bc2 &^ bc1) + a[21] = bc1 ^ (bc3 &^ bc2) + a[7] = bc2 ^ (bc4 &^ bc3) + a[18] = bc3 ^ (bc0 &^ bc4) + a[4] = bc4 ^ (bc1 &^ bc0) + + // Round 4 + bc0 = a[0] ^ a[5] ^ a[10] ^ a[15] ^ a[20] + bc1 = a[1] ^ a[6] ^ a[11] ^ a[16] ^ a[21] + bc2 = a[2] ^ a[7] ^ a[12] ^ a[17] ^ a[22] + bc3 = a[3] ^ a[8] ^ a[13] ^ a[18] ^ a[23] + bc4 = a[4] ^ a[9] ^ a[14] ^ a[19] ^ a[24] + d0 = bc4 ^ (bc1<<1 | bc1>>63) + d1 = bc0 ^ (bc2<<1 | bc2>>63) + d2 = bc1 ^ (bc3<<1 | bc3>>63) + d3 = bc2 ^ (bc4<<1 | bc4>>63) + d4 = bc3 ^ (bc0<<1 | bc0>>63) + + bc0 = a[0] ^ d0 + t = a[1] ^ d1 + bc1 = bits.RotateLeft64(t, 44) + t = a[2] ^ d2 + bc2 = bits.RotateLeft64(t, 43) + t = a[3] ^ d3 + bc3 = bits.RotateLeft64(t, 21) + t = a[4] ^ d4 + bc4 = bits.RotateLeft64(t, 14) + a[0] = bc0 ^ (bc2 &^ bc1) ^ rc[i+3] + a[1] = bc1 ^ (bc3 &^ bc2) + a[2] = bc2 ^ (bc4 &^ bc3) + a[3] = bc3 ^ (bc0 &^ bc4) + a[4] = bc4 ^ (bc1 &^ bc0) + + t = a[5] ^ d0 + bc2 = bits.RotateLeft64(t, 3) + t = a[6] ^ d1 + bc3 = bits.RotateLeft64(t, 45) + t = a[7] ^ d2 + bc4 = bits.RotateLeft64(t, 61) + t = a[8] ^ d3 + bc0 = bits.RotateLeft64(t, 28) + t = a[9] ^ d4 + bc1 = bits.RotateLeft64(t, 20) + a[5] = bc0 ^ (bc2 &^ bc1) + a[6] = bc1 ^ (bc3 &^ bc2) + a[7] = bc2 ^ (bc4 &^ bc3) + a[8] = bc3 ^ (bc0 &^ bc4) + a[9] = bc4 ^ (bc1 &^ bc0) + + t = a[10] ^ d0 + bc4 = bits.RotateLeft64(t, 18) + t = a[11] ^ d1 + bc0 = bits.RotateLeft64(t, 1) + t = a[12] ^ d2 + bc1 = bits.RotateLeft64(t, 6) + t = a[13] ^ d3 + bc2 = bits.RotateLeft64(t, 25) + t = a[14] ^ d4 + bc3 = bits.RotateLeft64(t, 8) + a[10] = bc0 ^ (bc2 &^ bc1) + a[11] = bc1 ^ (bc3 &^ bc2) + a[12] = bc2 ^ (bc4 &^ bc3) + a[13] = bc3 ^ (bc0 &^ bc4) + a[14] = bc4 ^ (bc1 &^ bc0) + + t = a[15] ^ d0 + bc1 = bits.RotateLeft64(t, 36) + t = a[16] ^ d1 + bc2 = bits.RotateLeft64(t, 10) + t = a[17] ^ d2 + bc3 = bits.RotateLeft64(t, 15) + t = a[18] ^ d3 + bc4 = bits.RotateLeft64(t, 56) + t = a[19] ^ d4 + bc0 = bits.RotateLeft64(t, 27) + a[15] = bc0 ^ (bc2 &^ bc1) + a[16] = bc1 ^ (bc3 &^ bc2) + a[17] = bc2 ^ (bc4 &^ bc3) + a[18] = bc3 ^ (bc0 &^ bc4) + a[19] = bc4 ^ (bc1 &^ bc0) + + t = a[20] ^ d0 + bc3 = bits.RotateLeft64(t, 41) + t = a[21] ^ d1 + bc4 = bits.RotateLeft64(t, 2) + t = a[22] ^ d2 + bc0 = bits.RotateLeft64(t, 62) + t = a[23] ^ d3 + bc1 = bits.RotateLeft64(t, 55) + t = a[24] ^ d4 + bc2 = bits.RotateLeft64(t, 39) + a[20] = bc0 ^ (bc2 &^ bc1) + a[21] = bc1 ^ (bc3 &^ bc2) + a[22] = bc2 ^ (bc4 &^ bc3) + a[23] = bc3 ^ (bc0 &^ bc4) + a[24] = bc4 ^ (bc1 &^ bc0) + } +} diff --git a/vendor/golang.org/x/crypto/sha3/keccakf_amd64.go b/vendor/golang.org/x/crypto/sha3/keccakf_amd64.go new file mode 100644 index 00000000..b908696b --- /dev/null +++ b/vendor/golang.org/x/crypto/sha3/keccakf_amd64.go @@ -0,0 +1,13 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build amd64 && !purego && gc + +package sha3 + +// This function is implemented in keccakf_amd64.s. + +//go:noescape + +func keccakF1600(a *[25]uint64) diff --git a/vendor/golang.org/x/crypto/sha3/keccakf_amd64.s b/vendor/golang.org/x/crypto/sha3/keccakf_amd64.s new file mode 100644 index 00000000..99e2f16e --- /dev/null +++ b/vendor/golang.org/x/crypto/sha3/keccakf_amd64.s @@ -0,0 +1,5419 @@ +// Code generated by command: go run keccakf_amd64_asm.go -out ../keccakf_amd64.s -pkg sha3. DO NOT EDIT. + +//go:build amd64 && !purego && gc + +// func keccakF1600(a *[25]uint64) +TEXT ·keccakF1600(SB), $200-8 + MOVQ a+0(FP), DI + + // Convert the user state into an internal state + NOTQ 8(DI) + NOTQ 16(DI) + NOTQ 64(DI) + NOTQ 96(DI) + NOTQ 136(DI) + NOTQ 160(DI) + + // Execute the KeccakF permutation + MOVQ (DI), SI + MOVQ 8(DI), BP + MOVQ 32(DI), R15 + XORQ 40(DI), SI + XORQ 48(DI), BP + XORQ 72(DI), R15 + XORQ 80(DI), SI + XORQ 88(DI), BP + XORQ 112(DI), R15 + XORQ 120(DI), SI + XORQ 128(DI), BP + XORQ 152(DI), R15 + XORQ 160(DI), SI + XORQ 168(DI), BP + MOVQ 176(DI), DX + MOVQ 184(DI), R8 + XORQ 192(DI), R15 + + // Prepare round + MOVQ BP, BX + ROLQ $0x01, BX + MOVQ 16(DI), R12 + XORQ 56(DI), DX + XORQ R15, BX + XORQ 96(DI), R12 + XORQ 136(DI), DX + XORQ DX, R12 + MOVQ R12, CX + ROLQ $0x01, CX + MOVQ 24(DI), R13 + XORQ 64(DI), R8 + XORQ SI, CX + XORQ 104(DI), R13 + XORQ 144(DI), R8 + XORQ R8, R13 + MOVQ R13, DX + ROLQ $0x01, DX + MOVQ R15, R8 + XORQ BP, DX + ROLQ $0x01, R8 + MOVQ SI, R9 + XORQ R12, R8 + ROLQ $0x01, R9 + + // Result b + MOVQ (DI), R10 + MOVQ 48(DI), R11 + XORQ R13, R9 + MOVQ 96(DI), R12 + MOVQ 144(DI), R13 + MOVQ 192(DI), R14 + XORQ CX, R11 + ROLQ $0x2c, R11 + XORQ DX, R12 + XORQ BX, R10 + ROLQ $0x2b, R12 + MOVQ R11, SI + MOVQ $0x0000000000000001, AX + ORQ R12, SI + XORQ R10, AX + XORQ AX, SI + MOVQ SI, (SP) + XORQ R9, R14 + ROLQ $0x0e, R14 + MOVQ R10, R15 + ANDQ R11, R15 + XORQ R14, R15 + MOVQ R15, 32(SP) + XORQ R8, R13 + ROLQ $0x15, R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 16(SP) + NOTQ R12 + ORQ R10, R14 + ORQ R13, R12 + XORQ R13, R14 + XORQ R11, R12 + MOVQ R14, 24(SP) + MOVQ R12, 8(SP) + MOVQ R12, BP + + // Result g + MOVQ 72(DI), R11 + XORQ R9, R11 + MOVQ 80(DI), R12 + ROLQ $0x14, R11 + XORQ BX, R12 + ROLQ $0x03, R12 + MOVQ 24(DI), R10 + MOVQ R11, AX + ORQ R12, AX + XORQ R8, R10 + MOVQ 128(DI), R13 + MOVQ 176(DI), R14 + ROLQ $0x1c, R10 + XORQ R10, AX + MOVQ AX, 40(SP) + XORQ AX, SI + XORQ CX, R13 + ROLQ $0x2d, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 48(SP) + XORQ AX, BP + XORQ DX, R14 + ROLQ $0x3d, R14 + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 64(SP) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 72(SP) + NOTQ R14 + XORQ R10, R15 + ORQ R14, R13 + XORQ R12, R13 + MOVQ R13, 56(SP) + + // Result k + MOVQ 8(DI), R10 + MOVQ 56(DI), R11 + MOVQ 104(DI), R12 + MOVQ 152(DI), R13 + MOVQ 160(DI), R14 + XORQ DX, R11 + ROLQ $0x06, R11 + XORQ R8, R12 + ROLQ $0x19, R12 + MOVQ R11, AX + ORQ R12, AX + XORQ CX, R10 + ROLQ $0x01, R10 + XORQ R10, AX + MOVQ AX, 80(SP) + XORQ AX, SI + XORQ R9, R13 + ROLQ $0x08, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 88(SP) + XORQ AX, BP + XORQ BX, R14 + ROLQ $0x12, R14 + NOTQ R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 96(SP) + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 104(SP) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 112(SP) + XORQ R10, R15 + + // Result m + MOVQ 40(DI), R11 + XORQ BX, R11 + MOVQ 88(DI), R12 + ROLQ $0x24, R11 + XORQ CX, R12 + MOVQ 32(DI), R10 + ROLQ $0x0a, R12 + MOVQ R11, AX + MOVQ 136(DI), R13 + ANDQ R12, AX + XORQ R9, R10 + MOVQ 184(DI), R14 + ROLQ $0x1b, R10 + XORQ R10, AX + MOVQ AX, 120(SP) + XORQ AX, SI + XORQ DX, R13 + ROLQ $0x0f, R13 + MOVQ R12, AX + ORQ R13, AX + XORQ R11, AX + MOVQ AX, 128(SP) + XORQ AX, BP + XORQ R8, R14 + ROLQ $0x38, R14 + NOTQ R13 + MOVQ R13, AX + ORQ R14, AX + XORQ R12, AX + MOVQ AX, 136(SP) + ORQ R10, R11 + XORQ R14, R11 + MOVQ R11, 152(SP) + ANDQ R10, R14 + XORQ R13, R14 + MOVQ R14, 144(SP) + XORQ R11, R15 + + // Result s + MOVQ 16(DI), R10 + MOVQ 64(DI), R11 + MOVQ 112(DI), R12 + XORQ DX, R10 + MOVQ 120(DI), R13 + ROLQ $0x3e, R10 + XORQ R8, R11 + MOVQ 168(DI), R14 + ROLQ $0x37, R11 + XORQ R9, R12 + MOVQ R10, R9 + XORQ CX, R14 + ROLQ $0x02, R14 + ANDQ R11, R9 + XORQ R14, R9 + MOVQ R9, 192(SP) + ROLQ $0x27, R12 + XORQ R9, R15 + NOTQ R11 + XORQ BX, R13 + MOVQ R11, BX + ANDQ R12, BX + XORQ R10, BX + MOVQ BX, 160(SP) + XORQ BX, SI + ROLQ $0x29, R13 + MOVQ R12, CX + ORQ R13, CX + XORQ R11, CX + MOVQ CX, 168(SP) + XORQ CX, BP + MOVQ R13, DX + MOVQ R14, R8 + ANDQ R14, DX + ORQ R10, R8 + XORQ R12, DX + XORQ R13, R8 + MOVQ DX, 176(SP) + MOVQ R8, 184(SP) + + // Prepare round + MOVQ BP, BX + ROLQ $0x01, BX + MOVQ 16(SP), R12 + XORQ 56(SP), DX + XORQ R15, BX + XORQ 96(SP), R12 + XORQ 136(SP), DX + XORQ DX, R12 + MOVQ R12, CX + ROLQ $0x01, CX + MOVQ 24(SP), R13 + XORQ 64(SP), R8 + XORQ SI, CX + XORQ 104(SP), R13 + XORQ 144(SP), R8 + XORQ R8, R13 + MOVQ R13, DX + ROLQ $0x01, DX + MOVQ R15, R8 + XORQ BP, DX + ROLQ $0x01, R8 + MOVQ SI, R9 + XORQ R12, R8 + ROLQ $0x01, R9 + + // Result b + MOVQ (SP), R10 + MOVQ 48(SP), R11 + XORQ R13, R9 + MOVQ 96(SP), R12 + MOVQ 144(SP), R13 + MOVQ 192(SP), R14 + XORQ CX, R11 + ROLQ $0x2c, R11 + XORQ DX, R12 + XORQ BX, R10 + ROLQ $0x2b, R12 + MOVQ R11, SI + MOVQ $0x0000000000008082, AX + ORQ R12, SI + XORQ R10, AX + XORQ AX, SI + MOVQ SI, (DI) + XORQ R9, R14 + ROLQ $0x0e, R14 + MOVQ R10, R15 + ANDQ R11, R15 + XORQ R14, R15 + MOVQ R15, 32(DI) + XORQ R8, R13 + ROLQ $0x15, R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 16(DI) + NOTQ R12 + ORQ R10, R14 + ORQ R13, R12 + XORQ R13, R14 + XORQ R11, R12 + MOVQ R14, 24(DI) + MOVQ R12, 8(DI) + MOVQ R12, BP + + // Result g + MOVQ 72(SP), R11 + XORQ R9, R11 + MOVQ 80(SP), R12 + ROLQ $0x14, R11 + XORQ BX, R12 + ROLQ $0x03, R12 + MOVQ 24(SP), R10 + MOVQ R11, AX + ORQ R12, AX + XORQ R8, R10 + MOVQ 128(SP), R13 + MOVQ 176(SP), R14 + ROLQ $0x1c, R10 + XORQ R10, AX + MOVQ AX, 40(DI) + XORQ AX, SI + XORQ CX, R13 + ROLQ $0x2d, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 48(DI) + XORQ AX, BP + XORQ DX, R14 + ROLQ $0x3d, R14 + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 64(DI) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 72(DI) + NOTQ R14 + XORQ R10, R15 + ORQ R14, R13 + XORQ R12, R13 + MOVQ R13, 56(DI) + + // Result k + MOVQ 8(SP), R10 + MOVQ 56(SP), R11 + MOVQ 104(SP), R12 + MOVQ 152(SP), R13 + MOVQ 160(SP), R14 + XORQ DX, R11 + ROLQ $0x06, R11 + XORQ R8, R12 + ROLQ $0x19, R12 + MOVQ R11, AX + ORQ R12, AX + XORQ CX, R10 + ROLQ $0x01, R10 + XORQ R10, AX + MOVQ AX, 80(DI) + XORQ AX, SI + XORQ R9, R13 + ROLQ $0x08, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 88(DI) + XORQ AX, BP + XORQ BX, R14 + ROLQ $0x12, R14 + NOTQ R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 96(DI) + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 104(DI) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 112(DI) + XORQ R10, R15 + + // Result m + MOVQ 40(SP), R11 + XORQ BX, R11 + MOVQ 88(SP), R12 + ROLQ $0x24, R11 + XORQ CX, R12 + MOVQ 32(SP), R10 + ROLQ $0x0a, R12 + MOVQ R11, AX + MOVQ 136(SP), R13 + ANDQ R12, AX + XORQ R9, R10 + MOVQ 184(SP), R14 + ROLQ $0x1b, R10 + XORQ R10, AX + MOVQ AX, 120(DI) + XORQ AX, SI + XORQ DX, R13 + ROLQ $0x0f, R13 + MOVQ R12, AX + ORQ R13, AX + XORQ R11, AX + MOVQ AX, 128(DI) + XORQ AX, BP + XORQ R8, R14 + ROLQ $0x38, R14 + NOTQ R13 + MOVQ R13, AX + ORQ R14, AX + XORQ R12, AX + MOVQ AX, 136(DI) + ORQ R10, R11 + XORQ R14, R11 + MOVQ R11, 152(DI) + ANDQ R10, R14 + XORQ R13, R14 + MOVQ R14, 144(DI) + XORQ R11, R15 + + // Result s + MOVQ 16(SP), R10 + MOVQ 64(SP), R11 + MOVQ 112(SP), R12 + XORQ DX, R10 + MOVQ 120(SP), R13 + ROLQ $0x3e, R10 + XORQ R8, R11 + MOVQ 168(SP), R14 + ROLQ $0x37, R11 + XORQ R9, R12 + MOVQ R10, R9 + XORQ CX, R14 + ROLQ $0x02, R14 + ANDQ R11, R9 + XORQ R14, R9 + MOVQ R9, 192(DI) + ROLQ $0x27, R12 + XORQ R9, R15 + NOTQ R11 + XORQ BX, R13 + MOVQ R11, BX + ANDQ R12, BX + XORQ R10, BX + MOVQ BX, 160(DI) + XORQ BX, SI + ROLQ $0x29, R13 + MOVQ R12, CX + ORQ R13, CX + XORQ R11, CX + MOVQ CX, 168(DI) + XORQ CX, BP + MOVQ R13, DX + MOVQ R14, R8 + ANDQ R14, DX + ORQ R10, R8 + XORQ R12, DX + XORQ R13, R8 + MOVQ DX, 176(DI) + MOVQ R8, 184(DI) + + // Prepare round + MOVQ BP, BX + ROLQ $0x01, BX + MOVQ 16(DI), R12 + XORQ 56(DI), DX + XORQ R15, BX + XORQ 96(DI), R12 + XORQ 136(DI), DX + XORQ DX, R12 + MOVQ R12, CX + ROLQ $0x01, CX + MOVQ 24(DI), R13 + XORQ 64(DI), R8 + XORQ SI, CX + XORQ 104(DI), R13 + XORQ 144(DI), R8 + XORQ R8, R13 + MOVQ R13, DX + ROLQ $0x01, DX + MOVQ R15, R8 + XORQ BP, DX + ROLQ $0x01, R8 + MOVQ SI, R9 + XORQ R12, R8 + ROLQ $0x01, R9 + + // Result b + MOVQ (DI), R10 + MOVQ 48(DI), R11 + XORQ R13, R9 + MOVQ 96(DI), R12 + MOVQ 144(DI), R13 + MOVQ 192(DI), R14 + XORQ CX, R11 + ROLQ $0x2c, R11 + XORQ DX, R12 + XORQ BX, R10 + ROLQ $0x2b, R12 + MOVQ R11, SI + MOVQ $0x800000000000808a, AX + ORQ R12, SI + XORQ R10, AX + XORQ AX, SI + MOVQ SI, (SP) + XORQ R9, R14 + ROLQ $0x0e, R14 + MOVQ R10, R15 + ANDQ R11, R15 + XORQ R14, R15 + MOVQ R15, 32(SP) + XORQ R8, R13 + ROLQ $0x15, R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 16(SP) + NOTQ R12 + ORQ R10, R14 + ORQ R13, R12 + XORQ R13, R14 + XORQ R11, R12 + MOVQ R14, 24(SP) + MOVQ R12, 8(SP) + MOVQ R12, BP + + // Result g + MOVQ 72(DI), R11 + XORQ R9, R11 + MOVQ 80(DI), R12 + ROLQ $0x14, R11 + XORQ BX, R12 + ROLQ $0x03, R12 + MOVQ 24(DI), R10 + MOVQ R11, AX + ORQ R12, AX + XORQ R8, R10 + MOVQ 128(DI), R13 + MOVQ 176(DI), R14 + ROLQ $0x1c, R10 + XORQ R10, AX + MOVQ AX, 40(SP) + XORQ AX, SI + XORQ CX, R13 + ROLQ $0x2d, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 48(SP) + XORQ AX, BP + XORQ DX, R14 + ROLQ $0x3d, R14 + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 64(SP) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 72(SP) + NOTQ R14 + XORQ R10, R15 + ORQ R14, R13 + XORQ R12, R13 + MOVQ R13, 56(SP) + + // Result k + MOVQ 8(DI), R10 + MOVQ 56(DI), R11 + MOVQ 104(DI), R12 + MOVQ 152(DI), R13 + MOVQ 160(DI), R14 + XORQ DX, R11 + ROLQ $0x06, R11 + XORQ R8, R12 + ROLQ $0x19, R12 + MOVQ R11, AX + ORQ R12, AX + XORQ CX, R10 + ROLQ $0x01, R10 + XORQ R10, AX + MOVQ AX, 80(SP) + XORQ AX, SI + XORQ R9, R13 + ROLQ $0x08, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 88(SP) + XORQ AX, BP + XORQ BX, R14 + ROLQ $0x12, R14 + NOTQ R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 96(SP) + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 104(SP) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 112(SP) + XORQ R10, R15 + + // Result m + MOVQ 40(DI), R11 + XORQ BX, R11 + MOVQ 88(DI), R12 + ROLQ $0x24, R11 + XORQ CX, R12 + MOVQ 32(DI), R10 + ROLQ $0x0a, R12 + MOVQ R11, AX + MOVQ 136(DI), R13 + ANDQ R12, AX + XORQ R9, R10 + MOVQ 184(DI), R14 + ROLQ $0x1b, R10 + XORQ R10, AX + MOVQ AX, 120(SP) + XORQ AX, SI + XORQ DX, R13 + ROLQ $0x0f, R13 + MOVQ R12, AX + ORQ R13, AX + XORQ R11, AX + MOVQ AX, 128(SP) + XORQ AX, BP + XORQ R8, R14 + ROLQ $0x38, R14 + NOTQ R13 + MOVQ R13, AX + ORQ R14, AX + XORQ R12, AX + MOVQ AX, 136(SP) + ORQ R10, R11 + XORQ R14, R11 + MOVQ R11, 152(SP) + ANDQ R10, R14 + XORQ R13, R14 + MOVQ R14, 144(SP) + XORQ R11, R15 + + // Result s + MOVQ 16(DI), R10 + MOVQ 64(DI), R11 + MOVQ 112(DI), R12 + XORQ DX, R10 + MOVQ 120(DI), R13 + ROLQ $0x3e, R10 + XORQ R8, R11 + MOVQ 168(DI), R14 + ROLQ $0x37, R11 + XORQ R9, R12 + MOVQ R10, R9 + XORQ CX, R14 + ROLQ $0x02, R14 + ANDQ R11, R9 + XORQ R14, R9 + MOVQ R9, 192(SP) + ROLQ $0x27, R12 + XORQ R9, R15 + NOTQ R11 + XORQ BX, R13 + MOVQ R11, BX + ANDQ R12, BX + XORQ R10, BX + MOVQ BX, 160(SP) + XORQ BX, SI + ROLQ $0x29, R13 + MOVQ R12, CX + ORQ R13, CX + XORQ R11, CX + MOVQ CX, 168(SP) + XORQ CX, BP + MOVQ R13, DX + MOVQ R14, R8 + ANDQ R14, DX + ORQ R10, R8 + XORQ R12, DX + XORQ R13, R8 + MOVQ DX, 176(SP) + MOVQ R8, 184(SP) + + // Prepare round + MOVQ BP, BX + ROLQ $0x01, BX + MOVQ 16(SP), R12 + XORQ 56(SP), DX + XORQ R15, BX + XORQ 96(SP), R12 + XORQ 136(SP), DX + XORQ DX, R12 + MOVQ R12, CX + ROLQ $0x01, CX + MOVQ 24(SP), R13 + XORQ 64(SP), R8 + XORQ SI, CX + XORQ 104(SP), R13 + XORQ 144(SP), R8 + XORQ R8, R13 + MOVQ R13, DX + ROLQ $0x01, DX + MOVQ R15, R8 + XORQ BP, DX + ROLQ $0x01, R8 + MOVQ SI, R9 + XORQ R12, R8 + ROLQ $0x01, R9 + + // Result b + MOVQ (SP), R10 + MOVQ 48(SP), R11 + XORQ R13, R9 + MOVQ 96(SP), R12 + MOVQ 144(SP), R13 + MOVQ 192(SP), R14 + XORQ CX, R11 + ROLQ $0x2c, R11 + XORQ DX, R12 + XORQ BX, R10 + ROLQ $0x2b, R12 + MOVQ R11, SI + MOVQ $0x8000000080008000, AX + ORQ R12, SI + XORQ R10, AX + XORQ AX, SI + MOVQ SI, (DI) + XORQ R9, R14 + ROLQ $0x0e, R14 + MOVQ R10, R15 + ANDQ R11, R15 + XORQ R14, R15 + MOVQ R15, 32(DI) + XORQ R8, R13 + ROLQ $0x15, R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 16(DI) + NOTQ R12 + ORQ R10, R14 + ORQ R13, R12 + XORQ R13, R14 + XORQ R11, R12 + MOVQ R14, 24(DI) + MOVQ R12, 8(DI) + MOVQ R12, BP + + // Result g + MOVQ 72(SP), R11 + XORQ R9, R11 + MOVQ 80(SP), R12 + ROLQ $0x14, R11 + XORQ BX, R12 + ROLQ $0x03, R12 + MOVQ 24(SP), R10 + MOVQ R11, AX + ORQ R12, AX + XORQ R8, R10 + MOVQ 128(SP), R13 + MOVQ 176(SP), R14 + ROLQ $0x1c, R10 + XORQ R10, AX + MOVQ AX, 40(DI) + XORQ AX, SI + XORQ CX, R13 + ROLQ $0x2d, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 48(DI) + XORQ AX, BP + XORQ DX, R14 + ROLQ $0x3d, R14 + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 64(DI) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 72(DI) + NOTQ R14 + XORQ R10, R15 + ORQ R14, R13 + XORQ R12, R13 + MOVQ R13, 56(DI) + + // Result k + MOVQ 8(SP), R10 + MOVQ 56(SP), R11 + MOVQ 104(SP), R12 + MOVQ 152(SP), R13 + MOVQ 160(SP), R14 + XORQ DX, R11 + ROLQ $0x06, R11 + XORQ R8, R12 + ROLQ $0x19, R12 + MOVQ R11, AX + ORQ R12, AX + XORQ CX, R10 + ROLQ $0x01, R10 + XORQ R10, AX + MOVQ AX, 80(DI) + XORQ AX, SI + XORQ R9, R13 + ROLQ $0x08, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 88(DI) + XORQ AX, BP + XORQ BX, R14 + ROLQ $0x12, R14 + NOTQ R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 96(DI) + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 104(DI) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 112(DI) + XORQ R10, R15 + + // Result m + MOVQ 40(SP), R11 + XORQ BX, R11 + MOVQ 88(SP), R12 + ROLQ $0x24, R11 + XORQ CX, R12 + MOVQ 32(SP), R10 + ROLQ $0x0a, R12 + MOVQ R11, AX + MOVQ 136(SP), R13 + ANDQ R12, AX + XORQ R9, R10 + MOVQ 184(SP), R14 + ROLQ $0x1b, R10 + XORQ R10, AX + MOVQ AX, 120(DI) + XORQ AX, SI + XORQ DX, R13 + ROLQ $0x0f, R13 + MOVQ R12, AX + ORQ R13, AX + XORQ R11, AX + MOVQ AX, 128(DI) + XORQ AX, BP + XORQ R8, R14 + ROLQ $0x38, R14 + NOTQ R13 + MOVQ R13, AX + ORQ R14, AX + XORQ R12, AX + MOVQ AX, 136(DI) + ORQ R10, R11 + XORQ R14, R11 + MOVQ R11, 152(DI) + ANDQ R10, R14 + XORQ R13, R14 + MOVQ R14, 144(DI) + XORQ R11, R15 + + // Result s + MOVQ 16(SP), R10 + MOVQ 64(SP), R11 + MOVQ 112(SP), R12 + XORQ DX, R10 + MOVQ 120(SP), R13 + ROLQ $0x3e, R10 + XORQ R8, R11 + MOVQ 168(SP), R14 + ROLQ $0x37, R11 + XORQ R9, R12 + MOVQ R10, R9 + XORQ CX, R14 + ROLQ $0x02, R14 + ANDQ R11, R9 + XORQ R14, R9 + MOVQ R9, 192(DI) + ROLQ $0x27, R12 + XORQ R9, R15 + NOTQ R11 + XORQ BX, R13 + MOVQ R11, BX + ANDQ R12, BX + XORQ R10, BX + MOVQ BX, 160(DI) + XORQ BX, SI + ROLQ $0x29, R13 + MOVQ R12, CX + ORQ R13, CX + XORQ R11, CX + MOVQ CX, 168(DI) + XORQ CX, BP + MOVQ R13, DX + MOVQ R14, R8 + ANDQ R14, DX + ORQ R10, R8 + XORQ R12, DX + XORQ R13, R8 + MOVQ DX, 176(DI) + MOVQ R8, 184(DI) + + // Prepare round + MOVQ BP, BX + ROLQ $0x01, BX + MOVQ 16(DI), R12 + XORQ 56(DI), DX + XORQ R15, BX + XORQ 96(DI), R12 + XORQ 136(DI), DX + XORQ DX, R12 + MOVQ R12, CX + ROLQ $0x01, CX + MOVQ 24(DI), R13 + XORQ 64(DI), R8 + XORQ SI, CX + XORQ 104(DI), R13 + XORQ 144(DI), R8 + XORQ R8, R13 + MOVQ R13, DX + ROLQ $0x01, DX + MOVQ R15, R8 + XORQ BP, DX + ROLQ $0x01, R8 + MOVQ SI, R9 + XORQ R12, R8 + ROLQ $0x01, R9 + + // Result b + MOVQ (DI), R10 + MOVQ 48(DI), R11 + XORQ R13, R9 + MOVQ 96(DI), R12 + MOVQ 144(DI), R13 + MOVQ 192(DI), R14 + XORQ CX, R11 + ROLQ $0x2c, R11 + XORQ DX, R12 + XORQ BX, R10 + ROLQ $0x2b, R12 + MOVQ R11, SI + MOVQ $0x000000000000808b, AX + ORQ R12, SI + XORQ R10, AX + XORQ AX, SI + MOVQ SI, (SP) + XORQ R9, R14 + ROLQ $0x0e, R14 + MOVQ R10, R15 + ANDQ R11, R15 + XORQ R14, R15 + MOVQ R15, 32(SP) + XORQ R8, R13 + ROLQ $0x15, R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 16(SP) + NOTQ R12 + ORQ R10, R14 + ORQ R13, R12 + XORQ R13, R14 + XORQ R11, R12 + MOVQ R14, 24(SP) + MOVQ R12, 8(SP) + MOVQ R12, BP + + // Result g + MOVQ 72(DI), R11 + XORQ R9, R11 + MOVQ 80(DI), R12 + ROLQ $0x14, R11 + XORQ BX, R12 + ROLQ $0x03, R12 + MOVQ 24(DI), R10 + MOVQ R11, AX + ORQ R12, AX + XORQ R8, R10 + MOVQ 128(DI), R13 + MOVQ 176(DI), R14 + ROLQ $0x1c, R10 + XORQ R10, AX + MOVQ AX, 40(SP) + XORQ AX, SI + XORQ CX, R13 + ROLQ $0x2d, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 48(SP) + XORQ AX, BP + XORQ DX, R14 + ROLQ $0x3d, R14 + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 64(SP) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 72(SP) + NOTQ R14 + XORQ R10, R15 + ORQ R14, R13 + XORQ R12, R13 + MOVQ R13, 56(SP) + + // Result k + MOVQ 8(DI), R10 + MOVQ 56(DI), R11 + MOVQ 104(DI), R12 + MOVQ 152(DI), R13 + MOVQ 160(DI), R14 + XORQ DX, R11 + ROLQ $0x06, R11 + XORQ R8, R12 + ROLQ $0x19, R12 + MOVQ R11, AX + ORQ R12, AX + XORQ CX, R10 + ROLQ $0x01, R10 + XORQ R10, AX + MOVQ AX, 80(SP) + XORQ AX, SI + XORQ R9, R13 + ROLQ $0x08, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 88(SP) + XORQ AX, BP + XORQ BX, R14 + ROLQ $0x12, R14 + NOTQ R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 96(SP) + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 104(SP) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 112(SP) + XORQ R10, R15 + + // Result m + MOVQ 40(DI), R11 + XORQ BX, R11 + MOVQ 88(DI), R12 + ROLQ $0x24, R11 + XORQ CX, R12 + MOVQ 32(DI), R10 + ROLQ $0x0a, R12 + MOVQ R11, AX + MOVQ 136(DI), R13 + ANDQ R12, AX + XORQ R9, R10 + MOVQ 184(DI), R14 + ROLQ $0x1b, R10 + XORQ R10, AX + MOVQ AX, 120(SP) + XORQ AX, SI + XORQ DX, R13 + ROLQ $0x0f, R13 + MOVQ R12, AX + ORQ R13, AX + XORQ R11, AX + MOVQ AX, 128(SP) + XORQ AX, BP + XORQ R8, R14 + ROLQ $0x38, R14 + NOTQ R13 + MOVQ R13, AX + ORQ R14, AX + XORQ R12, AX + MOVQ AX, 136(SP) + ORQ R10, R11 + XORQ R14, R11 + MOVQ R11, 152(SP) + ANDQ R10, R14 + XORQ R13, R14 + MOVQ R14, 144(SP) + XORQ R11, R15 + + // Result s + MOVQ 16(DI), R10 + MOVQ 64(DI), R11 + MOVQ 112(DI), R12 + XORQ DX, R10 + MOVQ 120(DI), R13 + ROLQ $0x3e, R10 + XORQ R8, R11 + MOVQ 168(DI), R14 + ROLQ $0x37, R11 + XORQ R9, R12 + MOVQ R10, R9 + XORQ CX, R14 + ROLQ $0x02, R14 + ANDQ R11, R9 + XORQ R14, R9 + MOVQ R9, 192(SP) + ROLQ $0x27, R12 + XORQ R9, R15 + NOTQ R11 + XORQ BX, R13 + MOVQ R11, BX + ANDQ R12, BX + XORQ R10, BX + MOVQ BX, 160(SP) + XORQ BX, SI + ROLQ $0x29, R13 + MOVQ R12, CX + ORQ R13, CX + XORQ R11, CX + MOVQ CX, 168(SP) + XORQ CX, BP + MOVQ R13, DX + MOVQ R14, R8 + ANDQ R14, DX + ORQ R10, R8 + XORQ R12, DX + XORQ R13, R8 + MOVQ DX, 176(SP) + MOVQ R8, 184(SP) + + // Prepare round + MOVQ BP, BX + ROLQ $0x01, BX + MOVQ 16(SP), R12 + XORQ 56(SP), DX + XORQ R15, BX + XORQ 96(SP), R12 + XORQ 136(SP), DX + XORQ DX, R12 + MOVQ R12, CX + ROLQ $0x01, CX + MOVQ 24(SP), R13 + XORQ 64(SP), R8 + XORQ SI, CX + XORQ 104(SP), R13 + XORQ 144(SP), R8 + XORQ R8, R13 + MOVQ R13, DX + ROLQ $0x01, DX + MOVQ R15, R8 + XORQ BP, DX + ROLQ $0x01, R8 + MOVQ SI, R9 + XORQ R12, R8 + ROLQ $0x01, R9 + + // Result b + MOVQ (SP), R10 + MOVQ 48(SP), R11 + XORQ R13, R9 + MOVQ 96(SP), R12 + MOVQ 144(SP), R13 + MOVQ 192(SP), R14 + XORQ CX, R11 + ROLQ $0x2c, R11 + XORQ DX, R12 + XORQ BX, R10 + ROLQ $0x2b, R12 + MOVQ R11, SI + MOVQ $0x0000000080000001, AX + ORQ R12, SI + XORQ R10, AX + XORQ AX, SI + MOVQ SI, (DI) + XORQ R9, R14 + ROLQ $0x0e, R14 + MOVQ R10, R15 + ANDQ R11, R15 + XORQ R14, R15 + MOVQ R15, 32(DI) + XORQ R8, R13 + ROLQ $0x15, R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 16(DI) + NOTQ R12 + ORQ R10, R14 + ORQ R13, R12 + XORQ R13, R14 + XORQ R11, R12 + MOVQ R14, 24(DI) + MOVQ R12, 8(DI) + MOVQ R12, BP + + // Result g + MOVQ 72(SP), R11 + XORQ R9, R11 + MOVQ 80(SP), R12 + ROLQ $0x14, R11 + XORQ BX, R12 + ROLQ $0x03, R12 + MOVQ 24(SP), R10 + MOVQ R11, AX + ORQ R12, AX + XORQ R8, R10 + MOVQ 128(SP), R13 + MOVQ 176(SP), R14 + ROLQ $0x1c, R10 + XORQ R10, AX + MOVQ AX, 40(DI) + XORQ AX, SI + XORQ CX, R13 + ROLQ $0x2d, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 48(DI) + XORQ AX, BP + XORQ DX, R14 + ROLQ $0x3d, R14 + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 64(DI) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 72(DI) + NOTQ R14 + XORQ R10, R15 + ORQ R14, R13 + XORQ R12, R13 + MOVQ R13, 56(DI) + + // Result k + MOVQ 8(SP), R10 + MOVQ 56(SP), R11 + MOVQ 104(SP), R12 + MOVQ 152(SP), R13 + MOVQ 160(SP), R14 + XORQ DX, R11 + ROLQ $0x06, R11 + XORQ R8, R12 + ROLQ $0x19, R12 + MOVQ R11, AX + ORQ R12, AX + XORQ CX, R10 + ROLQ $0x01, R10 + XORQ R10, AX + MOVQ AX, 80(DI) + XORQ AX, SI + XORQ R9, R13 + ROLQ $0x08, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 88(DI) + XORQ AX, BP + XORQ BX, R14 + ROLQ $0x12, R14 + NOTQ R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 96(DI) + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 104(DI) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 112(DI) + XORQ R10, R15 + + // Result m + MOVQ 40(SP), R11 + XORQ BX, R11 + MOVQ 88(SP), R12 + ROLQ $0x24, R11 + XORQ CX, R12 + MOVQ 32(SP), R10 + ROLQ $0x0a, R12 + MOVQ R11, AX + MOVQ 136(SP), R13 + ANDQ R12, AX + XORQ R9, R10 + MOVQ 184(SP), R14 + ROLQ $0x1b, R10 + XORQ R10, AX + MOVQ AX, 120(DI) + XORQ AX, SI + XORQ DX, R13 + ROLQ $0x0f, R13 + MOVQ R12, AX + ORQ R13, AX + XORQ R11, AX + MOVQ AX, 128(DI) + XORQ AX, BP + XORQ R8, R14 + ROLQ $0x38, R14 + NOTQ R13 + MOVQ R13, AX + ORQ R14, AX + XORQ R12, AX + MOVQ AX, 136(DI) + ORQ R10, R11 + XORQ R14, R11 + MOVQ R11, 152(DI) + ANDQ R10, R14 + XORQ R13, R14 + MOVQ R14, 144(DI) + XORQ R11, R15 + + // Result s + MOVQ 16(SP), R10 + MOVQ 64(SP), R11 + MOVQ 112(SP), R12 + XORQ DX, R10 + MOVQ 120(SP), R13 + ROLQ $0x3e, R10 + XORQ R8, R11 + MOVQ 168(SP), R14 + ROLQ $0x37, R11 + XORQ R9, R12 + MOVQ R10, R9 + XORQ CX, R14 + ROLQ $0x02, R14 + ANDQ R11, R9 + XORQ R14, R9 + MOVQ R9, 192(DI) + ROLQ $0x27, R12 + XORQ R9, R15 + NOTQ R11 + XORQ BX, R13 + MOVQ R11, BX + ANDQ R12, BX + XORQ R10, BX + MOVQ BX, 160(DI) + XORQ BX, SI + ROLQ $0x29, R13 + MOVQ R12, CX + ORQ R13, CX + XORQ R11, CX + MOVQ CX, 168(DI) + XORQ CX, BP + MOVQ R13, DX + MOVQ R14, R8 + ANDQ R14, DX + ORQ R10, R8 + XORQ R12, DX + XORQ R13, R8 + MOVQ DX, 176(DI) + MOVQ R8, 184(DI) + + // Prepare round + MOVQ BP, BX + ROLQ $0x01, BX + MOVQ 16(DI), R12 + XORQ 56(DI), DX + XORQ R15, BX + XORQ 96(DI), R12 + XORQ 136(DI), DX + XORQ DX, R12 + MOVQ R12, CX + ROLQ $0x01, CX + MOVQ 24(DI), R13 + XORQ 64(DI), R8 + XORQ SI, CX + XORQ 104(DI), R13 + XORQ 144(DI), R8 + XORQ R8, R13 + MOVQ R13, DX + ROLQ $0x01, DX + MOVQ R15, R8 + XORQ BP, DX + ROLQ $0x01, R8 + MOVQ SI, R9 + XORQ R12, R8 + ROLQ $0x01, R9 + + // Result b + MOVQ (DI), R10 + MOVQ 48(DI), R11 + XORQ R13, R9 + MOVQ 96(DI), R12 + MOVQ 144(DI), R13 + MOVQ 192(DI), R14 + XORQ CX, R11 + ROLQ $0x2c, R11 + XORQ DX, R12 + XORQ BX, R10 + ROLQ $0x2b, R12 + MOVQ R11, SI + MOVQ $0x8000000080008081, AX + ORQ R12, SI + XORQ R10, AX + XORQ AX, SI + MOVQ SI, (SP) + XORQ R9, R14 + ROLQ $0x0e, R14 + MOVQ R10, R15 + ANDQ R11, R15 + XORQ R14, R15 + MOVQ R15, 32(SP) + XORQ R8, R13 + ROLQ $0x15, R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 16(SP) + NOTQ R12 + ORQ R10, R14 + ORQ R13, R12 + XORQ R13, R14 + XORQ R11, R12 + MOVQ R14, 24(SP) + MOVQ R12, 8(SP) + MOVQ R12, BP + + // Result g + MOVQ 72(DI), R11 + XORQ R9, R11 + MOVQ 80(DI), R12 + ROLQ $0x14, R11 + XORQ BX, R12 + ROLQ $0x03, R12 + MOVQ 24(DI), R10 + MOVQ R11, AX + ORQ R12, AX + XORQ R8, R10 + MOVQ 128(DI), R13 + MOVQ 176(DI), R14 + ROLQ $0x1c, R10 + XORQ R10, AX + MOVQ AX, 40(SP) + XORQ AX, SI + XORQ CX, R13 + ROLQ $0x2d, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 48(SP) + XORQ AX, BP + XORQ DX, R14 + ROLQ $0x3d, R14 + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 64(SP) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 72(SP) + NOTQ R14 + XORQ R10, R15 + ORQ R14, R13 + XORQ R12, R13 + MOVQ R13, 56(SP) + + // Result k + MOVQ 8(DI), R10 + MOVQ 56(DI), R11 + MOVQ 104(DI), R12 + MOVQ 152(DI), R13 + MOVQ 160(DI), R14 + XORQ DX, R11 + ROLQ $0x06, R11 + XORQ R8, R12 + ROLQ $0x19, R12 + MOVQ R11, AX + ORQ R12, AX + XORQ CX, R10 + ROLQ $0x01, R10 + XORQ R10, AX + MOVQ AX, 80(SP) + XORQ AX, SI + XORQ R9, R13 + ROLQ $0x08, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 88(SP) + XORQ AX, BP + XORQ BX, R14 + ROLQ $0x12, R14 + NOTQ R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 96(SP) + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 104(SP) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 112(SP) + XORQ R10, R15 + + // Result m + MOVQ 40(DI), R11 + XORQ BX, R11 + MOVQ 88(DI), R12 + ROLQ $0x24, R11 + XORQ CX, R12 + MOVQ 32(DI), R10 + ROLQ $0x0a, R12 + MOVQ R11, AX + MOVQ 136(DI), R13 + ANDQ R12, AX + XORQ R9, R10 + MOVQ 184(DI), R14 + ROLQ $0x1b, R10 + XORQ R10, AX + MOVQ AX, 120(SP) + XORQ AX, SI + XORQ DX, R13 + ROLQ $0x0f, R13 + MOVQ R12, AX + ORQ R13, AX + XORQ R11, AX + MOVQ AX, 128(SP) + XORQ AX, BP + XORQ R8, R14 + ROLQ $0x38, R14 + NOTQ R13 + MOVQ R13, AX + ORQ R14, AX + XORQ R12, AX + MOVQ AX, 136(SP) + ORQ R10, R11 + XORQ R14, R11 + MOVQ R11, 152(SP) + ANDQ R10, R14 + XORQ R13, R14 + MOVQ R14, 144(SP) + XORQ R11, R15 + + // Result s + MOVQ 16(DI), R10 + MOVQ 64(DI), R11 + MOVQ 112(DI), R12 + XORQ DX, R10 + MOVQ 120(DI), R13 + ROLQ $0x3e, R10 + XORQ R8, R11 + MOVQ 168(DI), R14 + ROLQ $0x37, R11 + XORQ R9, R12 + MOVQ R10, R9 + XORQ CX, R14 + ROLQ $0x02, R14 + ANDQ R11, R9 + XORQ R14, R9 + MOVQ R9, 192(SP) + ROLQ $0x27, R12 + XORQ R9, R15 + NOTQ R11 + XORQ BX, R13 + MOVQ R11, BX + ANDQ R12, BX + XORQ R10, BX + MOVQ BX, 160(SP) + XORQ BX, SI + ROLQ $0x29, R13 + MOVQ R12, CX + ORQ R13, CX + XORQ R11, CX + MOVQ CX, 168(SP) + XORQ CX, BP + MOVQ R13, DX + MOVQ R14, R8 + ANDQ R14, DX + ORQ R10, R8 + XORQ R12, DX + XORQ R13, R8 + MOVQ DX, 176(SP) + MOVQ R8, 184(SP) + + // Prepare round + MOVQ BP, BX + ROLQ $0x01, BX + MOVQ 16(SP), R12 + XORQ 56(SP), DX + XORQ R15, BX + XORQ 96(SP), R12 + XORQ 136(SP), DX + XORQ DX, R12 + MOVQ R12, CX + ROLQ $0x01, CX + MOVQ 24(SP), R13 + XORQ 64(SP), R8 + XORQ SI, CX + XORQ 104(SP), R13 + XORQ 144(SP), R8 + XORQ R8, R13 + MOVQ R13, DX + ROLQ $0x01, DX + MOVQ R15, R8 + XORQ BP, DX + ROLQ $0x01, R8 + MOVQ SI, R9 + XORQ R12, R8 + ROLQ $0x01, R9 + + // Result b + MOVQ (SP), R10 + MOVQ 48(SP), R11 + XORQ R13, R9 + MOVQ 96(SP), R12 + MOVQ 144(SP), R13 + MOVQ 192(SP), R14 + XORQ CX, R11 + ROLQ $0x2c, R11 + XORQ DX, R12 + XORQ BX, R10 + ROLQ $0x2b, R12 + MOVQ R11, SI + MOVQ $0x8000000000008009, AX + ORQ R12, SI + XORQ R10, AX + XORQ AX, SI + MOVQ SI, (DI) + XORQ R9, R14 + ROLQ $0x0e, R14 + MOVQ R10, R15 + ANDQ R11, R15 + XORQ R14, R15 + MOVQ R15, 32(DI) + XORQ R8, R13 + ROLQ $0x15, R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 16(DI) + NOTQ R12 + ORQ R10, R14 + ORQ R13, R12 + XORQ R13, R14 + XORQ R11, R12 + MOVQ R14, 24(DI) + MOVQ R12, 8(DI) + MOVQ R12, BP + + // Result g + MOVQ 72(SP), R11 + XORQ R9, R11 + MOVQ 80(SP), R12 + ROLQ $0x14, R11 + XORQ BX, R12 + ROLQ $0x03, R12 + MOVQ 24(SP), R10 + MOVQ R11, AX + ORQ R12, AX + XORQ R8, R10 + MOVQ 128(SP), R13 + MOVQ 176(SP), R14 + ROLQ $0x1c, R10 + XORQ R10, AX + MOVQ AX, 40(DI) + XORQ AX, SI + XORQ CX, R13 + ROLQ $0x2d, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 48(DI) + XORQ AX, BP + XORQ DX, R14 + ROLQ $0x3d, R14 + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 64(DI) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 72(DI) + NOTQ R14 + XORQ R10, R15 + ORQ R14, R13 + XORQ R12, R13 + MOVQ R13, 56(DI) + + // Result k + MOVQ 8(SP), R10 + MOVQ 56(SP), R11 + MOVQ 104(SP), R12 + MOVQ 152(SP), R13 + MOVQ 160(SP), R14 + XORQ DX, R11 + ROLQ $0x06, R11 + XORQ R8, R12 + ROLQ $0x19, R12 + MOVQ R11, AX + ORQ R12, AX + XORQ CX, R10 + ROLQ $0x01, R10 + XORQ R10, AX + MOVQ AX, 80(DI) + XORQ AX, SI + XORQ R9, R13 + ROLQ $0x08, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 88(DI) + XORQ AX, BP + XORQ BX, R14 + ROLQ $0x12, R14 + NOTQ R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 96(DI) + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 104(DI) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 112(DI) + XORQ R10, R15 + + // Result m + MOVQ 40(SP), R11 + XORQ BX, R11 + MOVQ 88(SP), R12 + ROLQ $0x24, R11 + XORQ CX, R12 + MOVQ 32(SP), R10 + ROLQ $0x0a, R12 + MOVQ R11, AX + MOVQ 136(SP), R13 + ANDQ R12, AX + XORQ R9, R10 + MOVQ 184(SP), R14 + ROLQ $0x1b, R10 + XORQ R10, AX + MOVQ AX, 120(DI) + XORQ AX, SI + XORQ DX, R13 + ROLQ $0x0f, R13 + MOVQ R12, AX + ORQ R13, AX + XORQ R11, AX + MOVQ AX, 128(DI) + XORQ AX, BP + XORQ R8, R14 + ROLQ $0x38, R14 + NOTQ R13 + MOVQ R13, AX + ORQ R14, AX + XORQ R12, AX + MOVQ AX, 136(DI) + ORQ R10, R11 + XORQ R14, R11 + MOVQ R11, 152(DI) + ANDQ R10, R14 + XORQ R13, R14 + MOVQ R14, 144(DI) + XORQ R11, R15 + + // Result s + MOVQ 16(SP), R10 + MOVQ 64(SP), R11 + MOVQ 112(SP), R12 + XORQ DX, R10 + MOVQ 120(SP), R13 + ROLQ $0x3e, R10 + XORQ R8, R11 + MOVQ 168(SP), R14 + ROLQ $0x37, R11 + XORQ R9, R12 + MOVQ R10, R9 + XORQ CX, R14 + ROLQ $0x02, R14 + ANDQ R11, R9 + XORQ R14, R9 + MOVQ R9, 192(DI) + ROLQ $0x27, R12 + XORQ R9, R15 + NOTQ R11 + XORQ BX, R13 + MOVQ R11, BX + ANDQ R12, BX + XORQ R10, BX + MOVQ BX, 160(DI) + XORQ BX, SI + ROLQ $0x29, R13 + MOVQ R12, CX + ORQ R13, CX + XORQ R11, CX + MOVQ CX, 168(DI) + XORQ CX, BP + MOVQ R13, DX + MOVQ R14, R8 + ANDQ R14, DX + ORQ R10, R8 + XORQ R12, DX + XORQ R13, R8 + MOVQ DX, 176(DI) + MOVQ R8, 184(DI) + + // Prepare round + MOVQ BP, BX + ROLQ $0x01, BX + MOVQ 16(DI), R12 + XORQ 56(DI), DX + XORQ R15, BX + XORQ 96(DI), R12 + XORQ 136(DI), DX + XORQ DX, R12 + MOVQ R12, CX + ROLQ $0x01, CX + MOVQ 24(DI), R13 + XORQ 64(DI), R8 + XORQ SI, CX + XORQ 104(DI), R13 + XORQ 144(DI), R8 + XORQ R8, R13 + MOVQ R13, DX + ROLQ $0x01, DX + MOVQ R15, R8 + XORQ BP, DX + ROLQ $0x01, R8 + MOVQ SI, R9 + XORQ R12, R8 + ROLQ $0x01, R9 + + // Result b + MOVQ (DI), R10 + MOVQ 48(DI), R11 + XORQ R13, R9 + MOVQ 96(DI), R12 + MOVQ 144(DI), R13 + MOVQ 192(DI), R14 + XORQ CX, R11 + ROLQ $0x2c, R11 + XORQ DX, R12 + XORQ BX, R10 + ROLQ $0x2b, R12 + MOVQ R11, SI + MOVQ $0x000000000000008a, AX + ORQ R12, SI + XORQ R10, AX + XORQ AX, SI + MOVQ SI, (SP) + XORQ R9, R14 + ROLQ $0x0e, R14 + MOVQ R10, R15 + ANDQ R11, R15 + XORQ R14, R15 + MOVQ R15, 32(SP) + XORQ R8, R13 + ROLQ $0x15, R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 16(SP) + NOTQ R12 + ORQ R10, R14 + ORQ R13, R12 + XORQ R13, R14 + XORQ R11, R12 + MOVQ R14, 24(SP) + MOVQ R12, 8(SP) + MOVQ R12, BP + + // Result g + MOVQ 72(DI), R11 + XORQ R9, R11 + MOVQ 80(DI), R12 + ROLQ $0x14, R11 + XORQ BX, R12 + ROLQ $0x03, R12 + MOVQ 24(DI), R10 + MOVQ R11, AX + ORQ R12, AX + XORQ R8, R10 + MOVQ 128(DI), R13 + MOVQ 176(DI), R14 + ROLQ $0x1c, R10 + XORQ R10, AX + MOVQ AX, 40(SP) + XORQ AX, SI + XORQ CX, R13 + ROLQ $0x2d, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 48(SP) + XORQ AX, BP + XORQ DX, R14 + ROLQ $0x3d, R14 + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 64(SP) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 72(SP) + NOTQ R14 + XORQ R10, R15 + ORQ R14, R13 + XORQ R12, R13 + MOVQ R13, 56(SP) + + // Result k + MOVQ 8(DI), R10 + MOVQ 56(DI), R11 + MOVQ 104(DI), R12 + MOVQ 152(DI), R13 + MOVQ 160(DI), R14 + XORQ DX, R11 + ROLQ $0x06, R11 + XORQ R8, R12 + ROLQ $0x19, R12 + MOVQ R11, AX + ORQ R12, AX + XORQ CX, R10 + ROLQ $0x01, R10 + XORQ R10, AX + MOVQ AX, 80(SP) + XORQ AX, SI + XORQ R9, R13 + ROLQ $0x08, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 88(SP) + XORQ AX, BP + XORQ BX, R14 + ROLQ $0x12, R14 + NOTQ R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 96(SP) + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 104(SP) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 112(SP) + XORQ R10, R15 + + // Result m + MOVQ 40(DI), R11 + XORQ BX, R11 + MOVQ 88(DI), R12 + ROLQ $0x24, R11 + XORQ CX, R12 + MOVQ 32(DI), R10 + ROLQ $0x0a, R12 + MOVQ R11, AX + MOVQ 136(DI), R13 + ANDQ R12, AX + XORQ R9, R10 + MOVQ 184(DI), R14 + ROLQ $0x1b, R10 + XORQ R10, AX + MOVQ AX, 120(SP) + XORQ AX, SI + XORQ DX, R13 + ROLQ $0x0f, R13 + MOVQ R12, AX + ORQ R13, AX + XORQ R11, AX + MOVQ AX, 128(SP) + XORQ AX, BP + XORQ R8, R14 + ROLQ $0x38, R14 + NOTQ R13 + MOVQ R13, AX + ORQ R14, AX + XORQ R12, AX + MOVQ AX, 136(SP) + ORQ R10, R11 + XORQ R14, R11 + MOVQ R11, 152(SP) + ANDQ R10, R14 + XORQ R13, R14 + MOVQ R14, 144(SP) + XORQ R11, R15 + + // Result s + MOVQ 16(DI), R10 + MOVQ 64(DI), R11 + MOVQ 112(DI), R12 + XORQ DX, R10 + MOVQ 120(DI), R13 + ROLQ $0x3e, R10 + XORQ R8, R11 + MOVQ 168(DI), R14 + ROLQ $0x37, R11 + XORQ R9, R12 + MOVQ R10, R9 + XORQ CX, R14 + ROLQ $0x02, R14 + ANDQ R11, R9 + XORQ R14, R9 + MOVQ R9, 192(SP) + ROLQ $0x27, R12 + XORQ R9, R15 + NOTQ R11 + XORQ BX, R13 + MOVQ R11, BX + ANDQ R12, BX + XORQ R10, BX + MOVQ BX, 160(SP) + XORQ BX, SI + ROLQ $0x29, R13 + MOVQ R12, CX + ORQ R13, CX + XORQ R11, CX + MOVQ CX, 168(SP) + XORQ CX, BP + MOVQ R13, DX + MOVQ R14, R8 + ANDQ R14, DX + ORQ R10, R8 + XORQ R12, DX + XORQ R13, R8 + MOVQ DX, 176(SP) + MOVQ R8, 184(SP) + + // Prepare round + MOVQ BP, BX + ROLQ $0x01, BX + MOVQ 16(SP), R12 + XORQ 56(SP), DX + XORQ R15, BX + XORQ 96(SP), R12 + XORQ 136(SP), DX + XORQ DX, R12 + MOVQ R12, CX + ROLQ $0x01, CX + MOVQ 24(SP), R13 + XORQ 64(SP), R8 + XORQ SI, CX + XORQ 104(SP), R13 + XORQ 144(SP), R8 + XORQ R8, R13 + MOVQ R13, DX + ROLQ $0x01, DX + MOVQ R15, R8 + XORQ BP, DX + ROLQ $0x01, R8 + MOVQ SI, R9 + XORQ R12, R8 + ROLQ $0x01, R9 + + // Result b + MOVQ (SP), R10 + MOVQ 48(SP), R11 + XORQ R13, R9 + MOVQ 96(SP), R12 + MOVQ 144(SP), R13 + MOVQ 192(SP), R14 + XORQ CX, R11 + ROLQ $0x2c, R11 + XORQ DX, R12 + XORQ BX, R10 + ROLQ $0x2b, R12 + MOVQ R11, SI + MOVQ $0x0000000000000088, AX + ORQ R12, SI + XORQ R10, AX + XORQ AX, SI + MOVQ SI, (DI) + XORQ R9, R14 + ROLQ $0x0e, R14 + MOVQ R10, R15 + ANDQ R11, R15 + XORQ R14, R15 + MOVQ R15, 32(DI) + XORQ R8, R13 + ROLQ $0x15, R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 16(DI) + NOTQ R12 + ORQ R10, R14 + ORQ R13, R12 + XORQ R13, R14 + XORQ R11, R12 + MOVQ R14, 24(DI) + MOVQ R12, 8(DI) + MOVQ R12, BP + + // Result g + MOVQ 72(SP), R11 + XORQ R9, R11 + MOVQ 80(SP), R12 + ROLQ $0x14, R11 + XORQ BX, R12 + ROLQ $0x03, R12 + MOVQ 24(SP), R10 + MOVQ R11, AX + ORQ R12, AX + XORQ R8, R10 + MOVQ 128(SP), R13 + MOVQ 176(SP), R14 + ROLQ $0x1c, R10 + XORQ R10, AX + MOVQ AX, 40(DI) + XORQ AX, SI + XORQ CX, R13 + ROLQ $0x2d, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 48(DI) + XORQ AX, BP + XORQ DX, R14 + ROLQ $0x3d, R14 + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 64(DI) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 72(DI) + NOTQ R14 + XORQ R10, R15 + ORQ R14, R13 + XORQ R12, R13 + MOVQ R13, 56(DI) + + // Result k + MOVQ 8(SP), R10 + MOVQ 56(SP), R11 + MOVQ 104(SP), R12 + MOVQ 152(SP), R13 + MOVQ 160(SP), R14 + XORQ DX, R11 + ROLQ $0x06, R11 + XORQ R8, R12 + ROLQ $0x19, R12 + MOVQ R11, AX + ORQ R12, AX + XORQ CX, R10 + ROLQ $0x01, R10 + XORQ R10, AX + MOVQ AX, 80(DI) + XORQ AX, SI + XORQ R9, R13 + ROLQ $0x08, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 88(DI) + XORQ AX, BP + XORQ BX, R14 + ROLQ $0x12, R14 + NOTQ R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 96(DI) + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 104(DI) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 112(DI) + XORQ R10, R15 + + // Result m + MOVQ 40(SP), R11 + XORQ BX, R11 + MOVQ 88(SP), R12 + ROLQ $0x24, R11 + XORQ CX, R12 + MOVQ 32(SP), R10 + ROLQ $0x0a, R12 + MOVQ R11, AX + MOVQ 136(SP), R13 + ANDQ R12, AX + XORQ R9, R10 + MOVQ 184(SP), R14 + ROLQ $0x1b, R10 + XORQ R10, AX + MOVQ AX, 120(DI) + XORQ AX, SI + XORQ DX, R13 + ROLQ $0x0f, R13 + MOVQ R12, AX + ORQ R13, AX + XORQ R11, AX + MOVQ AX, 128(DI) + XORQ AX, BP + XORQ R8, R14 + ROLQ $0x38, R14 + NOTQ R13 + MOVQ R13, AX + ORQ R14, AX + XORQ R12, AX + MOVQ AX, 136(DI) + ORQ R10, R11 + XORQ R14, R11 + MOVQ R11, 152(DI) + ANDQ R10, R14 + XORQ R13, R14 + MOVQ R14, 144(DI) + XORQ R11, R15 + + // Result s + MOVQ 16(SP), R10 + MOVQ 64(SP), R11 + MOVQ 112(SP), R12 + XORQ DX, R10 + MOVQ 120(SP), R13 + ROLQ $0x3e, R10 + XORQ R8, R11 + MOVQ 168(SP), R14 + ROLQ $0x37, R11 + XORQ R9, R12 + MOVQ R10, R9 + XORQ CX, R14 + ROLQ $0x02, R14 + ANDQ R11, R9 + XORQ R14, R9 + MOVQ R9, 192(DI) + ROLQ $0x27, R12 + XORQ R9, R15 + NOTQ R11 + XORQ BX, R13 + MOVQ R11, BX + ANDQ R12, BX + XORQ R10, BX + MOVQ BX, 160(DI) + XORQ BX, SI + ROLQ $0x29, R13 + MOVQ R12, CX + ORQ R13, CX + XORQ R11, CX + MOVQ CX, 168(DI) + XORQ CX, BP + MOVQ R13, DX + MOVQ R14, R8 + ANDQ R14, DX + ORQ R10, R8 + XORQ R12, DX + XORQ R13, R8 + MOVQ DX, 176(DI) + MOVQ R8, 184(DI) + + // Prepare round + MOVQ BP, BX + ROLQ $0x01, BX + MOVQ 16(DI), R12 + XORQ 56(DI), DX + XORQ R15, BX + XORQ 96(DI), R12 + XORQ 136(DI), DX + XORQ DX, R12 + MOVQ R12, CX + ROLQ $0x01, CX + MOVQ 24(DI), R13 + XORQ 64(DI), R8 + XORQ SI, CX + XORQ 104(DI), R13 + XORQ 144(DI), R8 + XORQ R8, R13 + MOVQ R13, DX + ROLQ $0x01, DX + MOVQ R15, R8 + XORQ BP, DX + ROLQ $0x01, R8 + MOVQ SI, R9 + XORQ R12, R8 + ROLQ $0x01, R9 + + // Result b + MOVQ (DI), R10 + MOVQ 48(DI), R11 + XORQ R13, R9 + MOVQ 96(DI), R12 + MOVQ 144(DI), R13 + MOVQ 192(DI), R14 + XORQ CX, R11 + ROLQ $0x2c, R11 + XORQ DX, R12 + XORQ BX, R10 + ROLQ $0x2b, R12 + MOVQ R11, SI + MOVQ $0x0000000080008009, AX + ORQ R12, SI + XORQ R10, AX + XORQ AX, SI + MOVQ SI, (SP) + XORQ R9, R14 + ROLQ $0x0e, R14 + MOVQ R10, R15 + ANDQ R11, R15 + XORQ R14, R15 + MOVQ R15, 32(SP) + XORQ R8, R13 + ROLQ $0x15, R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 16(SP) + NOTQ R12 + ORQ R10, R14 + ORQ R13, R12 + XORQ R13, R14 + XORQ R11, R12 + MOVQ R14, 24(SP) + MOVQ R12, 8(SP) + MOVQ R12, BP + + // Result g + MOVQ 72(DI), R11 + XORQ R9, R11 + MOVQ 80(DI), R12 + ROLQ $0x14, R11 + XORQ BX, R12 + ROLQ $0x03, R12 + MOVQ 24(DI), R10 + MOVQ R11, AX + ORQ R12, AX + XORQ R8, R10 + MOVQ 128(DI), R13 + MOVQ 176(DI), R14 + ROLQ $0x1c, R10 + XORQ R10, AX + MOVQ AX, 40(SP) + XORQ AX, SI + XORQ CX, R13 + ROLQ $0x2d, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 48(SP) + XORQ AX, BP + XORQ DX, R14 + ROLQ $0x3d, R14 + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 64(SP) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 72(SP) + NOTQ R14 + XORQ R10, R15 + ORQ R14, R13 + XORQ R12, R13 + MOVQ R13, 56(SP) + + // Result k + MOVQ 8(DI), R10 + MOVQ 56(DI), R11 + MOVQ 104(DI), R12 + MOVQ 152(DI), R13 + MOVQ 160(DI), R14 + XORQ DX, R11 + ROLQ $0x06, R11 + XORQ R8, R12 + ROLQ $0x19, R12 + MOVQ R11, AX + ORQ R12, AX + XORQ CX, R10 + ROLQ $0x01, R10 + XORQ R10, AX + MOVQ AX, 80(SP) + XORQ AX, SI + XORQ R9, R13 + ROLQ $0x08, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 88(SP) + XORQ AX, BP + XORQ BX, R14 + ROLQ $0x12, R14 + NOTQ R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 96(SP) + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 104(SP) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 112(SP) + XORQ R10, R15 + + // Result m + MOVQ 40(DI), R11 + XORQ BX, R11 + MOVQ 88(DI), R12 + ROLQ $0x24, R11 + XORQ CX, R12 + MOVQ 32(DI), R10 + ROLQ $0x0a, R12 + MOVQ R11, AX + MOVQ 136(DI), R13 + ANDQ R12, AX + XORQ R9, R10 + MOVQ 184(DI), R14 + ROLQ $0x1b, R10 + XORQ R10, AX + MOVQ AX, 120(SP) + XORQ AX, SI + XORQ DX, R13 + ROLQ $0x0f, R13 + MOVQ R12, AX + ORQ R13, AX + XORQ R11, AX + MOVQ AX, 128(SP) + XORQ AX, BP + XORQ R8, R14 + ROLQ $0x38, R14 + NOTQ R13 + MOVQ R13, AX + ORQ R14, AX + XORQ R12, AX + MOVQ AX, 136(SP) + ORQ R10, R11 + XORQ R14, R11 + MOVQ R11, 152(SP) + ANDQ R10, R14 + XORQ R13, R14 + MOVQ R14, 144(SP) + XORQ R11, R15 + + // Result s + MOVQ 16(DI), R10 + MOVQ 64(DI), R11 + MOVQ 112(DI), R12 + XORQ DX, R10 + MOVQ 120(DI), R13 + ROLQ $0x3e, R10 + XORQ R8, R11 + MOVQ 168(DI), R14 + ROLQ $0x37, R11 + XORQ R9, R12 + MOVQ R10, R9 + XORQ CX, R14 + ROLQ $0x02, R14 + ANDQ R11, R9 + XORQ R14, R9 + MOVQ R9, 192(SP) + ROLQ $0x27, R12 + XORQ R9, R15 + NOTQ R11 + XORQ BX, R13 + MOVQ R11, BX + ANDQ R12, BX + XORQ R10, BX + MOVQ BX, 160(SP) + XORQ BX, SI + ROLQ $0x29, R13 + MOVQ R12, CX + ORQ R13, CX + XORQ R11, CX + MOVQ CX, 168(SP) + XORQ CX, BP + MOVQ R13, DX + MOVQ R14, R8 + ANDQ R14, DX + ORQ R10, R8 + XORQ R12, DX + XORQ R13, R8 + MOVQ DX, 176(SP) + MOVQ R8, 184(SP) + + // Prepare round + MOVQ BP, BX + ROLQ $0x01, BX + MOVQ 16(SP), R12 + XORQ 56(SP), DX + XORQ R15, BX + XORQ 96(SP), R12 + XORQ 136(SP), DX + XORQ DX, R12 + MOVQ R12, CX + ROLQ $0x01, CX + MOVQ 24(SP), R13 + XORQ 64(SP), R8 + XORQ SI, CX + XORQ 104(SP), R13 + XORQ 144(SP), R8 + XORQ R8, R13 + MOVQ R13, DX + ROLQ $0x01, DX + MOVQ R15, R8 + XORQ BP, DX + ROLQ $0x01, R8 + MOVQ SI, R9 + XORQ R12, R8 + ROLQ $0x01, R9 + + // Result b + MOVQ (SP), R10 + MOVQ 48(SP), R11 + XORQ R13, R9 + MOVQ 96(SP), R12 + MOVQ 144(SP), R13 + MOVQ 192(SP), R14 + XORQ CX, R11 + ROLQ $0x2c, R11 + XORQ DX, R12 + XORQ BX, R10 + ROLQ $0x2b, R12 + MOVQ R11, SI + MOVQ $0x000000008000000a, AX + ORQ R12, SI + XORQ R10, AX + XORQ AX, SI + MOVQ SI, (DI) + XORQ R9, R14 + ROLQ $0x0e, R14 + MOVQ R10, R15 + ANDQ R11, R15 + XORQ R14, R15 + MOVQ R15, 32(DI) + XORQ R8, R13 + ROLQ $0x15, R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 16(DI) + NOTQ R12 + ORQ R10, R14 + ORQ R13, R12 + XORQ R13, R14 + XORQ R11, R12 + MOVQ R14, 24(DI) + MOVQ R12, 8(DI) + MOVQ R12, BP + + // Result g + MOVQ 72(SP), R11 + XORQ R9, R11 + MOVQ 80(SP), R12 + ROLQ $0x14, R11 + XORQ BX, R12 + ROLQ $0x03, R12 + MOVQ 24(SP), R10 + MOVQ R11, AX + ORQ R12, AX + XORQ R8, R10 + MOVQ 128(SP), R13 + MOVQ 176(SP), R14 + ROLQ $0x1c, R10 + XORQ R10, AX + MOVQ AX, 40(DI) + XORQ AX, SI + XORQ CX, R13 + ROLQ $0x2d, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 48(DI) + XORQ AX, BP + XORQ DX, R14 + ROLQ $0x3d, R14 + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 64(DI) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 72(DI) + NOTQ R14 + XORQ R10, R15 + ORQ R14, R13 + XORQ R12, R13 + MOVQ R13, 56(DI) + + // Result k + MOVQ 8(SP), R10 + MOVQ 56(SP), R11 + MOVQ 104(SP), R12 + MOVQ 152(SP), R13 + MOVQ 160(SP), R14 + XORQ DX, R11 + ROLQ $0x06, R11 + XORQ R8, R12 + ROLQ $0x19, R12 + MOVQ R11, AX + ORQ R12, AX + XORQ CX, R10 + ROLQ $0x01, R10 + XORQ R10, AX + MOVQ AX, 80(DI) + XORQ AX, SI + XORQ R9, R13 + ROLQ $0x08, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 88(DI) + XORQ AX, BP + XORQ BX, R14 + ROLQ $0x12, R14 + NOTQ R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 96(DI) + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 104(DI) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 112(DI) + XORQ R10, R15 + + // Result m + MOVQ 40(SP), R11 + XORQ BX, R11 + MOVQ 88(SP), R12 + ROLQ $0x24, R11 + XORQ CX, R12 + MOVQ 32(SP), R10 + ROLQ $0x0a, R12 + MOVQ R11, AX + MOVQ 136(SP), R13 + ANDQ R12, AX + XORQ R9, R10 + MOVQ 184(SP), R14 + ROLQ $0x1b, R10 + XORQ R10, AX + MOVQ AX, 120(DI) + XORQ AX, SI + XORQ DX, R13 + ROLQ $0x0f, R13 + MOVQ R12, AX + ORQ R13, AX + XORQ R11, AX + MOVQ AX, 128(DI) + XORQ AX, BP + XORQ R8, R14 + ROLQ $0x38, R14 + NOTQ R13 + MOVQ R13, AX + ORQ R14, AX + XORQ R12, AX + MOVQ AX, 136(DI) + ORQ R10, R11 + XORQ R14, R11 + MOVQ R11, 152(DI) + ANDQ R10, R14 + XORQ R13, R14 + MOVQ R14, 144(DI) + XORQ R11, R15 + + // Result s + MOVQ 16(SP), R10 + MOVQ 64(SP), R11 + MOVQ 112(SP), R12 + XORQ DX, R10 + MOVQ 120(SP), R13 + ROLQ $0x3e, R10 + XORQ R8, R11 + MOVQ 168(SP), R14 + ROLQ $0x37, R11 + XORQ R9, R12 + MOVQ R10, R9 + XORQ CX, R14 + ROLQ $0x02, R14 + ANDQ R11, R9 + XORQ R14, R9 + MOVQ R9, 192(DI) + ROLQ $0x27, R12 + XORQ R9, R15 + NOTQ R11 + XORQ BX, R13 + MOVQ R11, BX + ANDQ R12, BX + XORQ R10, BX + MOVQ BX, 160(DI) + XORQ BX, SI + ROLQ $0x29, R13 + MOVQ R12, CX + ORQ R13, CX + XORQ R11, CX + MOVQ CX, 168(DI) + XORQ CX, BP + MOVQ R13, DX + MOVQ R14, R8 + ANDQ R14, DX + ORQ R10, R8 + XORQ R12, DX + XORQ R13, R8 + MOVQ DX, 176(DI) + MOVQ R8, 184(DI) + + // Prepare round + MOVQ BP, BX + ROLQ $0x01, BX + MOVQ 16(DI), R12 + XORQ 56(DI), DX + XORQ R15, BX + XORQ 96(DI), R12 + XORQ 136(DI), DX + XORQ DX, R12 + MOVQ R12, CX + ROLQ $0x01, CX + MOVQ 24(DI), R13 + XORQ 64(DI), R8 + XORQ SI, CX + XORQ 104(DI), R13 + XORQ 144(DI), R8 + XORQ R8, R13 + MOVQ R13, DX + ROLQ $0x01, DX + MOVQ R15, R8 + XORQ BP, DX + ROLQ $0x01, R8 + MOVQ SI, R9 + XORQ R12, R8 + ROLQ $0x01, R9 + + // Result b + MOVQ (DI), R10 + MOVQ 48(DI), R11 + XORQ R13, R9 + MOVQ 96(DI), R12 + MOVQ 144(DI), R13 + MOVQ 192(DI), R14 + XORQ CX, R11 + ROLQ $0x2c, R11 + XORQ DX, R12 + XORQ BX, R10 + ROLQ $0x2b, R12 + MOVQ R11, SI + MOVQ $0x000000008000808b, AX + ORQ R12, SI + XORQ R10, AX + XORQ AX, SI + MOVQ SI, (SP) + XORQ R9, R14 + ROLQ $0x0e, R14 + MOVQ R10, R15 + ANDQ R11, R15 + XORQ R14, R15 + MOVQ R15, 32(SP) + XORQ R8, R13 + ROLQ $0x15, R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 16(SP) + NOTQ R12 + ORQ R10, R14 + ORQ R13, R12 + XORQ R13, R14 + XORQ R11, R12 + MOVQ R14, 24(SP) + MOVQ R12, 8(SP) + MOVQ R12, BP + + // Result g + MOVQ 72(DI), R11 + XORQ R9, R11 + MOVQ 80(DI), R12 + ROLQ $0x14, R11 + XORQ BX, R12 + ROLQ $0x03, R12 + MOVQ 24(DI), R10 + MOVQ R11, AX + ORQ R12, AX + XORQ R8, R10 + MOVQ 128(DI), R13 + MOVQ 176(DI), R14 + ROLQ $0x1c, R10 + XORQ R10, AX + MOVQ AX, 40(SP) + XORQ AX, SI + XORQ CX, R13 + ROLQ $0x2d, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 48(SP) + XORQ AX, BP + XORQ DX, R14 + ROLQ $0x3d, R14 + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 64(SP) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 72(SP) + NOTQ R14 + XORQ R10, R15 + ORQ R14, R13 + XORQ R12, R13 + MOVQ R13, 56(SP) + + // Result k + MOVQ 8(DI), R10 + MOVQ 56(DI), R11 + MOVQ 104(DI), R12 + MOVQ 152(DI), R13 + MOVQ 160(DI), R14 + XORQ DX, R11 + ROLQ $0x06, R11 + XORQ R8, R12 + ROLQ $0x19, R12 + MOVQ R11, AX + ORQ R12, AX + XORQ CX, R10 + ROLQ $0x01, R10 + XORQ R10, AX + MOVQ AX, 80(SP) + XORQ AX, SI + XORQ R9, R13 + ROLQ $0x08, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 88(SP) + XORQ AX, BP + XORQ BX, R14 + ROLQ $0x12, R14 + NOTQ R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 96(SP) + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 104(SP) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 112(SP) + XORQ R10, R15 + + // Result m + MOVQ 40(DI), R11 + XORQ BX, R11 + MOVQ 88(DI), R12 + ROLQ $0x24, R11 + XORQ CX, R12 + MOVQ 32(DI), R10 + ROLQ $0x0a, R12 + MOVQ R11, AX + MOVQ 136(DI), R13 + ANDQ R12, AX + XORQ R9, R10 + MOVQ 184(DI), R14 + ROLQ $0x1b, R10 + XORQ R10, AX + MOVQ AX, 120(SP) + XORQ AX, SI + XORQ DX, R13 + ROLQ $0x0f, R13 + MOVQ R12, AX + ORQ R13, AX + XORQ R11, AX + MOVQ AX, 128(SP) + XORQ AX, BP + XORQ R8, R14 + ROLQ $0x38, R14 + NOTQ R13 + MOVQ R13, AX + ORQ R14, AX + XORQ R12, AX + MOVQ AX, 136(SP) + ORQ R10, R11 + XORQ R14, R11 + MOVQ R11, 152(SP) + ANDQ R10, R14 + XORQ R13, R14 + MOVQ R14, 144(SP) + XORQ R11, R15 + + // Result s + MOVQ 16(DI), R10 + MOVQ 64(DI), R11 + MOVQ 112(DI), R12 + XORQ DX, R10 + MOVQ 120(DI), R13 + ROLQ $0x3e, R10 + XORQ R8, R11 + MOVQ 168(DI), R14 + ROLQ $0x37, R11 + XORQ R9, R12 + MOVQ R10, R9 + XORQ CX, R14 + ROLQ $0x02, R14 + ANDQ R11, R9 + XORQ R14, R9 + MOVQ R9, 192(SP) + ROLQ $0x27, R12 + XORQ R9, R15 + NOTQ R11 + XORQ BX, R13 + MOVQ R11, BX + ANDQ R12, BX + XORQ R10, BX + MOVQ BX, 160(SP) + XORQ BX, SI + ROLQ $0x29, R13 + MOVQ R12, CX + ORQ R13, CX + XORQ R11, CX + MOVQ CX, 168(SP) + XORQ CX, BP + MOVQ R13, DX + MOVQ R14, R8 + ANDQ R14, DX + ORQ R10, R8 + XORQ R12, DX + XORQ R13, R8 + MOVQ DX, 176(SP) + MOVQ R8, 184(SP) + + // Prepare round + MOVQ BP, BX + ROLQ $0x01, BX + MOVQ 16(SP), R12 + XORQ 56(SP), DX + XORQ R15, BX + XORQ 96(SP), R12 + XORQ 136(SP), DX + XORQ DX, R12 + MOVQ R12, CX + ROLQ $0x01, CX + MOVQ 24(SP), R13 + XORQ 64(SP), R8 + XORQ SI, CX + XORQ 104(SP), R13 + XORQ 144(SP), R8 + XORQ R8, R13 + MOVQ R13, DX + ROLQ $0x01, DX + MOVQ R15, R8 + XORQ BP, DX + ROLQ $0x01, R8 + MOVQ SI, R9 + XORQ R12, R8 + ROLQ $0x01, R9 + + // Result b + MOVQ (SP), R10 + MOVQ 48(SP), R11 + XORQ R13, R9 + MOVQ 96(SP), R12 + MOVQ 144(SP), R13 + MOVQ 192(SP), R14 + XORQ CX, R11 + ROLQ $0x2c, R11 + XORQ DX, R12 + XORQ BX, R10 + ROLQ $0x2b, R12 + MOVQ R11, SI + MOVQ $0x800000000000008b, AX + ORQ R12, SI + XORQ R10, AX + XORQ AX, SI + MOVQ SI, (DI) + XORQ R9, R14 + ROLQ $0x0e, R14 + MOVQ R10, R15 + ANDQ R11, R15 + XORQ R14, R15 + MOVQ R15, 32(DI) + XORQ R8, R13 + ROLQ $0x15, R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 16(DI) + NOTQ R12 + ORQ R10, R14 + ORQ R13, R12 + XORQ R13, R14 + XORQ R11, R12 + MOVQ R14, 24(DI) + MOVQ R12, 8(DI) + MOVQ R12, BP + + // Result g + MOVQ 72(SP), R11 + XORQ R9, R11 + MOVQ 80(SP), R12 + ROLQ $0x14, R11 + XORQ BX, R12 + ROLQ $0x03, R12 + MOVQ 24(SP), R10 + MOVQ R11, AX + ORQ R12, AX + XORQ R8, R10 + MOVQ 128(SP), R13 + MOVQ 176(SP), R14 + ROLQ $0x1c, R10 + XORQ R10, AX + MOVQ AX, 40(DI) + XORQ AX, SI + XORQ CX, R13 + ROLQ $0x2d, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 48(DI) + XORQ AX, BP + XORQ DX, R14 + ROLQ $0x3d, R14 + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 64(DI) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 72(DI) + NOTQ R14 + XORQ R10, R15 + ORQ R14, R13 + XORQ R12, R13 + MOVQ R13, 56(DI) + + // Result k + MOVQ 8(SP), R10 + MOVQ 56(SP), R11 + MOVQ 104(SP), R12 + MOVQ 152(SP), R13 + MOVQ 160(SP), R14 + XORQ DX, R11 + ROLQ $0x06, R11 + XORQ R8, R12 + ROLQ $0x19, R12 + MOVQ R11, AX + ORQ R12, AX + XORQ CX, R10 + ROLQ $0x01, R10 + XORQ R10, AX + MOVQ AX, 80(DI) + XORQ AX, SI + XORQ R9, R13 + ROLQ $0x08, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 88(DI) + XORQ AX, BP + XORQ BX, R14 + ROLQ $0x12, R14 + NOTQ R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 96(DI) + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 104(DI) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 112(DI) + XORQ R10, R15 + + // Result m + MOVQ 40(SP), R11 + XORQ BX, R11 + MOVQ 88(SP), R12 + ROLQ $0x24, R11 + XORQ CX, R12 + MOVQ 32(SP), R10 + ROLQ $0x0a, R12 + MOVQ R11, AX + MOVQ 136(SP), R13 + ANDQ R12, AX + XORQ R9, R10 + MOVQ 184(SP), R14 + ROLQ $0x1b, R10 + XORQ R10, AX + MOVQ AX, 120(DI) + XORQ AX, SI + XORQ DX, R13 + ROLQ $0x0f, R13 + MOVQ R12, AX + ORQ R13, AX + XORQ R11, AX + MOVQ AX, 128(DI) + XORQ AX, BP + XORQ R8, R14 + ROLQ $0x38, R14 + NOTQ R13 + MOVQ R13, AX + ORQ R14, AX + XORQ R12, AX + MOVQ AX, 136(DI) + ORQ R10, R11 + XORQ R14, R11 + MOVQ R11, 152(DI) + ANDQ R10, R14 + XORQ R13, R14 + MOVQ R14, 144(DI) + XORQ R11, R15 + + // Result s + MOVQ 16(SP), R10 + MOVQ 64(SP), R11 + MOVQ 112(SP), R12 + XORQ DX, R10 + MOVQ 120(SP), R13 + ROLQ $0x3e, R10 + XORQ R8, R11 + MOVQ 168(SP), R14 + ROLQ $0x37, R11 + XORQ R9, R12 + MOVQ R10, R9 + XORQ CX, R14 + ROLQ $0x02, R14 + ANDQ R11, R9 + XORQ R14, R9 + MOVQ R9, 192(DI) + ROLQ $0x27, R12 + XORQ R9, R15 + NOTQ R11 + XORQ BX, R13 + MOVQ R11, BX + ANDQ R12, BX + XORQ R10, BX + MOVQ BX, 160(DI) + XORQ BX, SI + ROLQ $0x29, R13 + MOVQ R12, CX + ORQ R13, CX + XORQ R11, CX + MOVQ CX, 168(DI) + XORQ CX, BP + MOVQ R13, DX + MOVQ R14, R8 + ANDQ R14, DX + ORQ R10, R8 + XORQ R12, DX + XORQ R13, R8 + MOVQ DX, 176(DI) + MOVQ R8, 184(DI) + + // Prepare round + MOVQ BP, BX + ROLQ $0x01, BX + MOVQ 16(DI), R12 + XORQ 56(DI), DX + XORQ R15, BX + XORQ 96(DI), R12 + XORQ 136(DI), DX + XORQ DX, R12 + MOVQ R12, CX + ROLQ $0x01, CX + MOVQ 24(DI), R13 + XORQ 64(DI), R8 + XORQ SI, CX + XORQ 104(DI), R13 + XORQ 144(DI), R8 + XORQ R8, R13 + MOVQ R13, DX + ROLQ $0x01, DX + MOVQ R15, R8 + XORQ BP, DX + ROLQ $0x01, R8 + MOVQ SI, R9 + XORQ R12, R8 + ROLQ $0x01, R9 + + // Result b + MOVQ (DI), R10 + MOVQ 48(DI), R11 + XORQ R13, R9 + MOVQ 96(DI), R12 + MOVQ 144(DI), R13 + MOVQ 192(DI), R14 + XORQ CX, R11 + ROLQ $0x2c, R11 + XORQ DX, R12 + XORQ BX, R10 + ROLQ $0x2b, R12 + MOVQ R11, SI + MOVQ $0x8000000000008089, AX + ORQ R12, SI + XORQ R10, AX + XORQ AX, SI + MOVQ SI, (SP) + XORQ R9, R14 + ROLQ $0x0e, R14 + MOVQ R10, R15 + ANDQ R11, R15 + XORQ R14, R15 + MOVQ R15, 32(SP) + XORQ R8, R13 + ROLQ $0x15, R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 16(SP) + NOTQ R12 + ORQ R10, R14 + ORQ R13, R12 + XORQ R13, R14 + XORQ R11, R12 + MOVQ R14, 24(SP) + MOVQ R12, 8(SP) + MOVQ R12, BP + + // Result g + MOVQ 72(DI), R11 + XORQ R9, R11 + MOVQ 80(DI), R12 + ROLQ $0x14, R11 + XORQ BX, R12 + ROLQ $0x03, R12 + MOVQ 24(DI), R10 + MOVQ R11, AX + ORQ R12, AX + XORQ R8, R10 + MOVQ 128(DI), R13 + MOVQ 176(DI), R14 + ROLQ $0x1c, R10 + XORQ R10, AX + MOVQ AX, 40(SP) + XORQ AX, SI + XORQ CX, R13 + ROLQ $0x2d, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 48(SP) + XORQ AX, BP + XORQ DX, R14 + ROLQ $0x3d, R14 + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 64(SP) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 72(SP) + NOTQ R14 + XORQ R10, R15 + ORQ R14, R13 + XORQ R12, R13 + MOVQ R13, 56(SP) + + // Result k + MOVQ 8(DI), R10 + MOVQ 56(DI), R11 + MOVQ 104(DI), R12 + MOVQ 152(DI), R13 + MOVQ 160(DI), R14 + XORQ DX, R11 + ROLQ $0x06, R11 + XORQ R8, R12 + ROLQ $0x19, R12 + MOVQ R11, AX + ORQ R12, AX + XORQ CX, R10 + ROLQ $0x01, R10 + XORQ R10, AX + MOVQ AX, 80(SP) + XORQ AX, SI + XORQ R9, R13 + ROLQ $0x08, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 88(SP) + XORQ AX, BP + XORQ BX, R14 + ROLQ $0x12, R14 + NOTQ R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 96(SP) + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 104(SP) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 112(SP) + XORQ R10, R15 + + // Result m + MOVQ 40(DI), R11 + XORQ BX, R11 + MOVQ 88(DI), R12 + ROLQ $0x24, R11 + XORQ CX, R12 + MOVQ 32(DI), R10 + ROLQ $0x0a, R12 + MOVQ R11, AX + MOVQ 136(DI), R13 + ANDQ R12, AX + XORQ R9, R10 + MOVQ 184(DI), R14 + ROLQ $0x1b, R10 + XORQ R10, AX + MOVQ AX, 120(SP) + XORQ AX, SI + XORQ DX, R13 + ROLQ $0x0f, R13 + MOVQ R12, AX + ORQ R13, AX + XORQ R11, AX + MOVQ AX, 128(SP) + XORQ AX, BP + XORQ R8, R14 + ROLQ $0x38, R14 + NOTQ R13 + MOVQ R13, AX + ORQ R14, AX + XORQ R12, AX + MOVQ AX, 136(SP) + ORQ R10, R11 + XORQ R14, R11 + MOVQ R11, 152(SP) + ANDQ R10, R14 + XORQ R13, R14 + MOVQ R14, 144(SP) + XORQ R11, R15 + + // Result s + MOVQ 16(DI), R10 + MOVQ 64(DI), R11 + MOVQ 112(DI), R12 + XORQ DX, R10 + MOVQ 120(DI), R13 + ROLQ $0x3e, R10 + XORQ R8, R11 + MOVQ 168(DI), R14 + ROLQ $0x37, R11 + XORQ R9, R12 + MOVQ R10, R9 + XORQ CX, R14 + ROLQ $0x02, R14 + ANDQ R11, R9 + XORQ R14, R9 + MOVQ R9, 192(SP) + ROLQ $0x27, R12 + XORQ R9, R15 + NOTQ R11 + XORQ BX, R13 + MOVQ R11, BX + ANDQ R12, BX + XORQ R10, BX + MOVQ BX, 160(SP) + XORQ BX, SI + ROLQ $0x29, R13 + MOVQ R12, CX + ORQ R13, CX + XORQ R11, CX + MOVQ CX, 168(SP) + XORQ CX, BP + MOVQ R13, DX + MOVQ R14, R8 + ANDQ R14, DX + ORQ R10, R8 + XORQ R12, DX + XORQ R13, R8 + MOVQ DX, 176(SP) + MOVQ R8, 184(SP) + + // Prepare round + MOVQ BP, BX + ROLQ $0x01, BX + MOVQ 16(SP), R12 + XORQ 56(SP), DX + XORQ R15, BX + XORQ 96(SP), R12 + XORQ 136(SP), DX + XORQ DX, R12 + MOVQ R12, CX + ROLQ $0x01, CX + MOVQ 24(SP), R13 + XORQ 64(SP), R8 + XORQ SI, CX + XORQ 104(SP), R13 + XORQ 144(SP), R8 + XORQ R8, R13 + MOVQ R13, DX + ROLQ $0x01, DX + MOVQ R15, R8 + XORQ BP, DX + ROLQ $0x01, R8 + MOVQ SI, R9 + XORQ R12, R8 + ROLQ $0x01, R9 + + // Result b + MOVQ (SP), R10 + MOVQ 48(SP), R11 + XORQ R13, R9 + MOVQ 96(SP), R12 + MOVQ 144(SP), R13 + MOVQ 192(SP), R14 + XORQ CX, R11 + ROLQ $0x2c, R11 + XORQ DX, R12 + XORQ BX, R10 + ROLQ $0x2b, R12 + MOVQ R11, SI + MOVQ $0x8000000000008003, AX + ORQ R12, SI + XORQ R10, AX + XORQ AX, SI + MOVQ SI, (DI) + XORQ R9, R14 + ROLQ $0x0e, R14 + MOVQ R10, R15 + ANDQ R11, R15 + XORQ R14, R15 + MOVQ R15, 32(DI) + XORQ R8, R13 + ROLQ $0x15, R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 16(DI) + NOTQ R12 + ORQ R10, R14 + ORQ R13, R12 + XORQ R13, R14 + XORQ R11, R12 + MOVQ R14, 24(DI) + MOVQ R12, 8(DI) + MOVQ R12, BP + + // Result g + MOVQ 72(SP), R11 + XORQ R9, R11 + MOVQ 80(SP), R12 + ROLQ $0x14, R11 + XORQ BX, R12 + ROLQ $0x03, R12 + MOVQ 24(SP), R10 + MOVQ R11, AX + ORQ R12, AX + XORQ R8, R10 + MOVQ 128(SP), R13 + MOVQ 176(SP), R14 + ROLQ $0x1c, R10 + XORQ R10, AX + MOVQ AX, 40(DI) + XORQ AX, SI + XORQ CX, R13 + ROLQ $0x2d, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 48(DI) + XORQ AX, BP + XORQ DX, R14 + ROLQ $0x3d, R14 + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 64(DI) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 72(DI) + NOTQ R14 + XORQ R10, R15 + ORQ R14, R13 + XORQ R12, R13 + MOVQ R13, 56(DI) + + // Result k + MOVQ 8(SP), R10 + MOVQ 56(SP), R11 + MOVQ 104(SP), R12 + MOVQ 152(SP), R13 + MOVQ 160(SP), R14 + XORQ DX, R11 + ROLQ $0x06, R11 + XORQ R8, R12 + ROLQ $0x19, R12 + MOVQ R11, AX + ORQ R12, AX + XORQ CX, R10 + ROLQ $0x01, R10 + XORQ R10, AX + MOVQ AX, 80(DI) + XORQ AX, SI + XORQ R9, R13 + ROLQ $0x08, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 88(DI) + XORQ AX, BP + XORQ BX, R14 + ROLQ $0x12, R14 + NOTQ R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 96(DI) + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 104(DI) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 112(DI) + XORQ R10, R15 + + // Result m + MOVQ 40(SP), R11 + XORQ BX, R11 + MOVQ 88(SP), R12 + ROLQ $0x24, R11 + XORQ CX, R12 + MOVQ 32(SP), R10 + ROLQ $0x0a, R12 + MOVQ R11, AX + MOVQ 136(SP), R13 + ANDQ R12, AX + XORQ R9, R10 + MOVQ 184(SP), R14 + ROLQ $0x1b, R10 + XORQ R10, AX + MOVQ AX, 120(DI) + XORQ AX, SI + XORQ DX, R13 + ROLQ $0x0f, R13 + MOVQ R12, AX + ORQ R13, AX + XORQ R11, AX + MOVQ AX, 128(DI) + XORQ AX, BP + XORQ R8, R14 + ROLQ $0x38, R14 + NOTQ R13 + MOVQ R13, AX + ORQ R14, AX + XORQ R12, AX + MOVQ AX, 136(DI) + ORQ R10, R11 + XORQ R14, R11 + MOVQ R11, 152(DI) + ANDQ R10, R14 + XORQ R13, R14 + MOVQ R14, 144(DI) + XORQ R11, R15 + + // Result s + MOVQ 16(SP), R10 + MOVQ 64(SP), R11 + MOVQ 112(SP), R12 + XORQ DX, R10 + MOVQ 120(SP), R13 + ROLQ $0x3e, R10 + XORQ R8, R11 + MOVQ 168(SP), R14 + ROLQ $0x37, R11 + XORQ R9, R12 + MOVQ R10, R9 + XORQ CX, R14 + ROLQ $0x02, R14 + ANDQ R11, R9 + XORQ R14, R9 + MOVQ R9, 192(DI) + ROLQ $0x27, R12 + XORQ R9, R15 + NOTQ R11 + XORQ BX, R13 + MOVQ R11, BX + ANDQ R12, BX + XORQ R10, BX + MOVQ BX, 160(DI) + XORQ BX, SI + ROLQ $0x29, R13 + MOVQ R12, CX + ORQ R13, CX + XORQ R11, CX + MOVQ CX, 168(DI) + XORQ CX, BP + MOVQ R13, DX + MOVQ R14, R8 + ANDQ R14, DX + ORQ R10, R8 + XORQ R12, DX + XORQ R13, R8 + MOVQ DX, 176(DI) + MOVQ R8, 184(DI) + + // Prepare round + MOVQ BP, BX + ROLQ $0x01, BX + MOVQ 16(DI), R12 + XORQ 56(DI), DX + XORQ R15, BX + XORQ 96(DI), R12 + XORQ 136(DI), DX + XORQ DX, R12 + MOVQ R12, CX + ROLQ $0x01, CX + MOVQ 24(DI), R13 + XORQ 64(DI), R8 + XORQ SI, CX + XORQ 104(DI), R13 + XORQ 144(DI), R8 + XORQ R8, R13 + MOVQ R13, DX + ROLQ $0x01, DX + MOVQ R15, R8 + XORQ BP, DX + ROLQ $0x01, R8 + MOVQ SI, R9 + XORQ R12, R8 + ROLQ $0x01, R9 + + // Result b + MOVQ (DI), R10 + MOVQ 48(DI), R11 + XORQ R13, R9 + MOVQ 96(DI), R12 + MOVQ 144(DI), R13 + MOVQ 192(DI), R14 + XORQ CX, R11 + ROLQ $0x2c, R11 + XORQ DX, R12 + XORQ BX, R10 + ROLQ $0x2b, R12 + MOVQ R11, SI + MOVQ $0x8000000000008002, AX + ORQ R12, SI + XORQ R10, AX + XORQ AX, SI + MOVQ SI, (SP) + XORQ R9, R14 + ROLQ $0x0e, R14 + MOVQ R10, R15 + ANDQ R11, R15 + XORQ R14, R15 + MOVQ R15, 32(SP) + XORQ R8, R13 + ROLQ $0x15, R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 16(SP) + NOTQ R12 + ORQ R10, R14 + ORQ R13, R12 + XORQ R13, R14 + XORQ R11, R12 + MOVQ R14, 24(SP) + MOVQ R12, 8(SP) + MOVQ R12, BP + + // Result g + MOVQ 72(DI), R11 + XORQ R9, R11 + MOVQ 80(DI), R12 + ROLQ $0x14, R11 + XORQ BX, R12 + ROLQ $0x03, R12 + MOVQ 24(DI), R10 + MOVQ R11, AX + ORQ R12, AX + XORQ R8, R10 + MOVQ 128(DI), R13 + MOVQ 176(DI), R14 + ROLQ $0x1c, R10 + XORQ R10, AX + MOVQ AX, 40(SP) + XORQ AX, SI + XORQ CX, R13 + ROLQ $0x2d, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 48(SP) + XORQ AX, BP + XORQ DX, R14 + ROLQ $0x3d, R14 + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 64(SP) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 72(SP) + NOTQ R14 + XORQ R10, R15 + ORQ R14, R13 + XORQ R12, R13 + MOVQ R13, 56(SP) + + // Result k + MOVQ 8(DI), R10 + MOVQ 56(DI), R11 + MOVQ 104(DI), R12 + MOVQ 152(DI), R13 + MOVQ 160(DI), R14 + XORQ DX, R11 + ROLQ $0x06, R11 + XORQ R8, R12 + ROLQ $0x19, R12 + MOVQ R11, AX + ORQ R12, AX + XORQ CX, R10 + ROLQ $0x01, R10 + XORQ R10, AX + MOVQ AX, 80(SP) + XORQ AX, SI + XORQ R9, R13 + ROLQ $0x08, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 88(SP) + XORQ AX, BP + XORQ BX, R14 + ROLQ $0x12, R14 + NOTQ R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 96(SP) + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 104(SP) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 112(SP) + XORQ R10, R15 + + // Result m + MOVQ 40(DI), R11 + XORQ BX, R11 + MOVQ 88(DI), R12 + ROLQ $0x24, R11 + XORQ CX, R12 + MOVQ 32(DI), R10 + ROLQ $0x0a, R12 + MOVQ R11, AX + MOVQ 136(DI), R13 + ANDQ R12, AX + XORQ R9, R10 + MOVQ 184(DI), R14 + ROLQ $0x1b, R10 + XORQ R10, AX + MOVQ AX, 120(SP) + XORQ AX, SI + XORQ DX, R13 + ROLQ $0x0f, R13 + MOVQ R12, AX + ORQ R13, AX + XORQ R11, AX + MOVQ AX, 128(SP) + XORQ AX, BP + XORQ R8, R14 + ROLQ $0x38, R14 + NOTQ R13 + MOVQ R13, AX + ORQ R14, AX + XORQ R12, AX + MOVQ AX, 136(SP) + ORQ R10, R11 + XORQ R14, R11 + MOVQ R11, 152(SP) + ANDQ R10, R14 + XORQ R13, R14 + MOVQ R14, 144(SP) + XORQ R11, R15 + + // Result s + MOVQ 16(DI), R10 + MOVQ 64(DI), R11 + MOVQ 112(DI), R12 + XORQ DX, R10 + MOVQ 120(DI), R13 + ROLQ $0x3e, R10 + XORQ R8, R11 + MOVQ 168(DI), R14 + ROLQ $0x37, R11 + XORQ R9, R12 + MOVQ R10, R9 + XORQ CX, R14 + ROLQ $0x02, R14 + ANDQ R11, R9 + XORQ R14, R9 + MOVQ R9, 192(SP) + ROLQ $0x27, R12 + XORQ R9, R15 + NOTQ R11 + XORQ BX, R13 + MOVQ R11, BX + ANDQ R12, BX + XORQ R10, BX + MOVQ BX, 160(SP) + XORQ BX, SI + ROLQ $0x29, R13 + MOVQ R12, CX + ORQ R13, CX + XORQ R11, CX + MOVQ CX, 168(SP) + XORQ CX, BP + MOVQ R13, DX + MOVQ R14, R8 + ANDQ R14, DX + ORQ R10, R8 + XORQ R12, DX + XORQ R13, R8 + MOVQ DX, 176(SP) + MOVQ R8, 184(SP) + + // Prepare round + MOVQ BP, BX + ROLQ $0x01, BX + MOVQ 16(SP), R12 + XORQ 56(SP), DX + XORQ R15, BX + XORQ 96(SP), R12 + XORQ 136(SP), DX + XORQ DX, R12 + MOVQ R12, CX + ROLQ $0x01, CX + MOVQ 24(SP), R13 + XORQ 64(SP), R8 + XORQ SI, CX + XORQ 104(SP), R13 + XORQ 144(SP), R8 + XORQ R8, R13 + MOVQ R13, DX + ROLQ $0x01, DX + MOVQ R15, R8 + XORQ BP, DX + ROLQ $0x01, R8 + MOVQ SI, R9 + XORQ R12, R8 + ROLQ $0x01, R9 + + // Result b + MOVQ (SP), R10 + MOVQ 48(SP), R11 + XORQ R13, R9 + MOVQ 96(SP), R12 + MOVQ 144(SP), R13 + MOVQ 192(SP), R14 + XORQ CX, R11 + ROLQ $0x2c, R11 + XORQ DX, R12 + XORQ BX, R10 + ROLQ $0x2b, R12 + MOVQ R11, SI + MOVQ $0x8000000000000080, AX + ORQ R12, SI + XORQ R10, AX + XORQ AX, SI + MOVQ SI, (DI) + XORQ R9, R14 + ROLQ $0x0e, R14 + MOVQ R10, R15 + ANDQ R11, R15 + XORQ R14, R15 + MOVQ R15, 32(DI) + XORQ R8, R13 + ROLQ $0x15, R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 16(DI) + NOTQ R12 + ORQ R10, R14 + ORQ R13, R12 + XORQ R13, R14 + XORQ R11, R12 + MOVQ R14, 24(DI) + MOVQ R12, 8(DI) + MOVQ R12, BP + + // Result g + MOVQ 72(SP), R11 + XORQ R9, R11 + MOVQ 80(SP), R12 + ROLQ $0x14, R11 + XORQ BX, R12 + ROLQ $0x03, R12 + MOVQ 24(SP), R10 + MOVQ R11, AX + ORQ R12, AX + XORQ R8, R10 + MOVQ 128(SP), R13 + MOVQ 176(SP), R14 + ROLQ $0x1c, R10 + XORQ R10, AX + MOVQ AX, 40(DI) + XORQ AX, SI + XORQ CX, R13 + ROLQ $0x2d, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 48(DI) + XORQ AX, BP + XORQ DX, R14 + ROLQ $0x3d, R14 + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 64(DI) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 72(DI) + NOTQ R14 + XORQ R10, R15 + ORQ R14, R13 + XORQ R12, R13 + MOVQ R13, 56(DI) + + // Result k + MOVQ 8(SP), R10 + MOVQ 56(SP), R11 + MOVQ 104(SP), R12 + MOVQ 152(SP), R13 + MOVQ 160(SP), R14 + XORQ DX, R11 + ROLQ $0x06, R11 + XORQ R8, R12 + ROLQ $0x19, R12 + MOVQ R11, AX + ORQ R12, AX + XORQ CX, R10 + ROLQ $0x01, R10 + XORQ R10, AX + MOVQ AX, 80(DI) + XORQ AX, SI + XORQ R9, R13 + ROLQ $0x08, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 88(DI) + XORQ AX, BP + XORQ BX, R14 + ROLQ $0x12, R14 + NOTQ R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 96(DI) + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 104(DI) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 112(DI) + XORQ R10, R15 + + // Result m + MOVQ 40(SP), R11 + XORQ BX, R11 + MOVQ 88(SP), R12 + ROLQ $0x24, R11 + XORQ CX, R12 + MOVQ 32(SP), R10 + ROLQ $0x0a, R12 + MOVQ R11, AX + MOVQ 136(SP), R13 + ANDQ R12, AX + XORQ R9, R10 + MOVQ 184(SP), R14 + ROLQ $0x1b, R10 + XORQ R10, AX + MOVQ AX, 120(DI) + XORQ AX, SI + XORQ DX, R13 + ROLQ $0x0f, R13 + MOVQ R12, AX + ORQ R13, AX + XORQ R11, AX + MOVQ AX, 128(DI) + XORQ AX, BP + XORQ R8, R14 + ROLQ $0x38, R14 + NOTQ R13 + MOVQ R13, AX + ORQ R14, AX + XORQ R12, AX + MOVQ AX, 136(DI) + ORQ R10, R11 + XORQ R14, R11 + MOVQ R11, 152(DI) + ANDQ R10, R14 + XORQ R13, R14 + MOVQ R14, 144(DI) + XORQ R11, R15 + + // Result s + MOVQ 16(SP), R10 + MOVQ 64(SP), R11 + MOVQ 112(SP), R12 + XORQ DX, R10 + MOVQ 120(SP), R13 + ROLQ $0x3e, R10 + XORQ R8, R11 + MOVQ 168(SP), R14 + ROLQ $0x37, R11 + XORQ R9, R12 + MOVQ R10, R9 + XORQ CX, R14 + ROLQ $0x02, R14 + ANDQ R11, R9 + XORQ R14, R9 + MOVQ R9, 192(DI) + ROLQ $0x27, R12 + XORQ R9, R15 + NOTQ R11 + XORQ BX, R13 + MOVQ R11, BX + ANDQ R12, BX + XORQ R10, BX + MOVQ BX, 160(DI) + XORQ BX, SI + ROLQ $0x29, R13 + MOVQ R12, CX + ORQ R13, CX + XORQ R11, CX + MOVQ CX, 168(DI) + XORQ CX, BP + MOVQ R13, DX + MOVQ R14, R8 + ANDQ R14, DX + ORQ R10, R8 + XORQ R12, DX + XORQ R13, R8 + MOVQ DX, 176(DI) + MOVQ R8, 184(DI) + + // Prepare round + MOVQ BP, BX + ROLQ $0x01, BX + MOVQ 16(DI), R12 + XORQ 56(DI), DX + XORQ R15, BX + XORQ 96(DI), R12 + XORQ 136(DI), DX + XORQ DX, R12 + MOVQ R12, CX + ROLQ $0x01, CX + MOVQ 24(DI), R13 + XORQ 64(DI), R8 + XORQ SI, CX + XORQ 104(DI), R13 + XORQ 144(DI), R8 + XORQ R8, R13 + MOVQ R13, DX + ROLQ $0x01, DX + MOVQ R15, R8 + XORQ BP, DX + ROLQ $0x01, R8 + MOVQ SI, R9 + XORQ R12, R8 + ROLQ $0x01, R9 + + // Result b + MOVQ (DI), R10 + MOVQ 48(DI), R11 + XORQ R13, R9 + MOVQ 96(DI), R12 + MOVQ 144(DI), R13 + MOVQ 192(DI), R14 + XORQ CX, R11 + ROLQ $0x2c, R11 + XORQ DX, R12 + XORQ BX, R10 + ROLQ $0x2b, R12 + MOVQ R11, SI + MOVQ $0x000000000000800a, AX + ORQ R12, SI + XORQ R10, AX + XORQ AX, SI + MOVQ SI, (SP) + XORQ R9, R14 + ROLQ $0x0e, R14 + MOVQ R10, R15 + ANDQ R11, R15 + XORQ R14, R15 + MOVQ R15, 32(SP) + XORQ R8, R13 + ROLQ $0x15, R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 16(SP) + NOTQ R12 + ORQ R10, R14 + ORQ R13, R12 + XORQ R13, R14 + XORQ R11, R12 + MOVQ R14, 24(SP) + MOVQ R12, 8(SP) + MOVQ R12, BP + + // Result g + MOVQ 72(DI), R11 + XORQ R9, R11 + MOVQ 80(DI), R12 + ROLQ $0x14, R11 + XORQ BX, R12 + ROLQ $0x03, R12 + MOVQ 24(DI), R10 + MOVQ R11, AX + ORQ R12, AX + XORQ R8, R10 + MOVQ 128(DI), R13 + MOVQ 176(DI), R14 + ROLQ $0x1c, R10 + XORQ R10, AX + MOVQ AX, 40(SP) + XORQ AX, SI + XORQ CX, R13 + ROLQ $0x2d, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 48(SP) + XORQ AX, BP + XORQ DX, R14 + ROLQ $0x3d, R14 + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 64(SP) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 72(SP) + NOTQ R14 + XORQ R10, R15 + ORQ R14, R13 + XORQ R12, R13 + MOVQ R13, 56(SP) + + // Result k + MOVQ 8(DI), R10 + MOVQ 56(DI), R11 + MOVQ 104(DI), R12 + MOVQ 152(DI), R13 + MOVQ 160(DI), R14 + XORQ DX, R11 + ROLQ $0x06, R11 + XORQ R8, R12 + ROLQ $0x19, R12 + MOVQ R11, AX + ORQ R12, AX + XORQ CX, R10 + ROLQ $0x01, R10 + XORQ R10, AX + MOVQ AX, 80(SP) + XORQ AX, SI + XORQ R9, R13 + ROLQ $0x08, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 88(SP) + XORQ AX, BP + XORQ BX, R14 + ROLQ $0x12, R14 + NOTQ R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 96(SP) + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 104(SP) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 112(SP) + XORQ R10, R15 + + // Result m + MOVQ 40(DI), R11 + XORQ BX, R11 + MOVQ 88(DI), R12 + ROLQ $0x24, R11 + XORQ CX, R12 + MOVQ 32(DI), R10 + ROLQ $0x0a, R12 + MOVQ R11, AX + MOVQ 136(DI), R13 + ANDQ R12, AX + XORQ R9, R10 + MOVQ 184(DI), R14 + ROLQ $0x1b, R10 + XORQ R10, AX + MOVQ AX, 120(SP) + XORQ AX, SI + XORQ DX, R13 + ROLQ $0x0f, R13 + MOVQ R12, AX + ORQ R13, AX + XORQ R11, AX + MOVQ AX, 128(SP) + XORQ AX, BP + XORQ R8, R14 + ROLQ $0x38, R14 + NOTQ R13 + MOVQ R13, AX + ORQ R14, AX + XORQ R12, AX + MOVQ AX, 136(SP) + ORQ R10, R11 + XORQ R14, R11 + MOVQ R11, 152(SP) + ANDQ R10, R14 + XORQ R13, R14 + MOVQ R14, 144(SP) + XORQ R11, R15 + + // Result s + MOVQ 16(DI), R10 + MOVQ 64(DI), R11 + MOVQ 112(DI), R12 + XORQ DX, R10 + MOVQ 120(DI), R13 + ROLQ $0x3e, R10 + XORQ R8, R11 + MOVQ 168(DI), R14 + ROLQ $0x37, R11 + XORQ R9, R12 + MOVQ R10, R9 + XORQ CX, R14 + ROLQ $0x02, R14 + ANDQ R11, R9 + XORQ R14, R9 + MOVQ R9, 192(SP) + ROLQ $0x27, R12 + XORQ R9, R15 + NOTQ R11 + XORQ BX, R13 + MOVQ R11, BX + ANDQ R12, BX + XORQ R10, BX + MOVQ BX, 160(SP) + XORQ BX, SI + ROLQ $0x29, R13 + MOVQ R12, CX + ORQ R13, CX + XORQ R11, CX + MOVQ CX, 168(SP) + XORQ CX, BP + MOVQ R13, DX + MOVQ R14, R8 + ANDQ R14, DX + ORQ R10, R8 + XORQ R12, DX + XORQ R13, R8 + MOVQ DX, 176(SP) + MOVQ R8, 184(SP) + + // Prepare round + MOVQ BP, BX + ROLQ $0x01, BX + MOVQ 16(SP), R12 + XORQ 56(SP), DX + XORQ R15, BX + XORQ 96(SP), R12 + XORQ 136(SP), DX + XORQ DX, R12 + MOVQ R12, CX + ROLQ $0x01, CX + MOVQ 24(SP), R13 + XORQ 64(SP), R8 + XORQ SI, CX + XORQ 104(SP), R13 + XORQ 144(SP), R8 + XORQ R8, R13 + MOVQ R13, DX + ROLQ $0x01, DX + MOVQ R15, R8 + XORQ BP, DX + ROLQ $0x01, R8 + MOVQ SI, R9 + XORQ R12, R8 + ROLQ $0x01, R9 + + // Result b + MOVQ (SP), R10 + MOVQ 48(SP), R11 + XORQ R13, R9 + MOVQ 96(SP), R12 + MOVQ 144(SP), R13 + MOVQ 192(SP), R14 + XORQ CX, R11 + ROLQ $0x2c, R11 + XORQ DX, R12 + XORQ BX, R10 + ROLQ $0x2b, R12 + MOVQ R11, SI + MOVQ $0x800000008000000a, AX + ORQ R12, SI + XORQ R10, AX + XORQ AX, SI + MOVQ SI, (DI) + XORQ R9, R14 + ROLQ $0x0e, R14 + MOVQ R10, R15 + ANDQ R11, R15 + XORQ R14, R15 + MOVQ R15, 32(DI) + XORQ R8, R13 + ROLQ $0x15, R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 16(DI) + NOTQ R12 + ORQ R10, R14 + ORQ R13, R12 + XORQ R13, R14 + XORQ R11, R12 + MOVQ R14, 24(DI) + MOVQ R12, 8(DI) + MOVQ R12, BP + + // Result g + MOVQ 72(SP), R11 + XORQ R9, R11 + MOVQ 80(SP), R12 + ROLQ $0x14, R11 + XORQ BX, R12 + ROLQ $0x03, R12 + MOVQ 24(SP), R10 + MOVQ R11, AX + ORQ R12, AX + XORQ R8, R10 + MOVQ 128(SP), R13 + MOVQ 176(SP), R14 + ROLQ $0x1c, R10 + XORQ R10, AX + MOVQ AX, 40(DI) + XORQ AX, SI + XORQ CX, R13 + ROLQ $0x2d, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 48(DI) + XORQ AX, BP + XORQ DX, R14 + ROLQ $0x3d, R14 + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 64(DI) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 72(DI) + NOTQ R14 + XORQ R10, R15 + ORQ R14, R13 + XORQ R12, R13 + MOVQ R13, 56(DI) + + // Result k + MOVQ 8(SP), R10 + MOVQ 56(SP), R11 + MOVQ 104(SP), R12 + MOVQ 152(SP), R13 + MOVQ 160(SP), R14 + XORQ DX, R11 + ROLQ $0x06, R11 + XORQ R8, R12 + ROLQ $0x19, R12 + MOVQ R11, AX + ORQ R12, AX + XORQ CX, R10 + ROLQ $0x01, R10 + XORQ R10, AX + MOVQ AX, 80(DI) + XORQ AX, SI + XORQ R9, R13 + ROLQ $0x08, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 88(DI) + XORQ AX, BP + XORQ BX, R14 + ROLQ $0x12, R14 + NOTQ R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 96(DI) + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 104(DI) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 112(DI) + XORQ R10, R15 + + // Result m + MOVQ 40(SP), R11 + XORQ BX, R11 + MOVQ 88(SP), R12 + ROLQ $0x24, R11 + XORQ CX, R12 + MOVQ 32(SP), R10 + ROLQ $0x0a, R12 + MOVQ R11, AX + MOVQ 136(SP), R13 + ANDQ R12, AX + XORQ R9, R10 + MOVQ 184(SP), R14 + ROLQ $0x1b, R10 + XORQ R10, AX + MOVQ AX, 120(DI) + XORQ AX, SI + XORQ DX, R13 + ROLQ $0x0f, R13 + MOVQ R12, AX + ORQ R13, AX + XORQ R11, AX + MOVQ AX, 128(DI) + XORQ AX, BP + XORQ R8, R14 + ROLQ $0x38, R14 + NOTQ R13 + MOVQ R13, AX + ORQ R14, AX + XORQ R12, AX + MOVQ AX, 136(DI) + ORQ R10, R11 + XORQ R14, R11 + MOVQ R11, 152(DI) + ANDQ R10, R14 + XORQ R13, R14 + MOVQ R14, 144(DI) + XORQ R11, R15 + + // Result s + MOVQ 16(SP), R10 + MOVQ 64(SP), R11 + MOVQ 112(SP), R12 + XORQ DX, R10 + MOVQ 120(SP), R13 + ROLQ $0x3e, R10 + XORQ R8, R11 + MOVQ 168(SP), R14 + ROLQ $0x37, R11 + XORQ R9, R12 + MOVQ R10, R9 + XORQ CX, R14 + ROLQ $0x02, R14 + ANDQ R11, R9 + XORQ R14, R9 + MOVQ R9, 192(DI) + ROLQ $0x27, R12 + XORQ R9, R15 + NOTQ R11 + XORQ BX, R13 + MOVQ R11, BX + ANDQ R12, BX + XORQ R10, BX + MOVQ BX, 160(DI) + XORQ BX, SI + ROLQ $0x29, R13 + MOVQ R12, CX + ORQ R13, CX + XORQ R11, CX + MOVQ CX, 168(DI) + XORQ CX, BP + MOVQ R13, DX + MOVQ R14, R8 + ANDQ R14, DX + ORQ R10, R8 + XORQ R12, DX + XORQ R13, R8 + MOVQ DX, 176(DI) + MOVQ R8, 184(DI) + + // Prepare round + MOVQ BP, BX + ROLQ $0x01, BX + MOVQ 16(DI), R12 + XORQ 56(DI), DX + XORQ R15, BX + XORQ 96(DI), R12 + XORQ 136(DI), DX + XORQ DX, R12 + MOVQ R12, CX + ROLQ $0x01, CX + MOVQ 24(DI), R13 + XORQ 64(DI), R8 + XORQ SI, CX + XORQ 104(DI), R13 + XORQ 144(DI), R8 + XORQ R8, R13 + MOVQ R13, DX + ROLQ $0x01, DX + MOVQ R15, R8 + XORQ BP, DX + ROLQ $0x01, R8 + MOVQ SI, R9 + XORQ R12, R8 + ROLQ $0x01, R9 + + // Result b + MOVQ (DI), R10 + MOVQ 48(DI), R11 + XORQ R13, R9 + MOVQ 96(DI), R12 + MOVQ 144(DI), R13 + MOVQ 192(DI), R14 + XORQ CX, R11 + ROLQ $0x2c, R11 + XORQ DX, R12 + XORQ BX, R10 + ROLQ $0x2b, R12 + MOVQ R11, SI + MOVQ $0x8000000080008081, AX + ORQ R12, SI + XORQ R10, AX + XORQ AX, SI + MOVQ SI, (SP) + XORQ R9, R14 + ROLQ $0x0e, R14 + MOVQ R10, R15 + ANDQ R11, R15 + XORQ R14, R15 + MOVQ R15, 32(SP) + XORQ R8, R13 + ROLQ $0x15, R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 16(SP) + NOTQ R12 + ORQ R10, R14 + ORQ R13, R12 + XORQ R13, R14 + XORQ R11, R12 + MOVQ R14, 24(SP) + MOVQ R12, 8(SP) + MOVQ R12, BP + + // Result g + MOVQ 72(DI), R11 + XORQ R9, R11 + MOVQ 80(DI), R12 + ROLQ $0x14, R11 + XORQ BX, R12 + ROLQ $0x03, R12 + MOVQ 24(DI), R10 + MOVQ R11, AX + ORQ R12, AX + XORQ R8, R10 + MOVQ 128(DI), R13 + MOVQ 176(DI), R14 + ROLQ $0x1c, R10 + XORQ R10, AX + MOVQ AX, 40(SP) + XORQ AX, SI + XORQ CX, R13 + ROLQ $0x2d, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 48(SP) + XORQ AX, BP + XORQ DX, R14 + ROLQ $0x3d, R14 + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 64(SP) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 72(SP) + NOTQ R14 + XORQ R10, R15 + ORQ R14, R13 + XORQ R12, R13 + MOVQ R13, 56(SP) + + // Result k + MOVQ 8(DI), R10 + MOVQ 56(DI), R11 + MOVQ 104(DI), R12 + MOVQ 152(DI), R13 + MOVQ 160(DI), R14 + XORQ DX, R11 + ROLQ $0x06, R11 + XORQ R8, R12 + ROLQ $0x19, R12 + MOVQ R11, AX + ORQ R12, AX + XORQ CX, R10 + ROLQ $0x01, R10 + XORQ R10, AX + MOVQ AX, 80(SP) + XORQ AX, SI + XORQ R9, R13 + ROLQ $0x08, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 88(SP) + XORQ AX, BP + XORQ BX, R14 + ROLQ $0x12, R14 + NOTQ R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 96(SP) + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 104(SP) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 112(SP) + XORQ R10, R15 + + // Result m + MOVQ 40(DI), R11 + XORQ BX, R11 + MOVQ 88(DI), R12 + ROLQ $0x24, R11 + XORQ CX, R12 + MOVQ 32(DI), R10 + ROLQ $0x0a, R12 + MOVQ R11, AX + MOVQ 136(DI), R13 + ANDQ R12, AX + XORQ R9, R10 + MOVQ 184(DI), R14 + ROLQ $0x1b, R10 + XORQ R10, AX + MOVQ AX, 120(SP) + XORQ AX, SI + XORQ DX, R13 + ROLQ $0x0f, R13 + MOVQ R12, AX + ORQ R13, AX + XORQ R11, AX + MOVQ AX, 128(SP) + XORQ AX, BP + XORQ R8, R14 + ROLQ $0x38, R14 + NOTQ R13 + MOVQ R13, AX + ORQ R14, AX + XORQ R12, AX + MOVQ AX, 136(SP) + ORQ R10, R11 + XORQ R14, R11 + MOVQ R11, 152(SP) + ANDQ R10, R14 + XORQ R13, R14 + MOVQ R14, 144(SP) + XORQ R11, R15 + + // Result s + MOVQ 16(DI), R10 + MOVQ 64(DI), R11 + MOVQ 112(DI), R12 + XORQ DX, R10 + MOVQ 120(DI), R13 + ROLQ $0x3e, R10 + XORQ R8, R11 + MOVQ 168(DI), R14 + ROLQ $0x37, R11 + XORQ R9, R12 + MOVQ R10, R9 + XORQ CX, R14 + ROLQ $0x02, R14 + ANDQ R11, R9 + XORQ R14, R9 + MOVQ R9, 192(SP) + ROLQ $0x27, R12 + XORQ R9, R15 + NOTQ R11 + XORQ BX, R13 + MOVQ R11, BX + ANDQ R12, BX + XORQ R10, BX + MOVQ BX, 160(SP) + XORQ BX, SI + ROLQ $0x29, R13 + MOVQ R12, CX + ORQ R13, CX + XORQ R11, CX + MOVQ CX, 168(SP) + XORQ CX, BP + MOVQ R13, DX + MOVQ R14, R8 + ANDQ R14, DX + ORQ R10, R8 + XORQ R12, DX + XORQ R13, R8 + MOVQ DX, 176(SP) + MOVQ R8, 184(SP) + + // Prepare round + MOVQ BP, BX + ROLQ $0x01, BX + MOVQ 16(SP), R12 + XORQ 56(SP), DX + XORQ R15, BX + XORQ 96(SP), R12 + XORQ 136(SP), DX + XORQ DX, R12 + MOVQ R12, CX + ROLQ $0x01, CX + MOVQ 24(SP), R13 + XORQ 64(SP), R8 + XORQ SI, CX + XORQ 104(SP), R13 + XORQ 144(SP), R8 + XORQ R8, R13 + MOVQ R13, DX + ROLQ $0x01, DX + MOVQ R15, R8 + XORQ BP, DX + ROLQ $0x01, R8 + MOVQ SI, R9 + XORQ R12, R8 + ROLQ $0x01, R9 + + // Result b + MOVQ (SP), R10 + MOVQ 48(SP), R11 + XORQ R13, R9 + MOVQ 96(SP), R12 + MOVQ 144(SP), R13 + MOVQ 192(SP), R14 + XORQ CX, R11 + ROLQ $0x2c, R11 + XORQ DX, R12 + XORQ BX, R10 + ROLQ $0x2b, R12 + MOVQ R11, SI + MOVQ $0x8000000000008080, AX + ORQ R12, SI + XORQ R10, AX + XORQ AX, SI + MOVQ SI, (DI) + XORQ R9, R14 + ROLQ $0x0e, R14 + MOVQ R10, R15 + ANDQ R11, R15 + XORQ R14, R15 + MOVQ R15, 32(DI) + XORQ R8, R13 + ROLQ $0x15, R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 16(DI) + NOTQ R12 + ORQ R10, R14 + ORQ R13, R12 + XORQ R13, R14 + XORQ R11, R12 + MOVQ R14, 24(DI) + MOVQ R12, 8(DI) + MOVQ R12, BP + + // Result g + MOVQ 72(SP), R11 + XORQ R9, R11 + MOVQ 80(SP), R12 + ROLQ $0x14, R11 + XORQ BX, R12 + ROLQ $0x03, R12 + MOVQ 24(SP), R10 + MOVQ R11, AX + ORQ R12, AX + XORQ R8, R10 + MOVQ 128(SP), R13 + MOVQ 176(SP), R14 + ROLQ $0x1c, R10 + XORQ R10, AX + MOVQ AX, 40(DI) + XORQ AX, SI + XORQ CX, R13 + ROLQ $0x2d, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 48(DI) + XORQ AX, BP + XORQ DX, R14 + ROLQ $0x3d, R14 + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 64(DI) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 72(DI) + NOTQ R14 + XORQ R10, R15 + ORQ R14, R13 + XORQ R12, R13 + MOVQ R13, 56(DI) + + // Result k + MOVQ 8(SP), R10 + MOVQ 56(SP), R11 + MOVQ 104(SP), R12 + MOVQ 152(SP), R13 + MOVQ 160(SP), R14 + XORQ DX, R11 + ROLQ $0x06, R11 + XORQ R8, R12 + ROLQ $0x19, R12 + MOVQ R11, AX + ORQ R12, AX + XORQ CX, R10 + ROLQ $0x01, R10 + XORQ R10, AX + MOVQ AX, 80(DI) + XORQ AX, SI + XORQ R9, R13 + ROLQ $0x08, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 88(DI) + XORQ AX, BP + XORQ BX, R14 + ROLQ $0x12, R14 + NOTQ R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 96(DI) + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 104(DI) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 112(DI) + XORQ R10, R15 + + // Result m + MOVQ 40(SP), R11 + XORQ BX, R11 + MOVQ 88(SP), R12 + ROLQ $0x24, R11 + XORQ CX, R12 + MOVQ 32(SP), R10 + ROLQ $0x0a, R12 + MOVQ R11, AX + MOVQ 136(SP), R13 + ANDQ R12, AX + XORQ R9, R10 + MOVQ 184(SP), R14 + ROLQ $0x1b, R10 + XORQ R10, AX + MOVQ AX, 120(DI) + XORQ AX, SI + XORQ DX, R13 + ROLQ $0x0f, R13 + MOVQ R12, AX + ORQ R13, AX + XORQ R11, AX + MOVQ AX, 128(DI) + XORQ AX, BP + XORQ R8, R14 + ROLQ $0x38, R14 + NOTQ R13 + MOVQ R13, AX + ORQ R14, AX + XORQ R12, AX + MOVQ AX, 136(DI) + ORQ R10, R11 + XORQ R14, R11 + MOVQ R11, 152(DI) + ANDQ R10, R14 + XORQ R13, R14 + MOVQ R14, 144(DI) + XORQ R11, R15 + + // Result s + MOVQ 16(SP), R10 + MOVQ 64(SP), R11 + MOVQ 112(SP), R12 + XORQ DX, R10 + MOVQ 120(SP), R13 + ROLQ $0x3e, R10 + XORQ R8, R11 + MOVQ 168(SP), R14 + ROLQ $0x37, R11 + XORQ R9, R12 + MOVQ R10, R9 + XORQ CX, R14 + ROLQ $0x02, R14 + ANDQ R11, R9 + XORQ R14, R9 + MOVQ R9, 192(DI) + ROLQ $0x27, R12 + XORQ R9, R15 + NOTQ R11 + XORQ BX, R13 + MOVQ R11, BX + ANDQ R12, BX + XORQ R10, BX + MOVQ BX, 160(DI) + XORQ BX, SI + ROLQ $0x29, R13 + MOVQ R12, CX + ORQ R13, CX + XORQ R11, CX + MOVQ CX, 168(DI) + XORQ CX, BP + MOVQ R13, DX + MOVQ R14, R8 + ANDQ R14, DX + ORQ R10, R8 + XORQ R12, DX + XORQ R13, R8 + MOVQ DX, 176(DI) + MOVQ R8, 184(DI) + + // Prepare round + MOVQ BP, BX + ROLQ $0x01, BX + MOVQ 16(DI), R12 + XORQ 56(DI), DX + XORQ R15, BX + XORQ 96(DI), R12 + XORQ 136(DI), DX + XORQ DX, R12 + MOVQ R12, CX + ROLQ $0x01, CX + MOVQ 24(DI), R13 + XORQ 64(DI), R8 + XORQ SI, CX + XORQ 104(DI), R13 + XORQ 144(DI), R8 + XORQ R8, R13 + MOVQ R13, DX + ROLQ $0x01, DX + MOVQ R15, R8 + XORQ BP, DX + ROLQ $0x01, R8 + MOVQ SI, R9 + XORQ R12, R8 + ROLQ $0x01, R9 + + // Result b + MOVQ (DI), R10 + MOVQ 48(DI), R11 + XORQ R13, R9 + MOVQ 96(DI), R12 + MOVQ 144(DI), R13 + MOVQ 192(DI), R14 + XORQ CX, R11 + ROLQ $0x2c, R11 + XORQ DX, R12 + XORQ BX, R10 + ROLQ $0x2b, R12 + MOVQ R11, SI + MOVQ $0x0000000080000001, AX + ORQ R12, SI + XORQ R10, AX + XORQ AX, SI + MOVQ SI, (SP) + XORQ R9, R14 + ROLQ $0x0e, R14 + MOVQ R10, R15 + ANDQ R11, R15 + XORQ R14, R15 + MOVQ R15, 32(SP) + XORQ R8, R13 + ROLQ $0x15, R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 16(SP) + NOTQ R12 + ORQ R10, R14 + ORQ R13, R12 + XORQ R13, R14 + XORQ R11, R12 + MOVQ R14, 24(SP) + MOVQ R12, 8(SP) + MOVQ R12, BP + + // Result g + MOVQ 72(DI), R11 + XORQ R9, R11 + MOVQ 80(DI), R12 + ROLQ $0x14, R11 + XORQ BX, R12 + ROLQ $0x03, R12 + MOVQ 24(DI), R10 + MOVQ R11, AX + ORQ R12, AX + XORQ R8, R10 + MOVQ 128(DI), R13 + MOVQ 176(DI), R14 + ROLQ $0x1c, R10 + XORQ R10, AX + MOVQ AX, 40(SP) + XORQ AX, SI + XORQ CX, R13 + ROLQ $0x2d, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 48(SP) + XORQ AX, BP + XORQ DX, R14 + ROLQ $0x3d, R14 + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 64(SP) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 72(SP) + NOTQ R14 + XORQ R10, R15 + ORQ R14, R13 + XORQ R12, R13 + MOVQ R13, 56(SP) + + // Result k + MOVQ 8(DI), R10 + MOVQ 56(DI), R11 + MOVQ 104(DI), R12 + MOVQ 152(DI), R13 + MOVQ 160(DI), R14 + XORQ DX, R11 + ROLQ $0x06, R11 + XORQ R8, R12 + ROLQ $0x19, R12 + MOVQ R11, AX + ORQ R12, AX + XORQ CX, R10 + ROLQ $0x01, R10 + XORQ R10, AX + MOVQ AX, 80(SP) + XORQ AX, SI + XORQ R9, R13 + ROLQ $0x08, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 88(SP) + XORQ AX, BP + XORQ BX, R14 + ROLQ $0x12, R14 + NOTQ R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 96(SP) + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 104(SP) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 112(SP) + XORQ R10, R15 + + // Result m + MOVQ 40(DI), R11 + XORQ BX, R11 + MOVQ 88(DI), R12 + ROLQ $0x24, R11 + XORQ CX, R12 + MOVQ 32(DI), R10 + ROLQ $0x0a, R12 + MOVQ R11, AX + MOVQ 136(DI), R13 + ANDQ R12, AX + XORQ R9, R10 + MOVQ 184(DI), R14 + ROLQ $0x1b, R10 + XORQ R10, AX + MOVQ AX, 120(SP) + XORQ AX, SI + XORQ DX, R13 + ROLQ $0x0f, R13 + MOVQ R12, AX + ORQ R13, AX + XORQ R11, AX + MOVQ AX, 128(SP) + XORQ AX, BP + XORQ R8, R14 + ROLQ $0x38, R14 + NOTQ R13 + MOVQ R13, AX + ORQ R14, AX + XORQ R12, AX + MOVQ AX, 136(SP) + ORQ R10, R11 + XORQ R14, R11 + MOVQ R11, 152(SP) + ANDQ R10, R14 + XORQ R13, R14 + MOVQ R14, 144(SP) + XORQ R11, R15 + + // Result s + MOVQ 16(DI), R10 + MOVQ 64(DI), R11 + MOVQ 112(DI), R12 + XORQ DX, R10 + MOVQ 120(DI), R13 + ROLQ $0x3e, R10 + XORQ R8, R11 + MOVQ 168(DI), R14 + ROLQ $0x37, R11 + XORQ R9, R12 + MOVQ R10, R9 + XORQ CX, R14 + ROLQ $0x02, R14 + ANDQ R11, R9 + XORQ R14, R9 + MOVQ R9, 192(SP) + ROLQ $0x27, R12 + XORQ R9, R15 + NOTQ R11 + XORQ BX, R13 + MOVQ R11, BX + ANDQ R12, BX + XORQ R10, BX + MOVQ BX, 160(SP) + XORQ BX, SI + ROLQ $0x29, R13 + MOVQ R12, CX + ORQ R13, CX + XORQ R11, CX + MOVQ CX, 168(SP) + XORQ CX, BP + MOVQ R13, DX + MOVQ R14, R8 + ANDQ R14, DX + ORQ R10, R8 + XORQ R12, DX + XORQ R13, R8 + MOVQ DX, 176(SP) + MOVQ R8, 184(SP) + + // Prepare round + MOVQ BP, BX + ROLQ $0x01, BX + MOVQ 16(SP), R12 + XORQ 56(SP), DX + XORQ R15, BX + XORQ 96(SP), R12 + XORQ 136(SP), DX + XORQ DX, R12 + MOVQ R12, CX + ROLQ $0x01, CX + MOVQ 24(SP), R13 + XORQ 64(SP), R8 + XORQ SI, CX + XORQ 104(SP), R13 + XORQ 144(SP), R8 + XORQ R8, R13 + MOVQ R13, DX + ROLQ $0x01, DX + MOVQ R15, R8 + XORQ BP, DX + ROLQ $0x01, R8 + MOVQ SI, R9 + XORQ R12, R8 + ROLQ $0x01, R9 + + // Result b + MOVQ (SP), R10 + MOVQ 48(SP), R11 + XORQ R13, R9 + MOVQ 96(SP), R12 + MOVQ 144(SP), R13 + MOVQ 192(SP), R14 + XORQ CX, R11 + ROLQ $0x2c, R11 + XORQ DX, R12 + XORQ BX, R10 + ROLQ $0x2b, R12 + MOVQ R11, SI + MOVQ $0x8000000080008008, AX + ORQ R12, SI + XORQ R10, AX + XORQ AX, SI + MOVQ SI, (DI) + XORQ R9, R14 + ROLQ $0x0e, R14 + MOVQ R10, R15 + ANDQ R11, R15 + XORQ R14, R15 + MOVQ R15, 32(DI) + XORQ R8, R13 + ROLQ $0x15, R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 16(DI) + NOTQ R12 + ORQ R10, R14 + ORQ R13, R12 + XORQ R13, R14 + XORQ R11, R12 + MOVQ R14, 24(DI) + MOVQ R12, 8(DI) + NOP + + // Result g + MOVQ 72(SP), R11 + XORQ R9, R11 + MOVQ 80(SP), R12 + ROLQ $0x14, R11 + XORQ BX, R12 + ROLQ $0x03, R12 + MOVQ 24(SP), R10 + MOVQ R11, AX + ORQ R12, AX + XORQ R8, R10 + MOVQ 128(SP), R13 + MOVQ 176(SP), R14 + ROLQ $0x1c, R10 + XORQ R10, AX + MOVQ AX, 40(DI) + NOP + XORQ CX, R13 + ROLQ $0x2d, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 48(DI) + NOP + XORQ DX, R14 + ROLQ $0x3d, R14 + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 64(DI) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 72(DI) + NOTQ R14 + NOP + ORQ R14, R13 + XORQ R12, R13 + MOVQ R13, 56(DI) + + // Result k + MOVQ 8(SP), R10 + MOVQ 56(SP), R11 + MOVQ 104(SP), R12 + MOVQ 152(SP), R13 + MOVQ 160(SP), R14 + XORQ DX, R11 + ROLQ $0x06, R11 + XORQ R8, R12 + ROLQ $0x19, R12 + MOVQ R11, AX + ORQ R12, AX + XORQ CX, R10 + ROLQ $0x01, R10 + XORQ R10, AX + MOVQ AX, 80(DI) + NOP + XORQ R9, R13 + ROLQ $0x08, R13 + MOVQ R12, AX + ANDQ R13, AX + XORQ R11, AX + MOVQ AX, 88(DI) + NOP + XORQ BX, R14 + ROLQ $0x12, R14 + NOTQ R13 + MOVQ R13, AX + ANDQ R14, AX + XORQ R12, AX + MOVQ AX, 96(DI) + MOVQ R14, AX + ORQ R10, AX + XORQ R13, AX + MOVQ AX, 104(DI) + ANDQ R11, R10 + XORQ R14, R10 + MOVQ R10, 112(DI) + NOP + + // Result m + MOVQ 40(SP), R11 + XORQ BX, R11 + MOVQ 88(SP), R12 + ROLQ $0x24, R11 + XORQ CX, R12 + MOVQ 32(SP), R10 + ROLQ $0x0a, R12 + MOVQ R11, AX + MOVQ 136(SP), R13 + ANDQ R12, AX + XORQ R9, R10 + MOVQ 184(SP), R14 + ROLQ $0x1b, R10 + XORQ R10, AX + MOVQ AX, 120(DI) + NOP + XORQ DX, R13 + ROLQ $0x0f, R13 + MOVQ R12, AX + ORQ R13, AX + XORQ R11, AX + MOVQ AX, 128(DI) + NOP + XORQ R8, R14 + ROLQ $0x38, R14 + NOTQ R13 + MOVQ R13, AX + ORQ R14, AX + XORQ R12, AX + MOVQ AX, 136(DI) + ORQ R10, R11 + XORQ R14, R11 + MOVQ R11, 152(DI) + ANDQ R10, R14 + XORQ R13, R14 + MOVQ R14, 144(DI) + NOP + + // Result s + MOVQ 16(SP), R10 + MOVQ 64(SP), R11 + MOVQ 112(SP), R12 + XORQ DX, R10 + MOVQ 120(SP), R13 + ROLQ $0x3e, R10 + XORQ R8, R11 + MOVQ 168(SP), R14 + ROLQ $0x37, R11 + XORQ R9, R12 + MOVQ R10, R9 + XORQ CX, R14 + ROLQ $0x02, R14 + ANDQ R11, R9 + XORQ R14, R9 + MOVQ R9, 192(DI) + ROLQ $0x27, R12 + NOP + NOTQ R11 + XORQ BX, R13 + MOVQ R11, BX + ANDQ R12, BX + XORQ R10, BX + MOVQ BX, 160(DI) + NOP + ROLQ $0x29, R13 + MOVQ R12, CX + ORQ R13, CX + XORQ R11, CX + MOVQ CX, 168(DI) + NOP + MOVQ R13, DX + MOVQ R14, R8 + ANDQ R14, DX + ORQ R10, R8 + XORQ R12, DX + XORQ R13, R8 + MOVQ DX, 176(DI) + MOVQ R8, 184(DI) + + // Revert the internal state to the user state + NOTQ 8(DI) + NOTQ 16(DI) + NOTQ 64(DI) + NOTQ 96(DI) + NOTQ 136(DI) + NOTQ 160(DI) + RET diff --git a/vendor/golang.org/x/crypto/sha3/sha3.go b/vendor/golang.org/x/crypto/sha3/sha3.go new file mode 100644 index 00000000..6658c444 --- /dev/null +++ b/vendor/golang.org/x/crypto/sha3/sha3.go @@ -0,0 +1,244 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package sha3 + +import ( + "crypto/subtle" + "encoding/binary" + "errors" + "unsafe" + + "golang.org/x/sys/cpu" +) + +// spongeDirection indicates the direction bytes are flowing through the sponge. +type spongeDirection int + +const ( + // spongeAbsorbing indicates that the sponge is absorbing input. + spongeAbsorbing spongeDirection = iota + // spongeSqueezing indicates that the sponge is being squeezed. + spongeSqueezing +) + +type state struct { + a [1600 / 8]byte // main state of the hash + + // a[n:rate] is the buffer. If absorbing, it's the remaining space to XOR + // into before running the permutation. If squeezing, it's the remaining + // output to produce before running the permutation. + n, rate int + + // dsbyte contains the "domain separation" bits and the first bit of + // the padding. Sections 6.1 and 6.2 of [1] separate the outputs of the + // SHA-3 and SHAKE functions by appending bitstrings to the message. + // Using a little-endian bit-ordering convention, these are "01" for SHA-3 + // and "1111" for SHAKE, or 00000010b and 00001111b, respectively. Then the + // padding rule from section 5.1 is applied to pad the message to a multiple + // of the rate, which involves adding a "1" bit, zero or more "0" bits, and + // a final "1" bit. We merge the first "1" bit from the padding into dsbyte, + // giving 00000110b (0x06) and 00011111b (0x1f). + // [1] http://csrc.nist.gov/publications/drafts/fips-202/fips_202_draft.pdf + // "Draft FIPS 202: SHA-3 Standard: Permutation-Based Hash and + // Extendable-Output Functions (May 2014)" + dsbyte byte + + outputLen int // the default output size in bytes + state spongeDirection // whether the sponge is absorbing or squeezing +} + +// BlockSize returns the rate of sponge underlying this hash function. +func (d *state) BlockSize() int { return d.rate } + +// Size returns the output size of the hash function in bytes. +func (d *state) Size() int { return d.outputLen } + +// Reset clears the internal state by zeroing the sponge state and +// the buffer indexes, and setting Sponge.state to absorbing. +func (d *state) Reset() { + // Zero the permutation's state. + for i := range d.a { + d.a[i] = 0 + } + d.state = spongeAbsorbing + d.n = 0 +} + +func (d *state) clone() *state { + ret := *d + return &ret +} + +// permute applies the KeccakF-1600 permutation. +func (d *state) permute() { + var a *[25]uint64 + if cpu.IsBigEndian { + a = new([25]uint64) + for i := range a { + a[i] = binary.LittleEndian.Uint64(d.a[i*8:]) + } + } else { + a = (*[25]uint64)(unsafe.Pointer(&d.a)) + } + + keccakF1600(a) + d.n = 0 + + if cpu.IsBigEndian { + for i := range a { + binary.LittleEndian.PutUint64(d.a[i*8:], a[i]) + } + } +} + +// pads appends the domain separation bits in dsbyte, applies +// the multi-bitrate 10..1 padding rule, and permutes the state. +func (d *state) padAndPermute() { + // Pad with this instance's domain-separator bits. We know that there's + // at least one byte of space in the sponge because, if it were full, + // permute would have been called to empty it. dsbyte also contains the + // first one bit for the padding. See the comment in the state struct. + d.a[d.n] ^= d.dsbyte + // This adds the final one bit for the padding. Because of the way that + // bits are numbered from the LSB upwards, the final bit is the MSB of + // the last byte. + d.a[d.rate-1] ^= 0x80 + // Apply the permutation + d.permute() + d.state = spongeSqueezing +} + +// Write absorbs more data into the hash's state. It panics if any +// output has already been read. +func (d *state) Write(p []byte) (n int, err error) { + if d.state != spongeAbsorbing { + panic("sha3: Write after Read") + } + + n = len(p) + + for len(p) > 0 { + x := subtle.XORBytes(d.a[d.n:d.rate], d.a[d.n:d.rate], p) + d.n += x + p = p[x:] + + // If the sponge is full, apply the permutation. + if d.n == d.rate { + d.permute() + } + } + + return +} + +// Read squeezes an arbitrary number of bytes from the sponge. +func (d *state) Read(out []byte) (n int, err error) { + // If we're still absorbing, pad and apply the permutation. + if d.state == spongeAbsorbing { + d.padAndPermute() + } + + n = len(out) + + // Now, do the squeezing. + for len(out) > 0 { + // Apply the permutation if we've squeezed the sponge dry. + if d.n == d.rate { + d.permute() + } + + x := copy(out, d.a[d.n:d.rate]) + d.n += x + out = out[x:] + } + + return +} + +// Sum applies padding to the hash state and then squeezes out the desired +// number of output bytes. It panics if any output has already been read. +func (d *state) Sum(in []byte) []byte { + if d.state != spongeAbsorbing { + panic("sha3: Sum after Read") + } + + // Make a copy of the original hash so that caller can keep writing + // and summing. + dup := d.clone() + hash := make([]byte, dup.outputLen, 64) // explicit cap to allow stack allocation + dup.Read(hash) + return append(in, hash...) +} + +const ( + magicSHA3 = "sha\x08" + magicShake = "sha\x09" + magicCShake = "sha\x0a" + magicKeccak = "sha\x0b" + // magic || rate || main state || n || sponge direction + marshaledSize = len(magicSHA3) + 1 + 200 + 1 + 1 +) + +func (d *state) MarshalBinary() ([]byte, error) { + return d.AppendBinary(make([]byte, 0, marshaledSize)) +} + +func (d *state) AppendBinary(b []byte) ([]byte, error) { + switch d.dsbyte { + case dsbyteSHA3: + b = append(b, magicSHA3...) + case dsbyteShake: + b = append(b, magicShake...) + case dsbyteCShake: + b = append(b, magicCShake...) + case dsbyteKeccak: + b = append(b, magicKeccak...) + default: + panic("unknown dsbyte") + } + // rate is at most 168, and n is at most rate. + b = append(b, byte(d.rate)) + b = append(b, d.a[:]...) + b = append(b, byte(d.n), byte(d.state)) + return b, nil +} + +func (d *state) UnmarshalBinary(b []byte) error { + if len(b) != marshaledSize { + return errors.New("sha3: invalid hash state") + } + + magic := string(b[:len(magicSHA3)]) + b = b[len(magicSHA3):] + switch { + case magic == magicSHA3 && d.dsbyte == dsbyteSHA3: + case magic == magicShake && d.dsbyte == dsbyteShake: + case magic == magicCShake && d.dsbyte == dsbyteCShake: + case magic == magicKeccak && d.dsbyte == dsbyteKeccak: + default: + return errors.New("sha3: invalid hash state identifier") + } + + rate := int(b[0]) + b = b[1:] + if rate != d.rate { + return errors.New("sha3: invalid hash state function") + } + + copy(d.a[:], b) + b = b[len(d.a):] + + n, state := int(b[0]), spongeDirection(b[1]) + if n > d.rate { + return errors.New("sha3: invalid hash state") + } + d.n = n + if state != spongeAbsorbing && state != spongeSqueezing { + return errors.New("sha3: invalid hash state") + } + d.state = state + + return nil +} diff --git a/vendor/golang.org/x/crypto/sha3/sha3_s390x.go b/vendor/golang.org/x/crypto/sha3/sha3_s390x.go new file mode 100644 index 00000000..00d8034a --- /dev/null +++ b/vendor/golang.org/x/crypto/sha3/sha3_s390x.go @@ -0,0 +1,303 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build gc && !purego + +package sha3 + +// This file contains code for using the 'compute intermediate +// message digest' (KIMD) and 'compute last message digest' (KLMD) +// instructions to compute SHA-3 and SHAKE hashes on IBM Z. + +import ( + "hash" + + "golang.org/x/sys/cpu" +) + +// codes represent 7-bit KIMD/KLMD function codes as defined in +// the Principles of Operation. +type code uint64 + +const ( + // function codes for KIMD/KLMD + sha3_224 code = 32 + sha3_256 = 33 + sha3_384 = 34 + sha3_512 = 35 + shake_128 = 36 + shake_256 = 37 + nopad = 0x100 +) + +// kimd is a wrapper for the 'compute intermediate message digest' instruction. +// src must be a multiple of the rate for the given function code. +// +//go:noescape +func kimd(function code, chain *[200]byte, src []byte) + +// klmd is a wrapper for the 'compute last message digest' instruction. +// src padding is handled by the instruction. +// +//go:noescape +func klmd(function code, chain *[200]byte, dst, src []byte) + +type asmState struct { + a [200]byte // 1600 bit state + buf []byte // care must be taken to ensure cap(buf) is a multiple of rate + rate int // equivalent to block size + storage [3072]byte // underlying storage for buf + outputLen int // output length for full security + function code // KIMD/KLMD function code + state spongeDirection // whether the sponge is absorbing or squeezing +} + +func newAsmState(function code) *asmState { + var s asmState + s.function = function + switch function { + case sha3_224: + s.rate = 144 + s.outputLen = 28 + case sha3_256: + s.rate = 136 + s.outputLen = 32 + case sha3_384: + s.rate = 104 + s.outputLen = 48 + case sha3_512: + s.rate = 72 + s.outputLen = 64 + case shake_128: + s.rate = 168 + s.outputLen = 32 + case shake_256: + s.rate = 136 + s.outputLen = 64 + default: + panic("sha3: unrecognized function code") + } + + // limit s.buf size to a multiple of s.rate + s.resetBuf() + return &s +} + +func (s *asmState) clone() *asmState { + c := *s + c.buf = c.storage[:len(s.buf):cap(s.buf)] + return &c +} + +// copyIntoBuf copies b into buf. It will panic if there is not enough space to +// store all of b. +func (s *asmState) copyIntoBuf(b []byte) { + bufLen := len(s.buf) + s.buf = s.buf[:len(s.buf)+len(b)] + copy(s.buf[bufLen:], b) +} + +// resetBuf points buf at storage, sets the length to 0 and sets cap to be a +// multiple of the rate. +func (s *asmState) resetBuf() { + max := (cap(s.storage) / s.rate) * s.rate + s.buf = s.storage[:0:max] +} + +// Write (via the embedded io.Writer interface) adds more data to the running hash. +// It never returns an error. +func (s *asmState) Write(b []byte) (int, error) { + if s.state != spongeAbsorbing { + panic("sha3: Write after Read") + } + length := len(b) + for len(b) > 0 { + if len(s.buf) == 0 && len(b) >= cap(s.buf) { + // Hash the data directly and push any remaining bytes + // into the buffer. + remainder := len(b) % s.rate + kimd(s.function, &s.a, b[:len(b)-remainder]) + if remainder != 0 { + s.copyIntoBuf(b[len(b)-remainder:]) + } + return length, nil + } + + if len(s.buf) == cap(s.buf) { + // flush the buffer + kimd(s.function, &s.a, s.buf) + s.buf = s.buf[:0] + } + + // copy as much as we can into the buffer + n := len(b) + if len(b) > cap(s.buf)-len(s.buf) { + n = cap(s.buf) - len(s.buf) + } + s.copyIntoBuf(b[:n]) + b = b[n:] + } + return length, nil +} + +// Read squeezes an arbitrary number of bytes from the sponge. +func (s *asmState) Read(out []byte) (n int, err error) { + // The 'compute last message digest' instruction only stores the digest + // at the first operand (dst) for SHAKE functions. + if s.function != shake_128 && s.function != shake_256 { + panic("sha3: can only call Read for SHAKE functions") + } + + n = len(out) + + // need to pad if we were absorbing + if s.state == spongeAbsorbing { + s.state = spongeSqueezing + + // write hash directly into out if possible + if len(out)%s.rate == 0 { + klmd(s.function, &s.a, out, s.buf) // len(out) may be 0 + s.buf = s.buf[:0] + return + } + + // write hash into buffer + max := cap(s.buf) + if max > len(out) { + max = (len(out)/s.rate)*s.rate + s.rate + } + klmd(s.function, &s.a, s.buf[:max], s.buf) + s.buf = s.buf[:max] + } + + for len(out) > 0 { + // flush the buffer + if len(s.buf) != 0 { + c := copy(out, s.buf) + out = out[c:] + s.buf = s.buf[c:] + continue + } + + // write hash directly into out if possible + if len(out)%s.rate == 0 { + klmd(s.function|nopad, &s.a, out, nil) + return + } + + // write hash into buffer + s.resetBuf() + if cap(s.buf) > len(out) { + s.buf = s.buf[:(len(out)/s.rate)*s.rate+s.rate] + } + klmd(s.function|nopad, &s.a, s.buf, nil) + } + return +} + +// Sum appends the current hash to b and returns the resulting slice. +// It does not change the underlying hash state. +func (s *asmState) Sum(b []byte) []byte { + if s.state != spongeAbsorbing { + panic("sha3: Sum after Read") + } + + // Copy the state to preserve the original. + a := s.a + + // Hash the buffer. Note that we don't clear it because we + // aren't updating the state. + switch s.function { + case sha3_224, sha3_256, sha3_384, sha3_512: + klmd(s.function, &a, nil, s.buf) + return append(b, a[:s.outputLen]...) + case shake_128, shake_256: + d := make([]byte, s.outputLen, 64) + klmd(s.function, &a, d, s.buf) + return append(b, d[:s.outputLen]...) + default: + panic("sha3: unknown function") + } +} + +// Reset resets the Hash to its initial state. +func (s *asmState) Reset() { + for i := range s.a { + s.a[i] = 0 + } + s.resetBuf() + s.state = spongeAbsorbing +} + +// Size returns the number of bytes Sum will return. +func (s *asmState) Size() int { + return s.outputLen +} + +// BlockSize returns the hash's underlying block size. +// The Write method must be able to accept any amount +// of data, but it may operate more efficiently if all writes +// are a multiple of the block size. +func (s *asmState) BlockSize() int { + return s.rate +} + +// Clone returns a copy of the ShakeHash in its current state. +func (s *asmState) Clone() ShakeHash { + return s.clone() +} + +// new224 returns an assembly implementation of SHA3-224 if available, +// otherwise it returns a generic implementation. +func new224() hash.Hash { + if cpu.S390X.HasSHA3 { + return newAsmState(sha3_224) + } + return new224Generic() +} + +// new256 returns an assembly implementation of SHA3-256 if available, +// otherwise it returns a generic implementation. +func new256() hash.Hash { + if cpu.S390X.HasSHA3 { + return newAsmState(sha3_256) + } + return new256Generic() +} + +// new384 returns an assembly implementation of SHA3-384 if available, +// otherwise it returns a generic implementation. +func new384() hash.Hash { + if cpu.S390X.HasSHA3 { + return newAsmState(sha3_384) + } + return new384Generic() +} + +// new512 returns an assembly implementation of SHA3-512 if available, +// otherwise it returns a generic implementation. +func new512() hash.Hash { + if cpu.S390X.HasSHA3 { + return newAsmState(sha3_512) + } + return new512Generic() +} + +// newShake128 returns an assembly implementation of SHAKE-128 if available, +// otherwise it returns a generic implementation. +func newShake128() ShakeHash { + if cpu.S390X.HasSHA3 { + return newAsmState(shake_128) + } + return newShake128Generic() +} + +// newShake256 returns an assembly implementation of SHAKE-256 if available, +// otherwise it returns a generic implementation. +func newShake256() ShakeHash { + if cpu.S390X.HasSHA3 { + return newAsmState(shake_256) + } + return newShake256Generic() +} diff --git a/vendor/golang.org/x/crypto/sha3/sha3_s390x.s b/vendor/golang.org/x/crypto/sha3/sha3_s390x.s new file mode 100644 index 00000000..826b862c --- /dev/null +++ b/vendor/golang.org/x/crypto/sha3/sha3_s390x.s @@ -0,0 +1,33 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build gc && !purego + +#include "textflag.h" + +// func kimd(function code, chain *[200]byte, src []byte) +TEXT ·kimd(SB), NOFRAME|NOSPLIT, $0-40 + MOVD function+0(FP), R0 + MOVD chain+8(FP), R1 + LMG src+16(FP), R2, R3 // R2=base, R3=len + +continue: + WORD $0xB93E0002 // KIMD --, R2 + BVS continue // continue if interrupted + MOVD $0, R0 // reset R0 for pre-go1.8 compilers + RET + +// func klmd(function code, chain *[200]byte, dst, src []byte) +TEXT ·klmd(SB), NOFRAME|NOSPLIT, $0-64 + // TODO: SHAKE support + MOVD function+0(FP), R0 + MOVD chain+8(FP), R1 + LMG dst+16(FP), R2, R3 // R2=base, R3=len + LMG src+40(FP), R4, R5 // R4=base, R5=len + +continue: + WORD $0xB93F0024 // KLMD R2, R4 + BVS continue // continue if interrupted + MOVD $0, R0 // reset R0 for pre-go1.8 compilers + RET diff --git a/vendor/golang.org/x/crypto/sha3/shake.go b/vendor/golang.org/x/crypto/sha3/shake.go new file mode 100644 index 00000000..a6b3a428 --- /dev/null +++ b/vendor/golang.org/x/crypto/sha3/shake.go @@ -0,0 +1,193 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package sha3 + +// This file defines the ShakeHash interface, and provides +// functions for creating SHAKE and cSHAKE instances, as well as utility +// functions for hashing bytes to arbitrary-length output. +// +// +// SHAKE implementation is based on FIPS PUB 202 [1] +// cSHAKE implementations is based on NIST SP 800-185 [2] +// +// [1] https://nvlpubs.nist.gov/nistpubs/FIPS/NIST.FIPS.202.pdf +// [2] https://doi.org/10.6028/NIST.SP.800-185 + +import ( + "bytes" + "encoding/binary" + "errors" + "hash" + "io" + "math/bits" +) + +// ShakeHash defines the interface to hash functions that support +// arbitrary-length output. When used as a plain [hash.Hash], it +// produces minimum-length outputs that provide full-strength generic +// security. +type ShakeHash interface { + hash.Hash + + // Read reads more output from the hash; reading affects the hash's + // state. (ShakeHash.Read is thus very different from Hash.Sum) + // It never returns an error, but subsequent calls to Write or Sum + // will panic. + io.Reader + + // Clone returns a copy of the ShakeHash in its current state. + Clone() ShakeHash +} + +// cSHAKE specific context +type cshakeState struct { + *state // SHA-3 state context and Read/Write operations + + // initBlock is the cSHAKE specific initialization set of bytes. It is initialized + // by newCShake function and stores concatenation of N followed by S, encoded + // by the method specified in 3.3 of [1]. + // It is stored here in order for Reset() to be able to put context into + // initial state. + initBlock []byte +} + +func bytepad(data []byte, rate int) []byte { + out := make([]byte, 0, 9+len(data)+rate-1) + out = append(out, leftEncode(uint64(rate))...) + out = append(out, data...) + if padlen := rate - len(out)%rate; padlen < rate { + out = append(out, make([]byte, padlen)...) + } + return out +} + +func leftEncode(x uint64) []byte { + // Let n be the smallest positive integer for which 2^(8n) > x. + n := (bits.Len64(x) + 7) / 8 + if n == 0 { + n = 1 + } + // Return n || x with n as a byte and x an n bytes in big-endian order. + b := make([]byte, 9) + binary.BigEndian.PutUint64(b[1:], x) + b = b[9-n-1:] + b[0] = byte(n) + return b +} + +func newCShake(N, S []byte, rate, outputLen int, dsbyte byte) ShakeHash { + c := cshakeState{state: &state{rate: rate, outputLen: outputLen, dsbyte: dsbyte}} + c.initBlock = make([]byte, 0, 9+len(N)+9+len(S)) // leftEncode returns max 9 bytes + c.initBlock = append(c.initBlock, leftEncode(uint64(len(N))*8)...) + c.initBlock = append(c.initBlock, N...) + c.initBlock = append(c.initBlock, leftEncode(uint64(len(S))*8)...) + c.initBlock = append(c.initBlock, S...) + c.Write(bytepad(c.initBlock, c.rate)) + return &c +} + +// Reset resets the hash to initial state. +func (c *cshakeState) Reset() { + c.state.Reset() + c.Write(bytepad(c.initBlock, c.rate)) +} + +// Clone returns copy of a cSHAKE context within its current state. +func (c *cshakeState) Clone() ShakeHash { + b := make([]byte, len(c.initBlock)) + copy(b, c.initBlock) + return &cshakeState{state: c.clone(), initBlock: b} +} + +// Clone returns copy of SHAKE context within its current state. +func (c *state) Clone() ShakeHash { + return c.clone() +} + +func (c *cshakeState) MarshalBinary() ([]byte, error) { + return c.AppendBinary(make([]byte, 0, marshaledSize+len(c.initBlock))) +} + +func (c *cshakeState) AppendBinary(b []byte) ([]byte, error) { + b, err := c.state.AppendBinary(b) + if err != nil { + return nil, err + } + b = append(b, c.initBlock...) + return b, nil +} + +func (c *cshakeState) UnmarshalBinary(b []byte) error { + if len(b) <= marshaledSize { + return errors.New("sha3: invalid hash state") + } + if err := c.state.UnmarshalBinary(b[:marshaledSize]); err != nil { + return err + } + c.initBlock = bytes.Clone(b[marshaledSize:]) + return nil +} + +// NewShake128 creates a new SHAKE128 variable-output-length ShakeHash. +// Its generic security strength is 128 bits against all attacks if at +// least 32 bytes of its output are used. +func NewShake128() ShakeHash { + return newShake128() +} + +// NewShake256 creates a new SHAKE256 variable-output-length ShakeHash. +// Its generic security strength is 256 bits against all attacks if +// at least 64 bytes of its output are used. +func NewShake256() ShakeHash { + return newShake256() +} + +func newShake128Generic() *state { + return &state{rate: rateK256, outputLen: 32, dsbyte: dsbyteShake} +} + +func newShake256Generic() *state { + return &state{rate: rateK512, outputLen: 64, dsbyte: dsbyteShake} +} + +// NewCShake128 creates a new instance of cSHAKE128 variable-output-length ShakeHash, +// a customizable variant of SHAKE128. +// N is used to define functions based on cSHAKE, it can be empty when plain cSHAKE is +// desired. S is a customization byte string used for domain separation - two cSHAKE +// computations on same input with different S yield unrelated outputs. +// When N and S are both empty, this is equivalent to NewShake128. +func NewCShake128(N, S []byte) ShakeHash { + if len(N) == 0 && len(S) == 0 { + return NewShake128() + } + return newCShake(N, S, rateK256, 32, dsbyteCShake) +} + +// NewCShake256 creates a new instance of cSHAKE256 variable-output-length ShakeHash, +// a customizable variant of SHAKE256. +// N is used to define functions based on cSHAKE, it can be empty when plain cSHAKE is +// desired. S is a customization byte string used for domain separation - two cSHAKE +// computations on same input with different S yield unrelated outputs. +// When N and S are both empty, this is equivalent to NewShake256. +func NewCShake256(N, S []byte) ShakeHash { + if len(N) == 0 && len(S) == 0 { + return NewShake256() + } + return newCShake(N, S, rateK512, 64, dsbyteCShake) +} + +// ShakeSum128 writes an arbitrary-length digest of data into hash. +func ShakeSum128(hash, data []byte) { + h := NewShake128() + h.Write(data) + h.Read(hash) +} + +// ShakeSum256 writes an arbitrary-length digest of data into hash. +func ShakeSum256(hash, data []byte) { + h := NewShake256() + h.Write(data) + h.Read(hash) +} diff --git a/vendor/golang.org/x/crypto/sha3/shake_noasm.go b/vendor/golang.org/x/crypto/sha3/shake_noasm.go new file mode 100644 index 00000000..4276ba4a --- /dev/null +++ b/vendor/golang.org/x/crypto/sha3/shake_noasm.go @@ -0,0 +1,15 @@ +// Copyright 2023 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build !gc || purego || !s390x + +package sha3 + +func newShake128() *state { + return newShake128Generic() +} + +func newShake256() *state { + return newShake256Generic() +} diff --git a/vendor/golang.org/x/net/html/atom/atom.go b/vendor/golang.org/x/net/html/atom/atom.go new file mode 100644 index 00000000..cd0a8ac1 --- /dev/null +++ b/vendor/golang.org/x/net/html/atom/atom.go @@ -0,0 +1,78 @@ +// Copyright 2012 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package atom provides integer codes (also known as atoms) for a fixed set of +// frequently occurring HTML strings: tag names and attribute keys such as "p" +// and "id". +// +// Sharing an atom's name between all elements with the same tag can result in +// fewer string allocations when tokenizing and parsing HTML. Integer +// comparisons are also generally faster than string comparisons. +// +// The value of an atom's particular code is not guaranteed to stay the same +// between versions of this package. Neither is any ordering guaranteed: +// whether atom.H1 < atom.H2 may also change. The codes are not guaranteed to +// be dense. The only guarantees are that e.g. looking up "div" will yield +// atom.Div, calling atom.Div.String will return "div", and atom.Div != 0. +package atom // import "golang.org/x/net/html/atom" + +// Atom is an integer code for a string. The zero value maps to "". +type Atom uint32 + +// String returns the atom's name. +func (a Atom) String() string { + start := uint32(a >> 8) + n := uint32(a & 0xff) + if start+n > uint32(len(atomText)) { + return "" + } + return atomText[start : start+n] +} + +func (a Atom) string() string { + return atomText[a>>8 : a>>8+a&0xff] +} + +// fnv computes the FNV hash with an arbitrary starting value h. +func fnv(h uint32, s []byte) uint32 { + for i := range s { + h ^= uint32(s[i]) + h *= 16777619 + } + return h +} + +func match(s string, t []byte) bool { + for i, c := range t { + if s[i] != c { + return false + } + } + return true +} + +// Lookup returns the atom whose name is s. It returns zero if there is no +// such atom. The lookup is case sensitive. +func Lookup(s []byte) Atom { + if len(s) == 0 || len(s) > maxAtomLen { + return 0 + } + h := fnv(hash0, s) + if a := table[h&uint32(len(table)-1)]; int(a&0xff) == len(s) && match(a.string(), s) { + return a + } + if a := table[(h>>16)&uint32(len(table)-1)]; int(a&0xff) == len(s) && match(a.string(), s) { + return a + } + return 0 +} + +// String returns a string whose contents are equal to s. In that sense, it is +// equivalent to string(s) but may be more efficient. +func String(s []byte) string { + if a := Lookup(s); a != 0 { + return a.String() + } + return string(s) +} diff --git a/vendor/golang.org/x/net/html/atom/table.go b/vendor/golang.org/x/net/html/atom/table.go new file mode 100644 index 00000000..b460e6f7 --- /dev/null +++ b/vendor/golang.org/x/net/html/atom/table.go @@ -0,0 +1,785 @@ +// Code generated by go generate gen.go; DO NOT EDIT. + +//go:generate go run gen.go + +package atom + +const ( + A Atom = 0x1 + Abbr Atom = 0x4 + Accept Atom = 0x1a06 + AcceptCharset Atom = 0x1a0e + Accesskey Atom = 0x2c09 + Acronym Atom = 0xaa07 + Action Atom = 0x26506 + Address Atom = 0x6f107 + Align Atom = 0xb105 + Allowfullscreen Atom = 0x3280f + Allowpaymentrequest Atom = 0xc113 + Allowusermedia Atom = 0xdd0e + Alt Atom = 0xf303 + Annotation Atom = 0x1c90a + AnnotationXml Atom = 0x1c90e + Applet Atom = 0x30806 + Area Atom = 0x35004 + Article Atom = 0x3f607 + As Atom = 0x3c02 + Aside Atom = 0x10705 + Async Atom = 0xff05 + Audio Atom = 0x11505 + Autocomplete Atom = 0x26b0c + Autofocus Atom = 0x12109 + Autoplay Atom = 0x13c08 + B Atom = 0x101 + Base Atom = 0x3b04 + Basefont Atom = 0x3b08 + Bdi Atom = 0xba03 + Bdo Atom = 0x14b03 + Bgsound Atom = 0x15e07 + Big Atom = 0x17003 + Blink Atom = 0x17305 + Blockquote Atom = 0x1870a + Body Atom = 0x2804 + Br Atom = 0x202 + Button Atom = 0x19106 + Canvas Atom = 0x10306 + Caption Atom = 0x22407 + Center Atom = 0x21306 + Challenge Atom = 0x28e09 + Charset Atom = 0x2107 + Checked Atom = 0x5b507 + Cite Atom = 0x19c04 + Class Atom = 0x55805 + Code Atom = 0x5ee04 + Col Atom = 0x1ab03 + Colgroup Atom = 0x1ab08 + Color Atom = 0x1bf05 + Cols Atom = 0x1c404 + Colspan Atom = 0x1c407 + Command Atom = 0x1d707 + Content Atom = 0x57b07 + Contenteditable Atom = 0x57b0f + Contextmenu Atom = 0x37a0b + Controls Atom = 0x1de08 + Coords Atom = 0x1f006 + Crossorigin Atom = 0x1fa0b + Data Atom = 0x49904 + Datalist Atom = 0x49908 + Datetime Atom = 0x2ab08 + Dd Atom = 0x2bf02 + Default Atom = 0x10a07 + Defer Atom = 0x5f005 + Del Atom = 0x44c03 + Desc Atom = 0x55504 + Details Atom = 0x7207 + Dfn Atom = 0x8703 + Dialog Atom = 0xbb06 + Dir Atom = 0x9303 + Dirname Atom = 0x9307 + Disabled Atom = 0x16408 + Div Atom = 0x16b03 + Dl Atom = 0x5d602 + Download Atom = 0x45d08 + Draggable Atom = 0x17a09 + Dropzone Atom = 0x3ff08 + Dt Atom = 0x64002 + Em Atom = 0x6e02 + Embed Atom = 0x6e05 + Enctype Atom = 0x28007 + Face Atom = 0x21104 + Fieldset Atom = 0x21908 + Figcaption Atom = 0x2210a + Figure Atom = 0x23b06 + Font Atom = 0x3f04 + Footer Atom = 0xf606 + For Atom = 0x24703 + ForeignObject Atom = 0x2470d + Foreignobject Atom = 0x2540d + Form Atom = 0x26104 + Formaction Atom = 0x2610a + Formenctype Atom = 0x27c0b + Formmethod Atom = 0x2970a + Formnovalidate Atom = 0x2a10e + Formtarget Atom = 0x2b30a + Frame Atom = 0x8b05 + Frameset Atom = 0x8b08 + H1 Atom = 0x15c02 + H2 Atom = 0x56102 + H3 Atom = 0x2cd02 + H4 Atom = 0x2fc02 + H5 Atom = 0x33f02 + H6 Atom = 0x34902 + Head Atom = 0x32004 + Header Atom = 0x32006 + Headers Atom = 0x32007 + Height Atom = 0x5206 + Hgroup Atom = 0x64206 + Hidden Atom = 0x2bd06 + High Atom = 0x2ca04 + Hr Atom = 0x15702 + Href Atom = 0x2cf04 + Hreflang Atom = 0x2cf08 + Html Atom = 0x5604 + HttpEquiv Atom = 0x2d70a + I Atom = 0x601 + Icon Atom = 0x57a04 + Id Atom = 0x10902 + Iframe Atom = 0x2eb06 + Image Atom = 0x2f105 + Img Atom = 0x2f603 + Input Atom = 0x44505 + Inputmode Atom = 0x44509 + Ins Atom = 0x20303 + Integrity Atom = 0x23209 + Is Atom = 0x16502 + Isindex Atom = 0x2fe07 + Ismap Atom = 0x30505 + Itemid Atom = 0x38506 + Itemprop Atom = 0x19d08 + Itemref Atom = 0x3c707 + Itemscope Atom = 0x66f09 + Itemtype Atom = 0x30e08 + Kbd Atom = 0xb903 + Keygen Atom = 0x3206 + Keytype Atom = 0xd607 + Kind Atom = 0x17704 + Label Atom = 0x5905 + Lang Atom = 0x2d304 + Legend Atom = 0x18106 + Li Atom = 0xb202 + Link Atom = 0x17404 + List Atom = 0x49d04 + Listing Atom = 0x49d07 + Loop Atom = 0x5d04 + Low Atom = 0xc303 + Main Atom = 0x1004 + Malignmark Atom = 0xb00a + Manifest Atom = 0x6d508 + Map Atom = 0x30703 + Mark Atom = 0xb604 + Marquee Atom = 0x31607 + Math Atom = 0x31d04 + Max Atom = 0x33703 + Maxlength Atom = 0x33709 + Media Atom = 0xe605 + Mediagroup Atom = 0xe60a + Menu Atom = 0x38104 + Menuitem Atom = 0x38108 + Meta Atom = 0x4ac04 + Meter Atom = 0x9805 + Method Atom = 0x29b06 + Mglyph Atom = 0x2f706 + Mi Atom = 0x34102 + Min Atom = 0x34103 + Minlength Atom = 0x34109 + Mn Atom = 0x2a402 + Mo Atom = 0xa402 + Ms Atom = 0x67202 + Mtext Atom = 0x34b05 + Multiple Atom = 0x35908 + Muted Atom = 0x36105 + Name Atom = 0x9604 + Nav Atom = 0x1303 + Nobr Atom = 0x3704 + Noembed Atom = 0x6c07 + Noframes Atom = 0x8908 + Nomodule Atom = 0xa208 + Nonce Atom = 0x1a605 + Noscript Atom = 0x2c208 + Novalidate Atom = 0x2a50a + Object Atom = 0x25b06 + Ol Atom = 0x13702 + Onabort Atom = 0x19507 + Onafterprint Atom = 0x2290c + Onautocomplete Atom = 0x2690e + Onautocompleteerror Atom = 0x26913 + Onauxclick Atom = 0x6140a + Onbeforeprint Atom = 0x69c0d + Onbeforeunload Atom = 0x6e50e + Onblur Atom = 0x1ea06 + Oncancel Atom = 0x11908 + Oncanplay Atom = 0x14d09 + Oncanplaythrough Atom = 0x14d10 + Onchange Atom = 0x41508 + Onclick Atom = 0x2e407 + Onclose Atom = 0x36607 + Oncontextmenu Atom = 0x3780d + Oncopy Atom = 0x38b06 + Oncuechange Atom = 0x3910b + Oncut Atom = 0x39c05 + Ondblclick Atom = 0x3a10a + Ondrag Atom = 0x3ab06 + Ondragend Atom = 0x3ab09 + Ondragenter Atom = 0x3b40b + Ondragexit Atom = 0x3bf0a + Ondragleave Atom = 0x3d90b + Ondragover Atom = 0x3e40a + Ondragstart Atom = 0x3ee0b + Ondrop Atom = 0x3fd06 + Ondurationchange Atom = 0x40d10 + Onemptied Atom = 0x40409 + Onended Atom = 0x41d07 + Onerror Atom = 0x42407 + Onfocus Atom = 0x42b07 + Onhashchange Atom = 0x4370c + Oninput Atom = 0x44307 + Oninvalid Atom = 0x44f09 + Onkeydown Atom = 0x45809 + Onkeypress Atom = 0x4650a + Onkeyup Atom = 0x47407 + Onlanguagechange Atom = 0x48110 + Onload Atom = 0x49106 + Onloadeddata Atom = 0x4910c + Onloadedmetadata Atom = 0x4a410 + Onloadend Atom = 0x4ba09 + Onloadstart Atom = 0x4c30b + Onmessage Atom = 0x4ce09 + Onmessageerror Atom = 0x4ce0e + Onmousedown Atom = 0x4dc0b + Onmouseenter Atom = 0x4e70c + Onmouseleave Atom = 0x4f30c + Onmousemove Atom = 0x4ff0b + Onmouseout Atom = 0x50a0a + Onmouseover Atom = 0x5170b + Onmouseup Atom = 0x52209 + Onmousewheel Atom = 0x5300c + Onoffline Atom = 0x53c09 + Ononline Atom = 0x54508 + Onpagehide Atom = 0x54d0a + Onpageshow Atom = 0x5630a + Onpaste Atom = 0x56f07 + Onpause Atom = 0x58a07 + Onplay Atom = 0x59406 + Onplaying Atom = 0x59409 + Onpopstate Atom = 0x59d0a + Onprogress Atom = 0x5a70a + Onratechange Atom = 0x5bc0c + Onrejectionhandled Atom = 0x5c812 + Onreset Atom = 0x5da07 + Onresize Atom = 0x5e108 + Onscroll Atom = 0x5f508 + Onsecuritypolicyviolation Atom = 0x5fd19 + Onseeked Atom = 0x61e08 + Onseeking Atom = 0x62609 + Onselect Atom = 0x62f08 + Onshow Atom = 0x63906 + Onsort Atom = 0x64d06 + Onstalled Atom = 0x65709 + Onstorage Atom = 0x66009 + Onsubmit Atom = 0x66908 + Onsuspend Atom = 0x67909 + Ontimeupdate Atom = 0x400c + Ontoggle Atom = 0x68208 + Onunhandledrejection Atom = 0x68a14 + Onunload Atom = 0x6a908 + Onvolumechange Atom = 0x6b10e + Onwaiting Atom = 0x6bf09 + Onwheel Atom = 0x6c807 + Open Atom = 0x1a304 + Optgroup Atom = 0x5f08 + Optimum Atom = 0x6cf07 + Option Atom = 0x6e106 + Output Atom = 0x51106 + P Atom = 0xc01 + Param Atom = 0xc05 + Pattern Atom = 0x6607 + Picture Atom = 0x7b07 + Ping Atom = 0xef04 + Placeholder Atom = 0x1310b + Plaintext Atom = 0x1b209 + Playsinline Atom = 0x1400b + Poster Atom = 0x64706 + Pre Atom = 0x46a03 + Preload Atom = 0x47a07 + Progress Atom = 0x5a908 + Prompt Atom = 0x52a06 + Public Atom = 0x57606 + Q Atom = 0xcf01 + Radiogroup Atom = 0x30a + Rb Atom = 0x3a02 + Readonly Atom = 0x35108 + Referrerpolicy Atom = 0x3cb0e + Rel Atom = 0x47b03 + Required Atom = 0x23f08 + Reversed Atom = 0x8008 + Rows Atom = 0x9c04 + Rowspan Atom = 0x9c07 + Rp Atom = 0x22f02 + Rt Atom = 0x19a02 + Rtc Atom = 0x19a03 + Ruby Atom = 0xfb04 + S Atom = 0x2501 + Samp Atom = 0x7804 + Sandbox Atom = 0x12907 + Scope Atom = 0x67305 + Scoped Atom = 0x67306 + Script Atom = 0x2c406 + Seamless Atom = 0x36b08 + Search Atom = 0x55c06 + Section Atom = 0x1e507 + Select Atom = 0x63106 + Selected Atom = 0x63108 + Shape Atom = 0x1f505 + Size Atom = 0x5e504 + Sizes Atom = 0x5e505 + Slot Atom = 0x20504 + Small Atom = 0x32605 + Sortable Atom = 0x64f08 + Sorted Atom = 0x37206 + Source Atom = 0x43106 + Spacer Atom = 0x46e06 + Span Atom = 0x9f04 + Spellcheck Atom = 0x5b00a + Src Atom = 0x5e903 + Srcdoc Atom = 0x5e906 + Srclang Atom = 0x6f707 + Srcset Atom = 0x6fe06 + Start Atom = 0x3f405 + Step Atom = 0x57304 + Strike Atom = 0xd206 + Strong Atom = 0x6db06 + Style Atom = 0x70405 + Sub Atom = 0x66b03 + Summary Atom = 0x70907 + Sup Atom = 0x71003 + Svg Atom = 0x71303 + System Atom = 0x71606 + Tabindex Atom = 0x4b208 + Table Atom = 0x58505 + Target Atom = 0x2b706 + Tbody Atom = 0x2705 + Td Atom = 0x9202 + Template Atom = 0x71908 + Textarea Atom = 0x34c08 + Tfoot Atom = 0xf505 + Th Atom = 0x15602 + Thead Atom = 0x31f05 + Time Atom = 0x4204 + Title Atom = 0x11005 + Tr Atom = 0xcc02 + Track Atom = 0x1ba05 + Translate Atom = 0x20809 + Tt Atom = 0x6802 + Type Atom = 0xd904 + Typemustmatch Atom = 0x2830d + U Atom = 0xb01 + Ul Atom = 0xa702 + Updateviacache Atom = 0x460e + Usemap Atom = 0x58e06 + Value Atom = 0x1505 + Var Atom = 0x16d03 + Video Atom = 0x2e005 + Wbr Atom = 0x56c03 + Width Atom = 0x63e05 + Workertype Atom = 0x7210a + Wrap Atom = 0x72b04 + Xmp Atom = 0x12f03 +) + +const hash0 = 0x84f70e16 + +const maxAtomLen = 25 + +var table = [1 << 9]Atom{ + 0x1: 0x3ff08, // dropzone + 0x2: 0x3b08, // basefont + 0x3: 0x23209, // integrity + 0x4: 0x43106, // source + 0x5: 0x2c09, // accesskey + 0x6: 0x1a06, // accept + 0x7: 0x6c807, // onwheel + 0xb: 0x47407, // onkeyup + 0xc: 0x32007, // headers + 0xd: 0x67306, // scoped + 0xe: 0x67909, // onsuspend + 0xf: 0x8908, // noframes + 0x10: 0x1fa0b, // crossorigin + 0x11: 0x2e407, // onclick + 0x12: 0x3f405, // start + 0x13: 0x37a0b, // contextmenu + 0x14: 0x5e903, // src + 0x15: 0x1c404, // cols + 0x16: 0xbb06, // dialog + 0x17: 0x47a07, // preload + 0x18: 0x3c707, // itemref + 0x1b: 0x2f105, // image + 0x1d: 0x4ba09, // onloadend + 0x1e: 0x45d08, // download + 0x1f: 0x46a03, // pre + 0x23: 0x2970a, // formmethod + 0x24: 0x71303, // svg + 0x25: 0xcf01, // q + 0x26: 0x64002, // dt + 0x27: 0x1de08, // controls + 0x2a: 0x2804, // body + 0x2b: 0xd206, // strike + 0x2c: 0x3910b, // oncuechange + 0x2d: 0x4c30b, // onloadstart + 0x2e: 0x2fe07, // isindex + 0x2f: 0xb202, // li + 0x30: 0x1400b, // playsinline + 0x31: 0x34102, // mi + 0x32: 0x30806, // applet + 0x33: 0x4ce09, // onmessage + 0x35: 0x13702, // ol + 0x36: 0x1a304, // open + 0x39: 0x14d09, // oncanplay + 0x3a: 0x6bf09, // onwaiting + 0x3b: 0x11908, // oncancel + 0x3c: 0x6a908, // onunload + 0x3e: 0x53c09, // onoffline + 0x3f: 0x1a0e, // accept-charset + 0x40: 0x32004, // head + 0x42: 0x3ab09, // ondragend + 0x43: 0x1310b, // placeholder + 0x44: 0x2b30a, // formtarget + 0x45: 0x2540d, // foreignobject + 0x47: 0x400c, // ontimeupdate + 0x48: 0xdd0e, // allowusermedia + 0x4a: 0x69c0d, // onbeforeprint + 0x4b: 0x5604, // html + 0x4c: 0x9f04, // span + 0x4d: 0x64206, // hgroup + 0x4e: 0x16408, // disabled + 0x4f: 0x4204, // time + 0x51: 0x42b07, // onfocus + 0x53: 0xb00a, // malignmark + 0x55: 0x4650a, // onkeypress + 0x56: 0x55805, // class + 0x57: 0x1ab08, // colgroup + 0x58: 0x33709, // maxlength + 0x59: 0x5a908, // progress + 0x5b: 0x70405, // style + 0x5c: 0x2a10e, // formnovalidate + 0x5e: 0x38b06, // oncopy + 0x60: 0x26104, // form + 0x61: 0xf606, // footer + 0x64: 0x30a, // radiogroup + 0x66: 0xfb04, // ruby + 0x67: 0x4ff0b, // onmousemove + 0x68: 0x19d08, // itemprop + 0x69: 0x2d70a, // http-equiv + 0x6a: 0x15602, // th + 0x6c: 0x6e02, // em + 0x6d: 0x38108, // menuitem + 0x6e: 0x63106, // select + 0x6f: 0x48110, // onlanguagechange + 0x70: 0x31f05, // thead + 0x71: 0x15c02, // h1 + 0x72: 0x5e906, // srcdoc + 0x75: 0x9604, // name + 0x76: 0x19106, // button + 0x77: 0x55504, // desc + 0x78: 0x17704, // kind + 0x79: 0x1bf05, // color + 0x7c: 0x58e06, // usemap + 0x7d: 0x30e08, // itemtype + 0x7f: 0x6d508, // manifest + 0x81: 0x5300c, // onmousewheel + 0x82: 0x4dc0b, // onmousedown + 0x84: 0xc05, // param + 0x85: 0x2e005, // video + 0x86: 0x4910c, // onloadeddata + 0x87: 0x6f107, // address + 0x8c: 0xef04, // ping + 0x8d: 0x24703, // for + 0x8f: 0x62f08, // onselect + 0x90: 0x30703, // map + 0x92: 0xc01, // p + 0x93: 0x8008, // reversed + 0x94: 0x54d0a, // onpagehide + 0x95: 0x3206, // keygen + 0x96: 0x34109, // minlength + 0x97: 0x3e40a, // ondragover + 0x98: 0x42407, // onerror + 0x9a: 0x2107, // charset + 0x9b: 0x29b06, // method + 0x9c: 0x101, // b + 0x9d: 0x68208, // ontoggle + 0x9e: 0x2bd06, // hidden + 0xa0: 0x3f607, // article + 0xa2: 0x63906, // onshow + 0xa3: 0x64d06, // onsort + 0xa5: 0x57b0f, // contenteditable + 0xa6: 0x66908, // onsubmit + 0xa8: 0x44f09, // oninvalid + 0xaa: 0x202, // br + 0xab: 0x10902, // id + 0xac: 0x5d04, // loop + 0xad: 0x5630a, // onpageshow + 0xb0: 0x2cf04, // href + 0xb2: 0x2210a, // figcaption + 0xb3: 0x2690e, // onautocomplete + 0xb4: 0x49106, // onload + 0xb6: 0x9c04, // rows + 0xb7: 0x1a605, // nonce + 0xb8: 0x68a14, // onunhandledrejection + 0xbb: 0x21306, // center + 0xbc: 0x59406, // onplay + 0xbd: 0x33f02, // h5 + 0xbe: 0x49d07, // listing + 0xbf: 0x57606, // public + 0xc2: 0x23b06, // figure + 0xc3: 0x57a04, // icon + 0xc4: 0x1ab03, // col + 0xc5: 0x47b03, // rel + 0xc6: 0xe605, // media + 0xc7: 0x12109, // autofocus + 0xc8: 0x19a02, // rt + 0xca: 0x2d304, // lang + 0xcc: 0x49908, // datalist + 0xce: 0x2eb06, // iframe + 0xcf: 0x36105, // muted + 0xd0: 0x6140a, // onauxclick + 0xd2: 0x3c02, // as + 0xd6: 0x3fd06, // ondrop + 0xd7: 0x1c90a, // annotation + 0xd8: 0x21908, // fieldset + 0xdb: 0x2cf08, // hreflang + 0xdc: 0x4e70c, // onmouseenter + 0xdd: 0x2a402, // mn + 0xde: 0xe60a, // mediagroup + 0xdf: 0x9805, // meter + 0xe0: 0x56c03, // wbr + 0xe2: 0x63e05, // width + 0xe3: 0x2290c, // onafterprint + 0xe4: 0x30505, // ismap + 0xe5: 0x1505, // value + 0xe7: 0x1303, // nav + 0xe8: 0x54508, // ononline + 0xe9: 0xb604, // mark + 0xea: 0xc303, // low + 0xeb: 0x3ee0b, // ondragstart + 0xef: 0x12f03, // xmp + 0xf0: 0x22407, // caption + 0xf1: 0xd904, // type + 0xf2: 0x70907, // summary + 0xf3: 0x6802, // tt + 0xf4: 0x20809, // translate + 0xf5: 0x1870a, // blockquote + 0xf8: 0x15702, // hr + 0xfa: 0x2705, // tbody + 0xfc: 0x7b07, // picture + 0xfd: 0x5206, // height + 0xfe: 0x19c04, // cite + 0xff: 0x2501, // s + 0x101: 0xff05, // async + 0x102: 0x56f07, // onpaste + 0x103: 0x19507, // onabort + 0x104: 0x2b706, // target + 0x105: 0x14b03, // bdo + 0x106: 0x1f006, // coords + 0x107: 0x5e108, // onresize + 0x108: 0x71908, // template + 0x10a: 0x3a02, // rb + 0x10b: 0x2a50a, // novalidate + 0x10c: 0x460e, // updateviacache + 0x10d: 0x71003, // sup + 0x10e: 0x6c07, // noembed + 0x10f: 0x16b03, // div + 0x110: 0x6f707, // srclang + 0x111: 0x17a09, // draggable + 0x112: 0x67305, // scope + 0x113: 0x5905, // label + 0x114: 0x22f02, // rp + 0x115: 0x23f08, // required + 0x116: 0x3780d, // oncontextmenu + 0x117: 0x5e504, // size + 0x118: 0x5b00a, // spellcheck + 0x119: 0x3f04, // font + 0x11a: 0x9c07, // rowspan + 0x11b: 0x10a07, // default + 0x11d: 0x44307, // oninput + 0x11e: 0x38506, // itemid + 0x11f: 0x5ee04, // code + 0x120: 0xaa07, // acronym + 0x121: 0x3b04, // base + 0x125: 0x2470d, // foreignObject + 0x126: 0x2ca04, // high + 0x127: 0x3cb0e, // referrerpolicy + 0x128: 0x33703, // max + 0x129: 0x59d0a, // onpopstate + 0x12a: 0x2fc02, // h4 + 0x12b: 0x4ac04, // meta + 0x12c: 0x17305, // blink + 0x12e: 0x5f508, // onscroll + 0x12f: 0x59409, // onplaying + 0x130: 0xc113, // allowpaymentrequest + 0x131: 0x19a03, // rtc + 0x132: 0x72b04, // wrap + 0x134: 0x8b08, // frameset + 0x135: 0x32605, // small + 0x137: 0x32006, // header + 0x138: 0x40409, // onemptied + 0x139: 0x34902, // h6 + 0x13a: 0x35908, // multiple + 0x13c: 0x52a06, // prompt + 0x13f: 0x28e09, // challenge + 0x141: 0x4370c, // onhashchange + 0x142: 0x57b07, // content + 0x143: 0x1c90e, // annotation-xml + 0x144: 0x36607, // onclose + 0x145: 0x14d10, // oncanplaythrough + 0x148: 0x5170b, // onmouseover + 0x149: 0x64f08, // sortable + 0x14a: 0xa402, // mo + 0x14b: 0x2cd02, // h3 + 0x14c: 0x2c406, // script + 0x14d: 0x41d07, // onended + 0x14f: 0x64706, // poster + 0x150: 0x7210a, // workertype + 0x153: 0x1f505, // shape + 0x154: 0x4, // abbr + 0x155: 0x1, // a + 0x156: 0x2bf02, // dd + 0x157: 0x71606, // system + 0x158: 0x4ce0e, // onmessageerror + 0x159: 0x36b08, // seamless + 0x15a: 0x2610a, // formaction + 0x15b: 0x6e106, // option + 0x15c: 0x31d04, // math + 0x15d: 0x62609, // onseeking + 0x15e: 0x39c05, // oncut + 0x15f: 0x44c03, // del + 0x160: 0x11005, // title + 0x161: 0x11505, // audio + 0x162: 0x63108, // selected + 0x165: 0x3b40b, // ondragenter + 0x166: 0x46e06, // spacer + 0x167: 0x4a410, // onloadedmetadata + 0x168: 0x44505, // input + 0x16a: 0x58505, // table + 0x16b: 0x41508, // onchange + 0x16e: 0x5f005, // defer + 0x171: 0x50a0a, // onmouseout + 0x172: 0x20504, // slot + 0x175: 0x3704, // nobr + 0x177: 0x1d707, // command + 0x17a: 0x7207, // details + 0x17b: 0x38104, // menu + 0x17c: 0xb903, // kbd + 0x17d: 0x57304, // step + 0x17e: 0x20303, // ins + 0x17f: 0x13c08, // autoplay + 0x182: 0x34103, // min + 0x183: 0x17404, // link + 0x185: 0x40d10, // ondurationchange + 0x186: 0x9202, // td + 0x187: 0x8b05, // frame + 0x18a: 0x2ab08, // datetime + 0x18b: 0x44509, // inputmode + 0x18c: 0x35108, // readonly + 0x18d: 0x21104, // face + 0x18f: 0x5e505, // sizes + 0x191: 0x4b208, // tabindex + 0x192: 0x6db06, // strong + 0x193: 0xba03, // bdi + 0x194: 0x6fe06, // srcset + 0x196: 0x67202, // ms + 0x197: 0x5b507, // checked + 0x198: 0xb105, // align + 0x199: 0x1e507, // section + 0x19b: 0x6e05, // embed + 0x19d: 0x15e07, // bgsound + 0x1a2: 0x49d04, // list + 0x1a3: 0x61e08, // onseeked + 0x1a4: 0x66009, // onstorage + 0x1a5: 0x2f603, // img + 0x1a6: 0xf505, // tfoot + 0x1a9: 0x26913, // onautocompleteerror + 0x1aa: 0x5fd19, // onsecuritypolicyviolation + 0x1ad: 0x9303, // dir + 0x1ae: 0x9307, // dirname + 0x1b0: 0x5a70a, // onprogress + 0x1b2: 0x65709, // onstalled + 0x1b5: 0x66f09, // itemscope + 0x1b6: 0x49904, // data + 0x1b7: 0x3d90b, // ondragleave + 0x1b8: 0x56102, // h2 + 0x1b9: 0x2f706, // mglyph + 0x1ba: 0x16502, // is + 0x1bb: 0x6e50e, // onbeforeunload + 0x1bc: 0x2830d, // typemustmatch + 0x1bd: 0x3ab06, // ondrag + 0x1be: 0x5da07, // onreset + 0x1c0: 0x51106, // output + 0x1c1: 0x12907, // sandbox + 0x1c2: 0x1b209, // plaintext + 0x1c4: 0x34c08, // textarea + 0x1c7: 0xd607, // keytype + 0x1c8: 0x34b05, // mtext + 0x1c9: 0x6b10e, // onvolumechange + 0x1ca: 0x1ea06, // onblur + 0x1cb: 0x58a07, // onpause + 0x1cd: 0x5bc0c, // onratechange + 0x1ce: 0x10705, // aside + 0x1cf: 0x6cf07, // optimum + 0x1d1: 0x45809, // onkeydown + 0x1d2: 0x1c407, // colspan + 0x1d3: 0x1004, // main + 0x1d4: 0x66b03, // sub + 0x1d5: 0x25b06, // object + 0x1d6: 0x55c06, // search + 0x1d7: 0x37206, // sorted + 0x1d8: 0x17003, // big + 0x1d9: 0xb01, // u + 0x1db: 0x26b0c, // autocomplete + 0x1dc: 0xcc02, // tr + 0x1dd: 0xf303, // alt + 0x1df: 0x7804, // samp + 0x1e0: 0x5c812, // onrejectionhandled + 0x1e1: 0x4f30c, // onmouseleave + 0x1e2: 0x28007, // enctype + 0x1e3: 0xa208, // nomodule + 0x1e5: 0x3280f, // allowfullscreen + 0x1e6: 0x5f08, // optgroup + 0x1e8: 0x27c0b, // formenctype + 0x1e9: 0x18106, // legend + 0x1ea: 0x10306, // canvas + 0x1eb: 0x6607, // pattern + 0x1ec: 0x2c208, // noscript + 0x1ed: 0x601, // i + 0x1ee: 0x5d602, // dl + 0x1ef: 0xa702, // ul + 0x1f2: 0x52209, // onmouseup + 0x1f4: 0x1ba05, // track + 0x1f7: 0x3a10a, // ondblclick + 0x1f8: 0x3bf0a, // ondragexit + 0x1fa: 0x8703, // dfn + 0x1fc: 0x26506, // action + 0x1fd: 0x35004, // area + 0x1fe: 0x31607, // marquee + 0x1ff: 0x16d03, // var +} + +const atomText = "abbradiogrouparamainavalueaccept-charsetbodyaccesskeygenobrb" + + "asefontimeupdateviacacheightmlabelooptgroupatternoembedetail" + + "sampictureversedfnoframesetdirnameterowspanomoduleacronymali" + + "gnmarkbdialogallowpaymentrequestrikeytypeallowusermediagroup" + + "ingaltfooterubyasyncanvasidefaultitleaudioncancelautofocusan" + + "dboxmplaceholderautoplaysinlinebdoncanplaythrough1bgsoundisa" + + "bledivarbigblinkindraggablegendblockquotebuttonabortcitempro" + + "penoncecolgrouplaintextrackcolorcolspannotation-xmlcommandco" + + "ntrolsectionblurcoordshapecrossoriginslotranslatefacenterfie" + + "ldsetfigcaptionafterprintegrityfigurequiredforeignObjectfore" + + "ignobjectformactionautocompleteerrorformenctypemustmatchalle" + + "ngeformmethodformnovalidatetimeformtargethiddenoscripthigh3h" + + "reflanghttp-equivideonclickiframeimageimglyph4isindexismappl" + + "etitemtypemarqueematheadersmallowfullscreenmaxlength5minleng" + + "th6mtextareadonlymultiplemutedoncloseamlessortedoncontextmen" + + "uitemidoncopyoncuechangeoncutondblclickondragendondragentero" + + "ndragexitemreferrerpolicyondragleaveondragoverondragstarticl" + + "eondropzonemptiedondurationchangeonendedonerroronfocusourceo" + + "nhashchangeoninputmodeloninvalidonkeydownloadonkeypresspacer" + + "onkeyupreloadonlanguagechangeonloadeddatalistingonloadedmeta" + + "databindexonloadendonloadstartonmessageerroronmousedownonmou" + + "seenteronmouseleaveonmousemoveonmouseoutputonmouseoveronmous" + + "eupromptonmousewheelonofflineononlineonpagehidesclassearch2o" + + "npageshowbronpastepublicontenteditableonpausemaponplayingonp" + + "opstateonprogresspellcheckedonratechangeonrejectionhandledon" + + "resetonresizesrcdocodeferonscrollonsecuritypolicyviolationau" + + "xclickonseekedonseekingonselectedonshowidthgrouposteronsorta" + + "bleonstalledonstorageonsubmitemscopedonsuspendontoggleonunha" + + "ndledrejectionbeforeprintonunloadonvolumechangeonwaitingonwh" + + "eeloptimumanifestrongoptionbeforeunloaddressrclangsrcsetstyl" + + "esummarysupsvgsystemplateworkertypewrap" diff --git a/vendor/golang.org/x/net/html/const.go b/vendor/golang.org/x/net/html/const.go new file mode 100644 index 00000000..ff7acf2d --- /dev/null +++ b/vendor/golang.org/x/net/html/const.go @@ -0,0 +1,111 @@ +// Copyright 2011 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package html + +// Section 12.2.4.2 of the HTML5 specification says "The following elements +// have varying levels of special parsing rules". +// https://html.spec.whatwg.org/multipage/syntax.html#the-stack-of-open-elements +var isSpecialElementMap = map[string]bool{ + "address": true, + "applet": true, + "area": true, + "article": true, + "aside": true, + "base": true, + "basefont": true, + "bgsound": true, + "blockquote": true, + "body": true, + "br": true, + "button": true, + "caption": true, + "center": true, + "col": true, + "colgroup": true, + "dd": true, + "details": true, + "dir": true, + "div": true, + "dl": true, + "dt": true, + "embed": true, + "fieldset": true, + "figcaption": true, + "figure": true, + "footer": true, + "form": true, + "frame": true, + "frameset": true, + "h1": true, + "h2": true, + "h3": true, + "h4": true, + "h5": true, + "h6": true, + "head": true, + "header": true, + "hgroup": true, + "hr": true, + "html": true, + "iframe": true, + "img": true, + "input": true, + "keygen": true, // "keygen" has been removed from the spec, but are kept here for backwards compatibility. + "li": true, + "link": true, + "listing": true, + "main": true, + "marquee": true, + "menu": true, + "meta": true, + "nav": true, + "noembed": true, + "noframes": true, + "noscript": true, + "object": true, + "ol": true, + "p": true, + "param": true, + "plaintext": true, + "pre": true, + "script": true, + "section": true, + "select": true, + "source": true, + "style": true, + "summary": true, + "table": true, + "tbody": true, + "td": true, + "template": true, + "textarea": true, + "tfoot": true, + "th": true, + "thead": true, + "title": true, + "tr": true, + "track": true, + "ul": true, + "wbr": true, + "xmp": true, +} + +func isSpecialElement(element *Node) bool { + switch element.Namespace { + case "", "html": + return isSpecialElementMap[element.Data] + case "math": + switch element.Data { + case "mi", "mo", "mn", "ms", "mtext", "annotation-xml": + return true + } + case "svg": + switch element.Data { + case "foreignObject", "desc", "title": + return true + } + } + return false +} diff --git a/vendor/golang.org/x/net/html/doc.go b/vendor/golang.org/x/net/html/doc.go new file mode 100644 index 00000000..885c4c59 --- /dev/null +++ b/vendor/golang.org/x/net/html/doc.go @@ -0,0 +1,122 @@ +// Copyright 2010 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +/* +Package html implements an HTML5-compliant tokenizer and parser. + +Tokenization is done by creating a Tokenizer for an io.Reader r. It is the +caller's responsibility to ensure that r provides UTF-8 encoded HTML. + + z := html.NewTokenizer(r) + +Given a Tokenizer z, the HTML is tokenized by repeatedly calling z.Next(), +which parses the next token and returns its type, or an error: + + for { + tt := z.Next() + if tt == html.ErrorToken { + // ... + return ... + } + // Process the current token. + } + +There are two APIs for retrieving the current token. The high-level API is to +call Token; the low-level API is to call Text or TagName / TagAttr. Both APIs +allow optionally calling Raw after Next but before Token, Text, TagName, or +TagAttr. In EBNF notation, the valid call sequence per token is: + + Next {Raw} [ Token | Text | TagName {TagAttr} ] + +Token returns an independent data structure that completely describes a token. +Entities (such as "<") are unescaped, tag names and attribute keys are +lower-cased, and attributes are collected into a []Attribute. For example: + + for { + if z.Next() == html.ErrorToken { + // Returning io.EOF indicates success. + return z.Err() + } + emitToken(z.Token()) + } + +The low-level API performs fewer allocations and copies, but the contents of +the []byte values returned by Text, TagName and TagAttr may change on the next +call to Next. For example, to extract an HTML page's anchor text: + + depth := 0 + for { + tt := z.Next() + switch tt { + case html.ErrorToken: + return z.Err() + case html.TextToken: + if depth > 0 { + // emitBytes should copy the []byte it receives, + // if it doesn't process it immediately. + emitBytes(z.Text()) + } + case html.StartTagToken, html.EndTagToken: + tn, _ := z.TagName() + if len(tn) == 1 && tn[0] == 'a' { + if tt == html.StartTagToken { + depth++ + } else { + depth-- + } + } + } + } + +Parsing is done by calling Parse with an io.Reader, which returns the root of +the parse tree (the document element) as a *Node. It is the caller's +responsibility to ensure that the Reader provides UTF-8 encoded HTML. For +example, to process each anchor node in depth-first order: + + doc, err := html.Parse(r) + if err != nil { + // ... + } + for n := range doc.Descendants() { + if n.Type == html.ElementNode && n.Data == "a" { + // Do something with n... + } + } + +The relevant specifications include: +https://html.spec.whatwg.org/multipage/syntax.html and +https://html.spec.whatwg.org/multipage/syntax.html#tokenization + +# Security Considerations + +Care should be taken when parsing and interpreting HTML, whether full documents +or fragments, within the framework of the HTML specification, especially with +regard to untrusted inputs. + +This package provides both a tokenizer and a parser, which implement the +tokenization, and tokenization and tree construction stages of the WHATWG HTML +parsing specification respectively. While the tokenizer parses and normalizes +individual HTML tokens, only the parser constructs the DOM tree from the +tokenized HTML, as described in the tree construction stage of the +specification, dynamically modifying or extending the document's DOM tree. + +If your use case requires semantically well-formed HTML documents, as defined by +the WHATWG specification, the parser should be used rather than the tokenizer. + +In security contexts, if trust decisions are being made using the tokenized or +parsed content, the input must be re-serialized (for instance by using Render or +Token.String) in order for those trust decisions to hold, as the process of +tokenization or parsing may alter the content. +*/ +package html // import "golang.org/x/net/html" + +// The tokenization algorithm implemented by this package is not a line-by-line +// transliteration of the relatively verbose state-machine in the WHATWG +// specification. A more direct approach is used instead, where the program +// counter implies the state, such as whether it is tokenizing a tag or a text +// node. Specification compliance is verified by checking expected and actual +// outputs over a test suite rather than aiming for algorithmic fidelity. + +// TODO(nigeltao): Does a DOM API belong in this package or a separate one? +// TODO(nigeltao): How does parsing interact with a JavaScript engine? diff --git a/vendor/golang.org/x/net/html/doctype.go b/vendor/golang.org/x/net/html/doctype.go new file mode 100644 index 00000000..bca3ae9a --- /dev/null +++ b/vendor/golang.org/x/net/html/doctype.go @@ -0,0 +1,156 @@ +// Copyright 2011 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package html + +import ( + "strings" +) + +// parseDoctype parses the data from a DoctypeToken into a name, +// public identifier, and system identifier. It returns a Node whose Type +// is DoctypeNode, whose Data is the name, and which has attributes +// named "system" and "public" for the two identifiers if they were present. +// quirks is whether the document should be parsed in "quirks mode". +func parseDoctype(s string) (n *Node, quirks bool) { + n = &Node{Type: DoctypeNode} + + // Find the name. + space := strings.IndexAny(s, whitespace) + if space == -1 { + space = len(s) + } + n.Data = s[:space] + // The comparison to "html" is case-sensitive. + if n.Data != "html" { + quirks = true + } + n.Data = strings.ToLower(n.Data) + s = strings.TrimLeft(s[space:], whitespace) + + if len(s) < 6 { + // It can't start with "PUBLIC" or "SYSTEM". + // Ignore the rest of the string. + return n, quirks || s != "" + } + + key := strings.ToLower(s[:6]) + s = s[6:] + for key == "public" || key == "system" { + s = strings.TrimLeft(s, whitespace) + if s == "" { + break + } + quote := s[0] + if quote != '"' && quote != '\'' { + break + } + s = s[1:] + q := strings.IndexRune(s, rune(quote)) + var id string + if q == -1 { + id = s + s = "" + } else { + id = s[:q] + s = s[q+1:] + } + n.Attr = append(n.Attr, Attribute{Key: key, Val: id}) + if key == "public" { + key = "system" + } else { + key = "" + } + } + + if key != "" || s != "" { + quirks = true + } else if len(n.Attr) > 0 { + if n.Attr[0].Key == "public" { + public := strings.ToLower(n.Attr[0].Val) + switch public { + case "-//w3o//dtd w3 html strict 3.0//en//", "-/w3d/dtd html 4.0 transitional/en", "html": + quirks = true + default: + for _, q := range quirkyIDs { + if strings.HasPrefix(public, q) { + quirks = true + break + } + } + } + // The following two public IDs only cause quirks mode if there is no system ID. + if len(n.Attr) == 1 && (strings.HasPrefix(public, "-//w3c//dtd html 4.01 frameset//") || + strings.HasPrefix(public, "-//w3c//dtd html 4.01 transitional//")) { + quirks = true + } + } + if lastAttr := n.Attr[len(n.Attr)-1]; lastAttr.Key == "system" && + strings.EqualFold(lastAttr.Val, "http://www.ibm.com/data/dtd/v11/ibmxhtml1-transitional.dtd") { + quirks = true + } + } + + return n, quirks +} + +// quirkyIDs is a list of public doctype identifiers that cause a document +// to be interpreted in quirks mode. The identifiers should be in lower case. +var quirkyIDs = []string{ + "+//silmaril//dtd html pro v0r11 19970101//", + "-//advasoft ltd//dtd html 3.0 aswedit + extensions//", + "-//as//dtd html 3.0 aswedit + extensions//", + "-//ietf//dtd html 2.0 level 1//", + "-//ietf//dtd html 2.0 level 2//", + "-//ietf//dtd html 2.0 strict level 1//", + "-//ietf//dtd html 2.0 strict level 2//", + "-//ietf//dtd html 2.0 strict//", + "-//ietf//dtd html 2.0//", + "-//ietf//dtd html 2.1e//", + "-//ietf//dtd html 3.0//", + "-//ietf//dtd html 3.2 final//", + "-//ietf//dtd html 3.2//", + "-//ietf//dtd html 3//", + "-//ietf//dtd html level 0//", + "-//ietf//dtd html level 1//", + "-//ietf//dtd html level 2//", + "-//ietf//dtd html level 3//", + "-//ietf//dtd html strict level 0//", + "-//ietf//dtd html strict level 1//", + "-//ietf//dtd html strict level 2//", + "-//ietf//dtd html strict level 3//", + "-//ietf//dtd html strict//", + "-//ietf//dtd html//", + "-//metrius//dtd metrius presentational//", + "-//microsoft//dtd internet explorer 2.0 html strict//", + "-//microsoft//dtd internet explorer 2.0 html//", + "-//microsoft//dtd internet explorer 2.0 tables//", + "-//microsoft//dtd internet explorer 3.0 html strict//", + "-//microsoft//dtd internet explorer 3.0 html//", + "-//microsoft//dtd internet explorer 3.0 tables//", + "-//netscape comm. corp.//dtd html//", + "-//netscape comm. corp.//dtd strict html//", + "-//o'reilly and associates//dtd html 2.0//", + "-//o'reilly and associates//dtd html extended 1.0//", + "-//o'reilly and associates//dtd html extended relaxed 1.0//", + "-//softquad software//dtd hotmetal pro 6.0::19990601::extensions to html 4.0//", + "-//softquad//dtd hotmetal pro 4.0::19971010::extensions to html 4.0//", + "-//spyglass//dtd html 2.0 extended//", + "-//sq//dtd html 2.0 hotmetal + extensions//", + "-//sun microsystems corp.//dtd hotjava html//", + "-//sun microsystems corp.//dtd hotjava strict html//", + "-//w3c//dtd html 3 1995-03-24//", + "-//w3c//dtd html 3.2 draft//", + "-//w3c//dtd html 3.2 final//", + "-//w3c//dtd html 3.2//", + "-//w3c//dtd html 3.2s draft//", + "-//w3c//dtd html 4.0 frameset//", + "-//w3c//dtd html 4.0 transitional//", + "-//w3c//dtd html experimental 19960712//", + "-//w3c//dtd html experimental 970421//", + "-//w3c//dtd w3 html//", + "-//w3o//dtd w3 html 3.0//", + "-//webtechs//dtd mozilla html 2.0//", + "-//webtechs//dtd mozilla html//", +} diff --git a/vendor/golang.org/x/net/html/entity.go b/vendor/golang.org/x/net/html/entity.go new file mode 100644 index 00000000..b628880a --- /dev/null +++ b/vendor/golang.org/x/net/html/entity.go @@ -0,0 +1,2253 @@ +// Copyright 2010 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package html + +// All entities that do not end with ';' are 6 or fewer bytes long. +const longestEntityWithoutSemicolon = 6 + +// entity is a map from HTML entity names to their values. The semicolon matters: +// https://html.spec.whatwg.org/multipage/syntax.html#named-character-references +// lists both "amp" and "amp;" as two separate entries. +// +// Note that the HTML5 list is larger than the HTML4 list at +// http://www.w3.org/TR/html4/sgml/entities.html +var entity = map[string]rune{ + "AElig;": '\U000000C6', + "AMP;": '\U00000026', + "Aacute;": '\U000000C1', + "Abreve;": '\U00000102', + "Acirc;": '\U000000C2', + "Acy;": '\U00000410', + "Afr;": '\U0001D504', + "Agrave;": '\U000000C0', + "Alpha;": '\U00000391', + "Amacr;": '\U00000100', + "And;": '\U00002A53', + "Aogon;": '\U00000104', + "Aopf;": '\U0001D538', + "ApplyFunction;": '\U00002061', + "Aring;": '\U000000C5', + "Ascr;": '\U0001D49C', + "Assign;": '\U00002254', + "Atilde;": '\U000000C3', + "Auml;": '\U000000C4', + "Backslash;": '\U00002216', + "Barv;": '\U00002AE7', + "Barwed;": '\U00002306', + "Bcy;": '\U00000411', + "Because;": '\U00002235', + "Bernoullis;": '\U0000212C', + "Beta;": '\U00000392', + "Bfr;": '\U0001D505', + "Bopf;": '\U0001D539', + "Breve;": '\U000002D8', + "Bscr;": '\U0000212C', + "Bumpeq;": '\U0000224E', + "CHcy;": '\U00000427', + "COPY;": '\U000000A9', + "Cacute;": '\U00000106', + "Cap;": '\U000022D2', + "CapitalDifferentialD;": '\U00002145', + "Cayleys;": '\U0000212D', + "Ccaron;": '\U0000010C', + "Ccedil;": '\U000000C7', + "Ccirc;": '\U00000108', + "Cconint;": '\U00002230', + "Cdot;": '\U0000010A', + "Cedilla;": '\U000000B8', + "CenterDot;": '\U000000B7', + "Cfr;": '\U0000212D', + "Chi;": '\U000003A7', + "CircleDot;": '\U00002299', + "CircleMinus;": '\U00002296', + "CirclePlus;": '\U00002295', + "CircleTimes;": '\U00002297', + "ClockwiseContourIntegral;": '\U00002232', + "CloseCurlyDoubleQuote;": '\U0000201D', + "CloseCurlyQuote;": '\U00002019', + "Colon;": '\U00002237', + "Colone;": '\U00002A74', + "Congruent;": '\U00002261', + "Conint;": '\U0000222F', + "ContourIntegral;": '\U0000222E', + "Copf;": '\U00002102', + "Coproduct;": '\U00002210', + "CounterClockwiseContourIntegral;": '\U00002233', + "Cross;": '\U00002A2F', + "Cscr;": '\U0001D49E', + "Cup;": '\U000022D3', + "CupCap;": '\U0000224D', + "DD;": '\U00002145', + "DDotrahd;": '\U00002911', + "DJcy;": '\U00000402', + "DScy;": '\U00000405', + "DZcy;": '\U0000040F', + "Dagger;": '\U00002021', + "Darr;": '\U000021A1', + "Dashv;": '\U00002AE4', + "Dcaron;": '\U0000010E', + "Dcy;": '\U00000414', + "Del;": '\U00002207', + "Delta;": '\U00000394', + "Dfr;": '\U0001D507', + "DiacriticalAcute;": '\U000000B4', + "DiacriticalDot;": '\U000002D9', + "DiacriticalDoubleAcute;": '\U000002DD', + "DiacriticalGrave;": '\U00000060', + "DiacriticalTilde;": '\U000002DC', + "Diamond;": '\U000022C4', + "DifferentialD;": '\U00002146', + "Dopf;": '\U0001D53B', + "Dot;": '\U000000A8', + "DotDot;": '\U000020DC', + "DotEqual;": '\U00002250', + "DoubleContourIntegral;": '\U0000222F', + "DoubleDot;": '\U000000A8', + "DoubleDownArrow;": '\U000021D3', + "DoubleLeftArrow;": '\U000021D0', + "DoubleLeftRightArrow;": '\U000021D4', + "DoubleLeftTee;": '\U00002AE4', + "DoubleLongLeftArrow;": '\U000027F8', + "DoubleLongLeftRightArrow;": '\U000027FA', + "DoubleLongRightArrow;": '\U000027F9', + "DoubleRightArrow;": '\U000021D2', + "DoubleRightTee;": '\U000022A8', + "DoubleUpArrow;": '\U000021D1', + "DoubleUpDownArrow;": '\U000021D5', + "DoubleVerticalBar;": '\U00002225', + "DownArrow;": '\U00002193', + "DownArrowBar;": '\U00002913', + "DownArrowUpArrow;": '\U000021F5', + "DownBreve;": '\U00000311', + "DownLeftRightVector;": '\U00002950', + "DownLeftTeeVector;": '\U0000295E', + "DownLeftVector;": '\U000021BD', + "DownLeftVectorBar;": '\U00002956', + "DownRightTeeVector;": '\U0000295F', + "DownRightVector;": '\U000021C1', + "DownRightVectorBar;": '\U00002957', + "DownTee;": '\U000022A4', + "DownTeeArrow;": '\U000021A7', + "Downarrow;": '\U000021D3', + "Dscr;": '\U0001D49F', + "Dstrok;": '\U00000110', + "ENG;": '\U0000014A', + "ETH;": '\U000000D0', + "Eacute;": '\U000000C9', + "Ecaron;": '\U0000011A', + "Ecirc;": '\U000000CA', + "Ecy;": '\U0000042D', + "Edot;": '\U00000116', + "Efr;": '\U0001D508', + "Egrave;": '\U000000C8', + "Element;": '\U00002208', + "Emacr;": '\U00000112', + "EmptySmallSquare;": '\U000025FB', + "EmptyVerySmallSquare;": '\U000025AB', + "Eogon;": '\U00000118', + "Eopf;": '\U0001D53C', + "Epsilon;": '\U00000395', + "Equal;": '\U00002A75', + "EqualTilde;": '\U00002242', + "Equilibrium;": '\U000021CC', + "Escr;": '\U00002130', + "Esim;": '\U00002A73', + "Eta;": '\U00000397', + "Euml;": '\U000000CB', + "Exists;": '\U00002203', + "ExponentialE;": '\U00002147', + "Fcy;": '\U00000424', + "Ffr;": '\U0001D509', + "FilledSmallSquare;": '\U000025FC', + "FilledVerySmallSquare;": '\U000025AA', + "Fopf;": '\U0001D53D', + "ForAll;": '\U00002200', + "Fouriertrf;": '\U00002131', + "Fscr;": '\U00002131', + "GJcy;": '\U00000403', + "GT;": '\U0000003E', + "Gamma;": '\U00000393', + "Gammad;": '\U000003DC', + "Gbreve;": '\U0000011E', + "Gcedil;": '\U00000122', + "Gcirc;": '\U0000011C', + "Gcy;": '\U00000413', + "Gdot;": '\U00000120', + "Gfr;": '\U0001D50A', + "Gg;": '\U000022D9', + "Gopf;": '\U0001D53E', + "GreaterEqual;": '\U00002265', + "GreaterEqualLess;": '\U000022DB', + "GreaterFullEqual;": '\U00002267', + "GreaterGreater;": '\U00002AA2', + "GreaterLess;": '\U00002277', + "GreaterSlantEqual;": '\U00002A7E', + "GreaterTilde;": '\U00002273', + "Gscr;": '\U0001D4A2', + "Gt;": '\U0000226B', + "HARDcy;": '\U0000042A', + "Hacek;": '\U000002C7', + "Hat;": '\U0000005E', + "Hcirc;": '\U00000124', + "Hfr;": '\U0000210C', + "HilbertSpace;": '\U0000210B', + "Hopf;": '\U0000210D', + "HorizontalLine;": '\U00002500', + "Hscr;": '\U0000210B', + "Hstrok;": '\U00000126', + "HumpDownHump;": '\U0000224E', + "HumpEqual;": '\U0000224F', + "IEcy;": '\U00000415', + "IJlig;": '\U00000132', + "IOcy;": '\U00000401', + "Iacute;": '\U000000CD', + "Icirc;": '\U000000CE', + "Icy;": '\U00000418', + "Idot;": '\U00000130', + "Ifr;": '\U00002111', + "Igrave;": '\U000000CC', + "Im;": '\U00002111', + "Imacr;": '\U0000012A', + "ImaginaryI;": '\U00002148', + "Implies;": '\U000021D2', + "Int;": '\U0000222C', + "Integral;": '\U0000222B', + "Intersection;": '\U000022C2', + "InvisibleComma;": '\U00002063', + "InvisibleTimes;": '\U00002062', + "Iogon;": '\U0000012E', + "Iopf;": '\U0001D540', + "Iota;": '\U00000399', + "Iscr;": '\U00002110', + "Itilde;": '\U00000128', + "Iukcy;": '\U00000406', + "Iuml;": '\U000000CF', + "Jcirc;": '\U00000134', + "Jcy;": '\U00000419', + "Jfr;": '\U0001D50D', + "Jopf;": '\U0001D541', + "Jscr;": '\U0001D4A5', + "Jsercy;": '\U00000408', + "Jukcy;": '\U00000404', + "KHcy;": '\U00000425', + "KJcy;": '\U0000040C', + "Kappa;": '\U0000039A', + "Kcedil;": '\U00000136', + "Kcy;": '\U0000041A', + "Kfr;": '\U0001D50E', + "Kopf;": '\U0001D542', + "Kscr;": '\U0001D4A6', + "LJcy;": '\U00000409', + "LT;": '\U0000003C', + "Lacute;": '\U00000139', + "Lambda;": '\U0000039B', + "Lang;": '\U000027EA', + "Laplacetrf;": '\U00002112', + "Larr;": '\U0000219E', + "Lcaron;": '\U0000013D', + "Lcedil;": '\U0000013B', + "Lcy;": '\U0000041B', + "LeftAngleBracket;": '\U000027E8', + "LeftArrow;": '\U00002190', + "LeftArrowBar;": '\U000021E4', + "LeftArrowRightArrow;": '\U000021C6', + "LeftCeiling;": '\U00002308', + "LeftDoubleBracket;": '\U000027E6', + "LeftDownTeeVector;": '\U00002961', + "LeftDownVector;": '\U000021C3', + "LeftDownVectorBar;": '\U00002959', + "LeftFloor;": '\U0000230A', + "LeftRightArrow;": '\U00002194', + "LeftRightVector;": '\U0000294E', + "LeftTee;": '\U000022A3', + "LeftTeeArrow;": '\U000021A4', + "LeftTeeVector;": '\U0000295A', + "LeftTriangle;": '\U000022B2', + "LeftTriangleBar;": '\U000029CF', + "LeftTriangleEqual;": '\U000022B4', + "LeftUpDownVector;": '\U00002951', + "LeftUpTeeVector;": '\U00002960', + "LeftUpVector;": '\U000021BF', + "LeftUpVectorBar;": '\U00002958', + "LeftVector;": '\U000021BC', + "LeftVectorBar;": '\U00002952', + "Leftarrow;": '\U000021D0', + "Leftrightarrow;": '\U000021D4', + "LessEqualGreater;": '\U000022DA', + "LessFullEqual;": '\U00002266', + "LessGreater;": '\U00002276', + "LessLess;": '\U00002AA1', + "LessSlantEqual;": '\U00002A7D', + "LessTilde;": '\U00002272', + "Lfr;": '\U0001D50F', + "Ll;": '\U000022D8', + "Lleftarrow;": '\U000021DA', + "Lmidot;": '\U0000013F', + "LongLeftArrow;": '\U000027F5', + "LongLeftRightArrow;": '\U000027F7', + "LongRightArrow;": '\U000027F6', + "Longleftarrow;": '\U000027F8', + "Longleftrightarrow;": '\U000027FA', + "Longrightarrow;": '\U000027F9', + "Lopf;": '\U0001D543', + "LowerLeftArrow;": '\U00002199', + "LowerRightArrow;": '\U00002198', + "Lscr;": '\U00002112', + "Lsh;": '\U000021B0', + "Lstrok;": '\U00000141', + "Lt;": '\U0000226A', + "Map;": '\U00002905', + "Mcy;": '\U0000041C', + "MediumSpace;": '\U0000205F', + "Mellintrf;": '\U00002133', + "Mfr;": '\U0001D510', + "MinusPlus;": '\U00002213', + "Mopf;": '\U0001D544', + "Mscr;": '\U00002133', + "Mu;": '\U0000039C', + "NJcy;": '\U0000040A', + "Nacute;": '\U00000143', + "Ncaron;": '\U00000147', + "Ncedil;": '\U00000145', + "Ncy;": '\U0000041D', + "NegativeMediumSpace;": '\U0000200B', + "NegativeThickSpace;": '\U0000200B', + "NegativeThinSpace;": '\U0000200B', + "NegativeVeryThinSpace;": '\U0000200B', + "NestedGreaterGreater;": '\U0000226B', + "NestedLessLess;": '\U0000226A', + "NewLine;": '\U0000000A', + "Nfr;": '\U0001D511', + "NoBreak;": '\U00002060', + "NonBreakingSpace;": '\U000000A0', + "Nopf;": '\U00002115', + "Not;": '\U00002AEC', + "NotCongruent;": '\U00002262', + "NotCupCap;": '\U0000226D', + "NotDoubleVerticalBar;": '\U00002226', + "NotElement;": '\U00002209', + "NotEqual;": '\U00002260', + "NotExists;": '\U00002204', + "NotGreater;": '\U0000226F', + "NotGreaterEqual;": '\U00002271', + "NotGreaterLess;": '\U00002279', + "NotGreaterTilde;": '\U00002275', + "NotLeftTriangle;": '\U000022EA', + "NotLeftTriangleEqual;": '\U000022EC', + "NotLess;": '\U0000226E', + "NotLessEqual;": '\U00002270', + "NotLessGreater;": '\U00002278', + "NotLessTilde;": '\U00002274', + "NotPrecedes;": '\U00002280', + "NotPrecedesSlantEqual;": '\U000022E0', + "NotReverseElement;": '\U0000220C', + "NotRightTriangle;": '\U000022EB', + "NotRightTriangleEqual;": '\U000022ED', + "NotSquareSubsetEqual;": '\U000022E2', + "NotSquareSupersetEqual;": '\U000022E3', + "NotSubsetEqual;": '\U00002288', + "NotSucceeds;": '\U00002281', + "NotSucceedsSlantEqual;": '\U000022E1', + "NotSupersetEqual;": '\U00002289', + "NotTilde;": '\U00002241', + "NotTildeEqual;": '\U00002244', + "NotTildeFullEqual;": '\U00002247', + "NotTildeTilde;": '\U00002249', + "NotVerticalBar;": '\U00002224', + "Nscr;": '\U0001D4A9', + "Ntilde;": '\U000000D1', + "Nu;": '\U0000039D', + "OElig;": '\U00000152', + "Oacute;": '\U000000D3', + "Ocirc;": '\U000000D4', + "Ocy;": '\U0000041E', + "Odblac;": '\U00000150', + "Ofr;": '\U0001D512', + "Ograve;": '\U000000D2', + "Omacr;": '\U0000014C', + "Omega;": '\U000003A9', + "Omicron;": '\U0000039F', + "Oopf;": '\U0001D546', + "OpenCurlyDoubleQuote;": '\U0000201C', + "OpenCurlyQuote;": '\U00002018', + "Or;": '\U00002A54', + "Oscr;": '\U0001D4AA', + "Oslash;": '\U000000D8', + "Otilde;": '\U000000D5', + "Otimes;": '\U00002A37', + "Ouml;": '\U000000D6', + "OverBar;": '\U0000203E', + "OverBrace;": '\U000023DE', + "OverBracket;": '\U000023B4', + "OverParenthesis;": '\U000023DC', + "PartialD;": '\U00002202', + "Pcy;": '\U0000041F', + "Pfr;": '\U0001D513', + "Phi;": '\U000003A6', + "Pi;": '\U000003A0', + "PlusMinus;": '\U000000B1', + "Poincareplane;": '\U0000210C', + "Popf;": '\U00002119', + "Pr;": '\U00002ABB', + "Precedes;": '\U0000227A', + "PrecedesEqual;": '\U00002AAF', + "PrecedesSlantEqual;": '\U0000227C', + "PrecedesTilde;": '\U0000227E', + "Prime;": '\U00002033', + "Product;": '\U0000220F', + "Proportion;": '\U00002237', + "Proportional;": '\U0000221D', + "Pscr;": '\U0001D4AB', + "Psi;": '\U000003A8', + "QUOT;": '\U00000022', + "Qfr;": '\U0001D514', + "Qopf;": '\U0000211A', + "Qscr;": '\U0001D4AC', + "RBarr;": '\U00002910', + "REG;": '\U000000AE', + "Racute;": '\U00000154', + "Rang;": '\U000027EB', + "Rarr;": '\U000021A0', + "Rarrtl;": '\U00002916', + "Rcaron;": '\U00000158', + "Rcedil;": '\U00000156', + "Rcy;": '\U00000420', + "Re;": '\U0000211C', + "ReverseElement;": '\U0000220B', + "ReverseEquilibrium;": '\U000021CB', + "ReverseUpEquilibrium;": '\U0000296F', + "Rfr;": '\U0000211C', + "Rho;": '\U000003A1', + "RightAngleBracket;": '\U000027E9', + "RightArrow;": '\U00002192', + "RightArrowBar;": '\U000021E5', + "RightArrowLeftArrow;": '\U000021C4', + "RightCeiling;": '\U00002309', + "RightDoubleBracket;": '\U000027E7', + "RightDownTeeVector;": '\U0000295D', + "RightDownVector;": '\U000021C2', + "RightDownVectorBar;": '\U00002955', + "RightFloor;": '\U0000230B', + "RightTee;": '\U000022A2', + "RightTeeArrow;": '\U000021A6', + "RightTeeVector;": '\U0000295B', + "RightTriangle;": '\U000022B3', + "RightTriangleBar;": '\U000029D0', + "RightTriangleEqual;": '\U000022B5', + "RightUpDownVector;": '\U0000294F', + "RightUpTeeVector;": '\U0000295C', + "RightUpVector;": '\U000021BE', + "RightUpVectorBar;": '\U00002954', + "RightVector;": '\U000021C0', + "RightVectorBar;": '\U00002953', + "Rightarrow;": '\U000021D2', + "Ropf;": '\U0000211D', + "RoundImplies;": '\U00002970', + "Rrightarrow;": '\U000021DB', + "Rscr;": '\U0000211B', + "Rsh;": '\U000021B1', + "RuleDelayed;": '\U000029F4', + "SHCHcy;": '\U00000429', + "SHcy;": '\U00000428', + "SOFTcy;": '\U0000042C', + "Sacute;": '\U0000015A', + "Sc;": '\U00002ABC', + "Scaron;": '\U00000160', + "Scedil;": '\U0000015E', + "Scirc;": '\U0000015C', + "Scy;": '\U00000421', + "Sfr;": '\U0001D516', + "ShortDownArrow;": '\U00002193', + "ShortLeftArrow;": '\U00002190', + "ShortRightArrow;": '\U00002192', + "ShortUpArrow;": '\U00002191', + "Sigma;": '\U000003A3', + "SmallCircle;": '\U00002218', + "Sopf;": '\U0001D54A', + "Sqrt;": '\U0000221A', + "Square;": '\U000025A1', + "SquareIntersection;": '\U00002293', + "SquareSubset;": '\U0000228F', + "SquareSubsetEqual;": '\U00002291', + "SquareSuperset;": '\U00002290', + "SquareSupersetEqual;": '\U00002292', + "SquareUnion;": '\U00002294', + "Sscr;": '\U0001D4AE', + "Star;": '\U000022C6', + "Sub;": '\U000022D0', + "Subset;": '\U000022D0', + "SubsetEqual;": '\U00002286', + "Succeeds;": '\U0000227B', + "SucceedsEqual;": '\U00002AB0', + "SucceedsSlantEqual;": '\U0000227D', + "SucceedsTilde;": '\U0000227F', + "SuchThat;": '\U0000220B', + "Sum;": '\U00002211', + "Sup;": '\U000022D1', + "Superset;": '\U00002283', + "SupersetEqual;": '\U00002287', + "Supset;": '\U000022D1', + "THORN;": '\U000000DE', + "TRADE;": '\U00002122', + "TSHcy;": '\U0000040B', + "TScy;": '\U00000426', + "Tab;": '\U00000009', + "Tau;": '\U000003A4', + "Tcaron;": '\U00000164', + "Tcedil;": '\U00000162', + "Tcy;": '\U00000422', + "Tfr;": '\U0001D517', + "Therefore;": '\U00002234', + "Theta;": '\U00000398', + "ThinSpace;": '\U00002009', + "Tilde;": '\U0000223C', + "TildeEqual;": '\U00002243', + "TildeFullEqual;": '\U00002245', + "TildeTilde;": '\U00002248', + "Topf;": '\U0001D54B', + "TripleDot;": '\U000020DB', + "Tscr;": '\U0001D4AF', + "Tstrok;": '\U00000166', + "Uacute;": '\U000000DA', + "Uarr;": '\U0000219F', + "Uarrocir;": '\U00002949', + "Ubrcy;": '\U0000040E', + "Ubreve;": '\U0000016C', + "Ucirc;": '\U000000DB', + "Ucy;": '\U00000423', + "Udblac;": '\U00000170', + "Ufr;": '\U0001D518', + "Ugrave;": '\U000000D9', + "Umacr;": '\U0000016A', + "UnderBar;": '\U0000005F', + "UnderBrace;": '\U000023DF', + "UnderBracket;": '\U000023B5', + "UnderParenthesis;": '\U000023DD', + "Union;": '\U000022C3', + "UnionPlus;": '\U0000228E', + "Uogon;": '\U00000172', + "Uopf;": '\U0001D54C', + "UpArrow;": '\U00002191', + "UpArrowBar;": '\U00002912', + "UpArrowDownArrow;": '\U000021C5', + "UpDownArrow;": '\U00002195', + "UpEquilibrium;": '\U0000296E', + "UpTee;": '\U000022A5', + "UpTeeArrow;": '\U000021A5', + "Uparrow;": '\U000021D1', + "Updownarrow;": '\U000021D5', + "UpperLeftArrow;": '\U00002196', + "UpperRightArrow;": '\U00002197', + "Upsi;": '\U000003D2', + "Upsilon;": '\U000003A5', + "Uring;": '\U0000016E', + "Uscr;": '\U0001D4B0', + "Utilde;": '\U00000168', + "Uuml;": '\U000000DC', + "VDash;": '\U000022AB', + "Vbar;": '\U00002AEB', + "Vcy;": '\U00000412', + "Vdash;": '\U000022A9', + "Vdashl;": '\U00002AE6', + "Vee;": '\U000022C1', + "Verbar;": '\U00002016', + "Vert;": '\U00002016', + "VerticalBar;": '\U00002223', + "VerticalLine;": '\U0000007C', + "VerticalSeparator;": '\U00002758', + "VerticalTilde;": '\U00002240', + "VeryThinSpace;": '\U0000200A', + "Vfr;": '\U0001D519', + "Vopf;": '\U0001D54D', + "Vscr;": '\U0001D4B1', + "Vvdash;": '\U000022AA', + "Wcirc;": '\U00000174', + "Wedge;": '\U000022C0', + "Wfr;": '\U0001D51A', + "Wopf;": '\U0001D54E', + "Wscr;": '\U0001D4B2', + "Xfr;": '\U0001D51B', + "Xi;": '\U0000039E', + "Xopf;": '\U0001D54F', + "Xscr;": '\U0001D4B3', + "YAcy;": '\U0000042F', + "YIcy;": '\U00000407', + "YUcy;": '\U0000042E', + "Yacute;": '\U000000DD', + "Ycirc;": '\U00000176', + "Ycy;": '\U0000042B', + "Yfr;": '\U0001D51C', + "Yopf;": '\U0001D550', + "Yscr;": '\U0001D4B4', + "Yuml;": '\U00000178', + "ZHcy;": '\U00000416', + "Zacute;": '\U00000179', + "Zcaron;": '\U0000017D', + "Zcy;": '\U00000417', + "Zdot;": '\U0000017B', + "ZeroWidthSpace;": '\U0000200B', + "Zeta;": '\U00000396', + "Zfr;": '\U00002128', + "Zopf;": '\U00002124', + "Zscr;": '\U0001D4B5', + "aacute;": '\U000000E1', + "abreve;": '\U00000103', + "ac;": '\U0000223E', + "acd;": '\U0000223F', + "acirc;": '\U000000E2', + "acute;": '\U000000B4', + "acy;": '\U00000430', + "aelig;": '\U000000E6', + "af;": '\U00002061', + "afr;": '\U0001D51E', + "agrave;": '\U000000E0', + "alefsym;": '\U00002135', + "aleph;": '\U00002135', + "alpha;": '\U000003B1', + "amacr;": '\U00000101', + "amalg;": '\U00002A3F', + "amp;": '\U00000026', + "and;": '\U00002227', + "andand;": '\U00002A55', + "andd;": '\U00002A5C', + "andslope;": '\U00002A58', + "andv;": '\U00002A5A', + "ang;": '\U00002220', + "ange;": '\U000029A4', + "angle;": '\U00002220', + "angmsd;": '\U00002221', + "angmsdaa;": '\U000029A8', + "angmsdab;": '\U000029A9', + "angmsdac;": '\U000029AA', + "angmsdad;": '\U000029AB', + "angmsdae;": '\U000029AC', + "angmsdaf;": '\U000029AD', + "angmsdag;": '\U000029AE', + "angmsdah;": '\U000029AF', + "angrt;": '\U0000221F', + "angrtvb;": '\U000022BE', + "angrtvbd;": '\U0000299D', + "angsph;": '\U00002222', + "angst;": '\U000000C5', + "angzarr;": '\U0000237C', + "aogon;": '\U00000105', + "aopf;": '\U0001D552', + "ap;": '\U00002248', + "apE;": '\U00002A70', + "apacir;": '\U00002A6F', + "ape;": '\U0000224A', + "apid;": '\U0000224B', + "apos;": '\U00000027', + "approx;": '\U00002248', + "approxeq;": '\U0000224A', + "aring;": '\U000000E5', + "ascr;": '\U0001D4B6', + "ast;": '\U0000002A', + "asymp;": '\U00002248', + "asympeq;": '\U0000224D', + "atilde;": '\U000000E3', + "auml;": '\U000000E4', + "awconint;": '\U00002233', + "awint;": '\U00002A11', + "bNot;": '\U00002AED', + "backcong;": '\U0000224C', + "backepsilon;": '\U000003F6', + "backprime;": '\U00002035', + "backsim;": '\U0000223D', + "backsimeq;": '\U000022CD', + "barvee;": '\U000022BD', + "barwed;": '\U00002305', + "barwedge;": '\U00002305', + "bbrk;": '\U000023B5', + "bbrktbrk;": '\U000023B6', + "bcong;": '\U0000224C', + "bcy;": '\U00000431', + "bdquo;": '\U0000201E', + "becaus;": '\U00002235', + "because;": '\U00002235', + "bemptyv;": '\U000029B0', + "bepsi;": '\U000003F6', + "bernou;": '\U0000212C', + "beta;": '\U000003B2', + "beth;": '\U00002136', + "between;": '\U0000226C', + "bfr;": '\U0001D51F', + "bigcap;": '\U000022C2', + "bigcirc;": '\U000025EF', + "bigcup;": '\U000022C3', + "bigodot;": '\U00002A00', + "bigoplus;": '\U00002A01', + "bigotimes;": '\U00002A02', + "bigsqcup;": '\U00002A06', + "bigstar;": '\U00002605', + "bigtriangledown;": '\U000025BD', + "bigtriangleup;": '\U000025B3', + "biguplus;": '\U00002A04', + "bigvee;": '\U000022C1', + "bigwedge;": '\U000022C0', + "bkarow;": '\U0000290D', + "blacklozenge;": '\U000029EB', + "blacksquare;": '\U000025AA', + "blacktriangle;": '\U000025B4', + "blacktriangledown;": '\U000025BE', + "blacktriangleleft;": '\U000025C2', + "blacktriangleright;": '\U000025B8', + "blank;": '\U00002423', + "blk12;": '\U00002592', + "blk14;": '\U00002591', + "blk34;": '\U00002593', + "block;": '\U00002588', + "bnot;": '\U00002310', + "bopf;": '\U0001D553', + "bot;": '\U000022A5', + "bottom;": '\U000022A5', + "bowtie;": '\U000022C8', + "boxDL;": '\U00002557', + "boxDR;": '\U00002554', + "boxDl;": '\U00002556', + "boxDr;": '\U00002553', + "boxH;": '\U00002550', + "boxHD;": '\U00002566', + "boxHU;": '\U00002569', + "boxHd;": '\U00002564', + "boxHu;": '\U00002567', + "boxUL;": '\U0000255D', + "boxUR;": '\U0000255A', + "boxUl;": '\U0000255C', + "boxUr;": '\U00002559', + "boxV;": '\U00002551', + "boxVH;": '\U0000256C', + "boxVL;": '\U00002563', + "boxVR;": '\U00002560', + "boxVh;": '\U0000256B', + "boxVl;": '\U00002562', + "boxVr;": '\U0000255F', + "boxbox;": '\U000029C9', + "boxdL;": '\U00002555', + "boxdR;": '\U00002552', + "boxdl;": '\U00002510', + "boxdr;": '\U0000250C', + "boxh;": '\U00002500', + "boxhD;": '\U00002565', + "boxhU;": '\U00002568', + "boxhd;": '\U0000252C', + "boxhu;": '\U00002534', + "boxminus;": '\U0000229F', + "boxplus;": '\U0000229E', + "boxtimes;": '\U000022A0', + "boxuL;": '\U0000255B', + "boxuR;": '\U00002558', + "boxul;": '\U00002518', + "boxur;": '\U00002514', + "boxv;": '\U00002502', + "boxvH;": '\U0000256A', + "boxvL;": '\U00002561', + "boxvR;": '\U0000255E', + "boxvh;": '\U0000253C', + "boxvl;": '\U00002524', + "boxvr;": '\U0000251C', + "bprime;": '\U00002035', + "breve;": '\U000002D8', + "brvbar;": '\U000000A6', + "bscr;": '\U0001D4B7', + "bsemi;": '\U0000204F', + "bsim;": '\U0000223D', + "bsime;": '\U000022CD', + "bsol;": '\U0000005C', + "bsolb;": '\U000029C5', + "bsolhsub;": '\U000027C8', + "bull;": '\U00002022', + "bullet;": '\U00002022', + "bump;": '\U0000224E', + "bumpE;": '\U00002AAE', + "bumpe;": '\U0000224F', + "bumpeq;": '\U0000224F', + "cacute;": '\U00000107', + "cap;": '\U00002229', + "capand;": '\U00002A44', + "capbrcup;": '\U00002A49', + "capcap;": '\U00002A4B', + "capcup;": '\U00002A47', + "capdot;": '\U00002A40', + "caret;": '\U00002041', + "caron;": '\U000002C7', + "ccaps;": '\U00002A4D', + "ccaron;": '\U0000010D', + "ccedil;": '\U000000E7', + "ccirc;": '\U00000109', + "ccups;": '\U00002A4C', + "ccupssm;": '\U00002A50', + "cdot;": '\U0000010B', + "cedil;": '\U000000B8', + "cemptyv;": '\U000029B2', + "cent;": '\U000000A2', + "centerdot;": '\U000000B7', + "cfr;": '\U0001D520', + "chcy;": '\U00000447', + "check;": '\U00002713', + "checkmark;": '\U00002713', + "chi;": '\U000003C7', + "cir;": '\U000025CB', + "cirE;": '\U000029C3', + "circ;": '\U000002C6', + "circeq;": '\U00002257', + "circlearrowleft;": '\U000021BA', + "circlearrowright;": '\U000021BB', + "circledR;": '\U000000AE', + "circledS;": '\U000024C8', + "circledast;": '\U0000229B', + "circledcirc;": '\U0000229A', + "circleddash;": '\U0000229D', + "cire;": '\U00002257', + "cirfnint;": '\U00002A10', + "cirmid;": '\U00002AEF', + "cirscir;": '\U000029C2', + "clubs;": '\U00002663', + "clubsuit;": '\U00002663', + "colon;": '\U0000003A', + "colone;": '\U00002254', + "coloneq;": '\U00002254', + "comma;": '\U0000002C', + "commat;": '\U00000040', + "comp;": '\U00002201', + "compfn;": '\U00002218', + "complement;": '\U00002201', + "complexes;": '\U00002102', + "cong;": '\U00002245', + "congdot;": '\U00002A6D', + "conint;": '\U0000222E', + "copf;": '\U0001D554', + "coprod;": '\U00002210', + "copy;": '\U000000A9', + "copysr;": '\U00002117', + "crarr;": '\U000021B5', + "cross;": '\U00002717', + "cscr;": '\U0001D4B8', + "csub;": '\U00002ACF', + "csube;": '\U00002AD1', + "csup;": '\U00002AD0', + "csupe;": '\U00002AD2', + "ctdot;": '\U000022EF', + "cudarrl;": '\U00002938', + "cudarrr;": '\U00002935', + "cuepr;": '\U000022DE', + "cuesc;": '\U000022DF', + "cularr;": '\U000021B6', + "cularrp;": '\U0000293D', + "cup;": '\U0000222A', + "cupbrcap;": '\U00002A48', + "cupcap;": '\U00002A46', + "cupcup;": '\U00002A4A', + "cupdot;": '\U0000228D', + "cupor;": '\U00002A45', + "curarr;": '\U000021B7', + "curarrm;": '\U0000293C', + "curlyeqprec;": '\U000022DE', + "curlyeqsucc;": '\U000022DF', + "curlyvee;": '\U000022CE', + "curlywedge;": '\U000022CF', + "curren;": '\U000000A4', + "curvearrowleft;": '\U000021B6', + "curvearrowright;": '\U000021B7', + "cuvee;": '\U000022CE', + "cuwed;": '\U000022CF', + "cwconint;": '\U00002232', + "cwint;": '\U00002231', + "cylcty;": '\U0000232D', + "dArr;": '\U000021D3', + "dHar;": '\U00002965', + "dagger;": '\U00002020', + "daleth;": '\U00002138', + "darr;": '\U00002193', + "dash;": '\U00002010', + "dashv;": '\U000022A3', + "dbkarow;": '\U0000290F', + "dblac;": '\U000002DD', + "dcaron;": '\U0000010F', + "dcy;": '\U00000434', + "dd;": '\U00002146', + "ddagger;": '\U00002021', + "ddarr;": '\U000021CA', + "ddotseq;": '\U00002A77', + "deg;": '\U000000B0', + "delta;": '\U000003B4', + "demptyv;": '\U000029B1', + "dfisht;": '\U0000297F', + "dfr;": '\U0001D521', + "dharl;": '\U000021C3', + "dharr;": '\U000021C2', + "diam;": '\U000022C4', + "diamond;": '\U000022C4', + "diamondsuit;": '\U00002666', + "diams;": '\U00002666', + "die;": '\U000000A8', + "digamma;": '\U000003DD', + "disin;": '\U000022F2', + "div;": '\U000000F7', + "divide;": '\U000000F7', + "divideontimes;": '\U000022C7', + "divonx;": '\U000022C7', + "djcy;": '\U00000452', + "dlcorn;": '\U0000231E', + "dlcrop;": '\U0000230D', + "dollar;": '\U00000024', + "dopf;": '\U0001D555', + "dot;": '\U000002D9', + "doteq;": '\U00002250', + "doteqdot;": '\U00002251', + "dotminus;": '\U00002238', + "dotplus;": '\U00002214', + "dotsquare;": '\U000022A1', + "doublebarwedge;": '\U00002306', + "downarrow;": '\U00002193', + "downdownarrows;": '\U000021CA', + "downharpoonleft;": '\U000021C3', + "downharpoonright;": '\U000021C2', + "drbkarow;": '\U00002910', + "drcorn;": '\U0000231F', + "drcrop;": '\U0000230C', + "dscr;": '\U0001D4B9', + "dscy;": '\U00000455', + "dsol;": '\U000029F6', + "dstrok;": '\U00000111', + "dtdot;": '\U000022F1', + "dtri;": '\U000025BF', + "dtrif;": '\U000025BE', + "duarr;": '\U000021F5', + "duhar;": '\U0000296F', + "dwangle;": '\U000029A6', + "dzcy;": '\U0000045F', + "dzigrarr;": '\U000027FF', + "eDDot;": '\U00002A77', + "eDot;": '\U00002251', + "eacute;": '\U000000E9', + "easter;": '\U00002A6E', + "ecaron;": '\U0000011B', + "ecir;": '\U00002256', + "ecirc;": '\U000000EA', + "ecolon;": '\U00002255', + "ecy;": '\U0000044D', + "edot;": '\U00000117', + "ee;": '\U00002147', + "efDot;": '\U00002252', + "efr;": '\U0001D522', + "eg;": '\U00002A9A', + "egrave;": '\U000000E8', + "egs;": '\U00002A96', + "egsdot;": '\U00002A98', + "el;": '\U00002A99', + "elinters;": '\U000023E7', + "ell;": '\U00002113', + "els;": '\U00002A95', + "elsdot;": '\U00002A97', + "emacr;": '\U00000113', + "empty;": '\U00002205', + "emptyset;": '\U00002205', + "emptyv;": '\U00002205', + "emsp;": '\U00002003', + "emsp13;": '\U00002004', + "emsp14;": '\U00002005', + "eng;": '\U0000014B', + "ensp;": '\U00002002', + "eogon;": '\U00000119', + "eopf;": '\U0001D556', + "epar;": '\U000022D5', + "eparsl;": '\U000029E3', + "eplus;": '\U00002A71', + "epsi;": '\U000003B5', + "epsilon;": '\U000003B5', + "epsiv;": '\U000003F5', + "eqcirc;": '\U00002256', + "eqcolon;": '\U00002255', + "eqsim;": '\U00002242', + "eqslantgtr;": '\U00002A96', + "eqslantless;": '\U00002A95', + "equals;": '\U0000003D', + "equest;": '\U0000225F', + "equiv;": '\U00002261', + "equivDD;": '\U00002A78', + "eqvparsl;": '\U000029E5', + "erDot;": '\U00002253', + "erarr;": '\U00002971', + "escr;": '\U0000212F', + "esdot;": '\U00002250', + "esim;": '\U00002242', + "eta;": '\U000003B7', + "eth;": '\U000000F0', + "euml;": '\U000000EB', + "euro;": '\U000020AC', + "excl;": '\U00000021', + "exist;": '\U00002203', + "expectation;": '\U00002130', + "exponentiale;": '\U00002147', + "fallingdotseq;": '\U00002252', + "fcy;": '\U00000444', + "female;": '\U00002640', + "ffilig;": '\U0000FB03', + "fflig;": '\U0000FB00', + "ffllig;": '\U0000FB04', + "ffr;": '\U0001D523', + "filig;": '\U0000FB01', + "flat;": '\U0000266D', + "fllig;": '\U0000FB02', + "fltns;": '\U000025B1', + "fnof;": '\U00000192', + "fopf;": '\U0001D557', + "forall;": '\U00002200', + "fork;": '\U000022D4', + "forkv;": '\U00002AD9', + "fpartint;": '\U00002A0D', + "frac12;": '\U000000BD', + "frac13;": '\U00002153', + "frac14;": '\U000000BC', + "frac15;": '\U00002155', + "frac16;": '\U00002159', + "frac18;": '\U0000215B', + "frac23;": '\U00002154', + "frac25;": '\U00002156', + "frac34;": '\U000000BE', + "frac35;": '\U00002157', + "frac38;": '\U0000215C', + "frac45;": '\U00002158', + "frac56;": '\U0000215A', + "frac58;": '\U0000215D', + "frac78;": '\U0000215E', + "frasl;": '\U00002044', + "frown;": '\U00002322', + "fscr;": '\U0001D4BB', + "gE;": '\U00002267', + "gEl;": '\U00002A8C', + "gacute;": '\U000001F5', + "gamma;": '\U000003B3', + "gammad;": '\U000003DD', + "gap;": '\U00002A86', + "gbreve;": '\U0000011F', + "gcirc;": '\U0000011D', + "gcy;": '\U00000433', + "gdot;": '\U00000121', + "ge;": '\U00002265', + "gel;": '\U000022DB', + "geq;": '\U00002265', + "geqq;": '\U00002267', + "geqslant;": '\U00002A7E', + "ges;": '\U00002A7E', + "gescc;": '\U00002AA9', + "gesdot;": '\U00002A80', + "gesdoto;": '\U00002A82', + "gesdotol;": '\U00002A84', + "gesles;": '\U00002A94', + "gfr;": '\U0001D524', + "gg;": '\U0000226B', + "ggg;": '\U000022D9', + "gimel;": '\U00002137', + "gjcy;": '\U00000453', + "gl;": '\U00002277', + "glE;": '\U00002A92', + "gla;": '\U00002AA5', + "glj;": '\U00002AA4', + "gnE;": '\U00002269', + "gnap;": '\U00002A8A', + "gnapprox;": '\U00002A8A', + "gne;": '\U00002A88', + "gneq;": '\U00002A88', + "gneqq;": '\U00002269', + "gnsim;": '\U000022E7', + "gopf;": '\U0001D558', + "grave;": '\U00000060', + "gscr;": '\U0000210A', + "gsim;": '\U00002273', + "gsime;": '\U00002A8E', + "gsiml;": '\U00002A90', + "gt;": '\U0000003E', + "gtcc;": '\U00002AA7', + "gtcir;": '\U00002A7A', + "gtdot;": '\U000022D7', + "gtlPar;": '\U00002995', + "gtquest;": '\U00002A7C', + "gtrapprox;": '\U00002A86', + "gtrarr;": '\U00002978', + "gtrdot;": '\U000022D7', + "gtreqless;": '\U000022DB', + "gtreqqless;": '\U00002A8C', + "gtrless;": '\U00002277', + "gtrsim;": '\U00002273', + "hArr;": '\U000021D4', + "hairsp;": '\U0000200A', + "half;": '\U000000BD', + "hamilt;": '\U0000210B', + "hardcy;": '\U0000044A', + "harr;": '\U00002194', + "harrcir;": '\U00002948', + "harrw;": '\U000021AD', + "hbar;": '\U0000210F', + "hcirc;": '\U00000125', + "hearts;": '\U00002665', + "heartsuit;": '\U00002665', + "hellip;": '\U00002026', + "hercon;": '\U000022B9', + "hfr;": '\U0001D525', + "hksearow;": '\U00002925', + "hkswarow;": '\U00002926', + "hoarr;": '\U000021FF', + "homtht;": '\U0000223B', + "hookleftarrow;": '\U000021A9', + "hookrightarrow;": '\U000021AA', + "hopf;": '\U0001D559', + "horbar;": '\U00002015', + "hscr;": '\U0001D4BD', + "hslash;": '\U0000210F', + "hstrok;": '\U00000127', + "hybull;": '\U00002043', + "hyphen;": '\U00002010', + "iacute;": '\U000000ED', + "ic;": '\U00002063', + "icirc;": '\U000000EE', + "icy;": '\U00000438', + "iecy;": '\U00000435', + "iexcl;": '\U000000A1', + "iff;": '\U000021D4', + "ifr;": '\U0001D526', + "igrave;": '\U000000EC', + "ii;": '\U00002148', + "iiiint;": '\U00002A0C', + "iiint;": '\U0000222D', + "iinfin;": '\U000029DC', + "iiota;": '\U00002129', + "ijlig;": '\U00000133', + "imacr;": '\U0000012B', + "image;": '\U00002111', + "imagline;": '\U00002110', + "imagpart;": '\U00002111', + "imath;": '\U00000131', + "imof;": '\U000022B7', + "imped;": '\U000001B5', + "in;": '\U00002208', + "incare;": '\U00002105', + "infin;": '\U0000221E', + "infintie;": '\U000029DD', + "inodot;": '\U00000131', + "int;": '\U0000222B', + "intcal;": '\U000022BA', + "integers;": '\U00002124', + "intercal;": '\U000022BA', + "intlarhk;": '\U00002A17', + "intprod;": '\U00002A3C', + "iocy;": '\U00000451', + "iogon;": '\U0000012F', + "iopf;": '\U0001D55A', + "iota;": '\U000003B9', + "iprod;": '\U00002A3C', + "iquest;": '\U000000BF', + "iscr;": '\U0001D4BE', + "isin;": '\U00002208', + "isinE;": '\U000022F9', + "isindot;": '\U000022F5', + "isins;": '\U000022F4', + "isinsv;": '\U000022F3', + "isinv;": '\U00002208', + "it;": '\U00002062', + "itilde;": '\U00000129', + "iukcy;": '\U00000456', + "iuml;": '\U000000EF', + "jcirc;": '\U00000135', + "jcy;": '\U00000439', + "jfr;": '\U0001D527', + "jmath;": '\U00000237', + "jopf;": '\U0001D55B', + "jscr;": '\U0001D4BF', + "jsercy;": '\U00000458', + "jukcy;": '\U00000454', + "kappa;": '\U000003BA', + "kappav;": '\U000003F0', + "kcedil;": '\U00000137', + "kcy;": '\U0000043A', + "kfr;": '\U0001D528', + "kgreen;": '\U00000138', + "khcy;": '\U00000445', + "kjcy;": '\U0000045C', + "kopf;": '\U0001D55C', + "kscr;": '\U0001D4C0', + "lAarr;": '\U000021DA', + "lArr;": '\U000021D0', + "lAtail;": '\U0000291B', + "lBarr;": '\U0000290E', + "lE;": '\U00002266', + "lEg;": '\U00002A8B', + "lHar;": '\U00002962', + "lacute;": '\U0000013A', + "laemptyv;": '\U000029B4', + "lagran;": '\U00002112', + "lambda;": '\U000003BB', + "lang;": '\U000027E8', + "langd;": '\U00002991', + "langle;": '\U000027E8', + "lap;": '\U00002A85', + "laquo;": '\U000000AB', + "larr;": '\U00002190', + "larrb;": '\U000021E4', + "larrbfs;": '\U0000291F', + "larrfs;": '\U0000291D', + "larrhk;": '\U000021A9', + "larrlp;": '\U000021AB', + "larrpl;": '\U00002939', + "larrsim;": '\U00002973', + "larrtl;": '\U000021A2', + "lat;": '\U00002AAB', + "latail;": '\U00002919', + "late;": '\U00002AAD', + "lbarr;": '\U0000290C', + "lbbrk;": '\U00002772', + "lbrace;": '\U0000007B', + "lbrack;": '\U0000005B', + "lbrke;": '\U0000298B', + "lbrksld;": '\U0000298F', + "lbrkslu;": '\U0000298D', + "lcaron;": '\U0000013E', + "lcedil;": '\U0000013C', + "lceil;": '\U00002308', + "lcub;": '\U0000007B', + "lcy;": '\U0000043B', + "ldca;": '\U00002936', + "ldquo;": '\U0000201C', + "ldquor;": '\U0000201E', + "ldrdhar;": '\U00002967', + "ldrushar;": '\U0000294B', + "ldsh;": '\U000021B2', + "le;": '\U00002264', + "leftarrow;": '\U00002190', + "leftarrowtail;": '\U000021A2', + "leftharpoondown;": '\U000021BD', + "leftharpoonup;": '\U000021BC', + "leftleftarrows;": '\U000021C7', + "leftrightarrow;": '\U00002194', + "leftrightarrows;": '\U000021C6', + "leftrightharpoons;": '\U000021CB', + "leftrightsquigarrow;": '\U000021AD', + "leftthreetimes;": '\U000022CB', + "leg;": '\U000022DA', + "leq;": '\U00002264', + "leqq;": '\U00002266', + "leqslant;": '\U00002A7D', + "les;": '\U00002A7D', + "lescc;": '\U00002AA8', + "lesdot;": '\U00002A7F', + "lesdoto;": '\U00002A81', + "lesdotor;": '\U00002A83', + "lesges;": '\U00002A93', + "lessapprox;": '\U00002A85', + "lessdot;": '\U000022D6', + "lesseqgtr;": '\U000022DA', + "lesseqqgtr;": '\U00002A8B', + "lessgtr;": '\U00002276', + "lesssim;": '\U00002272', + "lfisht;": '\U0000297C', + "lfloor;": '\U0000230A', + "lfr;": '\U0001D529', + "lg;": '\U00002276', + "lgE;": '\U00002A91', + "lhard;": '\U000021BD', + "lharu;": '\U000021BC', + "lharul;": '\U0000296A', + "lhblk;": '\U00002584', + "ljcy;": '\U00000459', + "ll;": '\U0000226A', + "llarr;": '\U000021C7', + "llcorner;": '\U0000231E', + "llhard;": '\U0000296B', + "lltri;": '\U000025FA', + "lmidot;": '\U00000140', + "lmoust;": '\U000023B0', + "lmoustache;": '\U000023B0', + "lnE;": '\U00002268', + "lnap;": '\U00002A89', + "lnapprox;": '\U00002A89', + "lne;": '\U00002A87', + "lneq;": '\U00002A87', + "lneqq;": '\U00002268', + "lnsim;": '\U000022E6', + "loang;": '\U000027EC', + "loarr;": '\U000021FD', + "lobrk;": '\U000027E6', + "longleftarrow;": '\U000027F5', + "longleftrightarrow;": '\U000027F7', + "longmapsto;": '\U000027FC', + "longrightarrow;": '\U000027F6', + "looparrowleft;": '\U000021AB', + "looparrowright;": '\U000021AC', + "lopar;": '\U00002985', + "lopf;": '\U0001D55D', + "loplus;": '\U00002A2D', + "lotimes;": '\U00002A34', + "lowast;": '\U00002217', + "lowbar;": '\U0000005F', + "loz;": '\U000025CA', + "lozenge;": '\U000025CA', + "lozf;": '\U000029EB', + "lpar;": '\U00000028', + "lparlt;": '\U00002993', + "lrarr;": '\U000021C6', + "lrcorner;": '\U0000231F', + "lrhar;": '\U000021CB', + "lrhard;": '\U0000296D', + "lrm;": '\U0000200E', + "lrtri;": '\U000022BF', + "lsaquo;": '\U00002039', + "lscr;": '\U0001D4C1', + "lsh;": '\U000021B0', + "lsim;": '\U00002272', + "lsime;": '\U00002A8D', + "lsimg;": '\U00002A8F', + "lsqb;": '\U0000005B', + "lsquo;": '\U00002018', + "lsquor;": '\U0000201A', + "lstrok;": '\U00000142', + "lt;": '\U0000003C', + "ltcc;": '\U00002AA6', + "ltcir;": '\U00002A79', + "ltdot;": '\U000022D6', + "lthree;": '\U000022CB', + "ltimes;": '\U000022C9', + "ltlarr;": '\U00002976', + "ltquest;": '\U00002A7B', + "ltrPar;": '\U00002996', + "ltri;": '\U000025C3', + "ltrie;": '\U000022B4', + "ltrif;": '\U000025C2', + "lurdshar;": '\U0000294A', + "luruhar;": '\U00002966', + "mDDot;": '\U0000223A', + "macr;": '\U000000AF', + "male;": '\U00002642', + "malt;": '\U00002720', + "maltese;": '\U00002720', + "map;": '\U000021A6', + "mapsto;": '\U000021A6', + "mapstodown;": '\U000021A7', + "mapstoleft;": '\U000021A4', + "mapstoup;": '\U000021A5', + "marker;": '\U000025AE', + "mcomma;": '\U00002A29', + "mcy;": '\U0000043C', + "mdash;": '\U00002014', + "measuredangle;": '\U00002221', + "mfr;": '\U0001D52A', + "mho;": '\U00002127', + "micro;": '\U000000B5', + "mid;": '\U00002223', + "midast;": '\U0000002A', + "midcir;": '\U00002AF0', + "middot;": '\U000000B7', + "minus;": '\U00002212', + "minusb;": '\U0000229F', + "minusd;": '\U00002238', + "minusdu;": '\U00002A2A', + "mlcp;": '\U00002ADB', + "mldr;": '\U00002026', + "mnplus;": '\U00002213', + "models;": '\U000022A7', + "mopf;": '\U0001D55E', + "mp;": '\U00002213', + "mscr;": '\U0001D4C2', + "mstpos;": '\U0000223E', + "mu;": '\U000003BC', + "multimap;": '\U000022B8', + "mumap;": '\U000022B8', + "nLeftarrow;": '\U000021CD', + "nLeftrightarrow;": '\U000021CE', + "nRightarrow;": '\U000021CF', + "nVDash;": '\U000022AF', + "nVdash;": '\U000022AE', + "nabla;": '\U00002207', + "nacute;": '\U00000144', + "nap;": '\U00002249', + "napos;": '\U00000149', + "napprox;": '\U00002249', + "natur;": '\U0000266E', + "natural;": '\U0000266E', + "naturals;": '\U00002115', + "nbsp;": '\U000000A0', + "ncap;": '\U00002A43', + "ncaron;": '\U00000148', + "ncedil;": '\U00000146', + "ncong;": '\U00002247', + "ncup;": '\U00002A42', + "ncy;": '\U0000043D', + "ndash;": '\U00002013', + "ne;": '\U00002260', + "neArr;": '\U000021D7', + "nearhk;": '\U00002924', + "nearr;": '\U00002197', + "nearrow;": '\U00002197', + "nequiv;": '\U00002262', + "nesear;": '\U00002928', + "nexist;": '\U00002204', + "nexists;": '\U00002204', + "nfr;": '\U0001D52B', + "nge;": '\U00002271', + "ngeq;": '\U00002271', + "ngsim;": '\U00002275', + "ngt;": '\U0000226F', + "ngtr;": '\U0000226F', + "nhArr;": '\U000021CE', + "nharr;": '\U000021AE', + "nhpar;": '\U00002AF2', + "ni;": '\U0000220B', + "nis;": '\U000022FC', + "nisd;": '\U000022FA', + "niv;": '\U0000220B', + "njcy;": '\U0000045A', + "nlArr;": '\U000021CD', + "nlarr;": '\U0000219A', + "nldr;": '\U00002025', + "nle;": '\U00002270', + "nleftarrow;": '\U0000219A', + "nleftrightarrow;": '\U000021AE', + "nleq;": '\U00002270', + "nless;": '\U0000226E', + "nlsim;": '\U00002274', + "nlt;": '\U0000226E', + "nltri;": '\U000022EA', + "nltrie;": '\U000022EC', + "nmid;": '\U00002224', + "nopf;": '\U0001D55F', + "not;": '\U000000AC', + "notin;": '\U00002209', + "notinva;": '\U00002209', + "notinvb;": '\U000022F7', + "notinvc;": '\U000022F6', + "notni;": '\U0000220C', + "notniva;": '\U0000220C', + "notnivb;": '\U000022FE', + "notnivc;": '\U000022FD', + "npar;": '\U00002226', + "nparallel;": '\U00002226', + "npolint;": '\U00002A14', + "npr;": '\U00002280', + "nprcue;": '\U000022E0', + "nprec;": '\U00002280', + "nrArr;": '\U000021CF', + "nrarr;": '\U0000219B', + "nrightarrow;": '\U0000219B', + "nrtri;": '\U000022EB', + "nrtrie;": '\U000022ED', + "nsc;": '\U00002281', + "nsccue;": '\U000022E1', + "nscr;": '\U0001D4C3', + "nshortmid;": '\U00002224', + "nshortparallel;": '\U00002226', + "nsim;": '\U00002241', + "nsime;": '\U00002244', + "nsimeq;": '\U00002244', + "nsmid;": '\U00002224', + "nspar;": '\U00002226', + "nsqsube;": '\U000022E2', + "nsqsupe;": '\U000022E3', + "nsub;": '\U00002284', + "nsube;": '\U00002288', + "nsubseteq;": '\U00002288', + "nsucc;": '\U00002281', + "nsup;": '\U00002285', + "nsupe;": '\U00002289', + "nsupseteq;": '\U00002289', + "ntgl;": '\U00002279', + "ntilde;": '\U000000F1', + "ntlg;": '\U00002278', + "ntriangleleft;": '\U000022EA', + "ntrianglelefteq;": '\U000022EC', + "ntriangleright;": '\U000022EB', + "ntrianglerighteq;": '\U000022ED', + "nu;": '\U000003BD', + "num;": '\U00000023', + "numero;": '\U00002116', + "numsp;": '\U00002007', + "nvDash;": '\U000022AD', + "nvHarr;": '\U00002904', + "nvdash;": '\U000022AC', + "nvinfin;": '\U000029DE', + "nvlArr;": '\U00002902', + "nvrArr;": '\U00002903', + "nwArr;": '\U000021D6', + "nwarhk;": '\U00002923', + "nwarr;": '\U00002196', + "nwarrow;": '\U00002196', + "nwnear;": '\U00002927', + "oS;": '\U000024C8', + "oacute;": '\U000000F3', + "oast;": '\U0000229B', + "ocir;": '\U0000229A', + "ocirc;": '\U000000F4', + "ocy;": '\U0000043E', + "odash;": '\U0000229D', + "odblac;": '\U00000151', + "odiv;": '\U00002A38', + "odot;": '\U00002299', + "odsold;": '\U000029BC', + "oelig;": '\U00000153', + "ofcir;": '\U000029BF', + "ofr;": '\U0001D52C', + "ogon;": '\U000002DB', + "ograve;": '\U000000F2', + "ogt;": '\U000029C1', + "ohbar;": '\U000029B5', + "ohm;": '\U000003A9', + "oint;": '\U0000222E', + "olarr;": '\U000021BA', + "olcir;": '\U000029BE', + "olcross;": '\U000029BB', + "oline;": '\U0000203E', + "olt;": '\U000029C0', + "omacr;": '\U0000014D', + "omega;": '\U000003C9', + "omicron;": '\U000003BF', + "omid;": '\U000029B6', + "ominus;": '\U00002296', + "oopf;": '\U0001D560', + "opar;": '\U000029B7', + "operp;": '\U000029B9', + "oplus;": '\U00002295', + "or;": '\U00002228', + "orarr;": '\U000021BB', + "ord;": '\U00002A5D', + "order;": '\U00002134', + "orderof;": '\U00002134', + "ordf;": '\U000000AA', + "ordm;": '\U000000BA', + "origof;": '\U000022B6', + "oror;": '\U00002A56', + "orslope;": '\U00002A57', + "orv;": '\U00002A5B', + "oscr;": '\U00002134', + "oslash;": '\U000000F8', + "osol;": '\U00002298', + "otilde;": '\U000000F5', + "otimes;": '\U00002297', + "otimesas;": '\U00002A36', + "ouml;": '\U000000F6', + "ovbar;": '\U0000233D', + "par;": '\U00002225', + "para;": '\U000000B6', + "parallel;": '\U00002225', + "parsim;": '\U00002AF3', + "parsl;": '\U00002AFD', + "part;": '\U00002202', + "pcy;": '\U0000043F', + "percnt;": '\U00000025', + "period;": '\U0000002E', + "permil;": '\U00002030', + "perp;": '\U000022A5', + "pertenk;": '\U00002031', + "pfr;": '\U0001D52D', + "phi;": '\U000003C6', + "phiv;": '\U000003D5', + "phmmat;": '\U00002133', + "phone;": '\U0000260E', + "pi;": '\U000003C0', + "pitchfork;": '\U000022D4', + "piv;": '\U000003D6', + "planck;": '\U0000210F', + "planckh;": '\U0000210E', + "plankv;": '\U0000210F', + "plus;": '\U0000002B', + "plusacir;": '\U00002A23', + "plusb;": '\U0000229E', + "pluscir;": '\U00002A22', + "plusdo;": '\U00002214', + "plusdu;": '\U00002A25', + "pluse;": '\U00002A72', + "plusmn;": '\U000000B1', + "plussim;": '\U00002A26', + "plustwo;": '\U00002A27', + "pm;": '\U000000B1', + "pointint;": '\U00002A15', + "popf;": '\U0001D561', + "pound;": '\U000000A3', + "pr;": '\U0000227A', + "prE;": '\U00002AB3', + "prap;": '\U00002AB7', + "prcue;": '\U0000227C', + "pre;": '\U00002AAF', + "prec;": '\U0000227A', + "precapprox;": '\U00002AB7', + "preccurlyeq;": '\U0000227C', + "preceq;": '\U00002AAF', + "precnapprox;": '\U00002AB9', + "precneqq;": '\U00002AB5', + "precnsim;": '\U000022E8', + "precsim;": '\U0000227E', + "prime;": '\U00002032', + "primes;": '\U00002119', + "prnE;": '\U00002AB5', + "prnap;": '\U00002AB9', + "prnsim;": '\U000022E8', + "prod;": '\U0000220F', + "profalar;": '\U0000232E', + "profline;": '\U00002312', + "profsurf;": '\U00002313', + "prop;": '\U0000221D', + "propto;": '\U0000221D', + "prsim;": '\U0000227E', + "prurel;": '\U000022B0', + "pscr;": '\U0001D4C5', + "psi;": '\U000003C8', + "puncsp;": '\U00002008', + "qfr;": '\U0001D52E', + "qint;": '\U00002A0C', + "qopf;": '\U0001D562', + "qprime;": '\U00002057', + "qscr;": '\U0001D4C6', + "quaternions;": '\U0000210D', + "quatint;": '\U00002A16', + "quest;": '\U0000003F', + "questeq;": '\U0000225F', + "quot;": '\U00000022', + "rAarr;": '\U000021DB', + "rArr;": '\U000021D2', + "rAtail;": '\U0000291C', + "rBarr;": '\U0000290F', + "rHar;": '\U00002964', + "racute;": '\U00000155', + "radic;": '\U0000221A', + "raemptyv;": '\U000029B3', + "rang;": '\U000027E9', + "rangd;": '\U00002992', + "range;": '\U000029A5', + "rangle;": '\U000027E9', + "raquo;": '\U000000BB', + "rarr;": '\U00002192', + "rarrap;": '\U00002975', + "rarrb;": '\U000021E5', + "rarrbfs;": '\U00002920', + "rarrc;": '\U00002933', + "rarrfs;": '\U0000291E', + "rarrhk;": '\U000021AA', + "rarrlp;": '\U000021AC', + "rarrpl;": '\U00002945', + "rarrsim;": '\U00002974', + "rarrtl;": '\U000021A3', + "rarrw;": '\U0000219D', + "ratail;": '\U0000291A', + "ratio;": '\U00002236', + "rationals;": '\U0000211A', + "rbarr;": '\U0000290D', + "rbbrk;": '\U00002773', + "rbrace;": '\U0000007D', + "rbrack;": '\U0000005D', + "rbrke;": '\U0000298C', + "rbrksld;": '\U0000298E', + "rbrkslu;": '\U00002990', + "rcaron;": '\U00000159', + "rcedil;": '\U00000157', + "rceil;": '\U00002309', + "rcub;": '\U0000007D', + "rcy;": '\U00000440', + "rdca;": '\U00002937', + "rdldhar;": '\U00002969', + "rdquo;": '\U0000201D', + "rdquor;": '\U0000201D', + "rdsh;": '\U000021B3', + "real;": '\U0000211C', + "realine;": '\U0000211B', + "realpart;": '\U0000211C', + "reals;": '\U0000211D', + "rect;": '\U000025AD', + "reg;": '\U000000AE', + "rfisht;": '\U0000297D', + "rfloor;": '\U0000230B', + "rfr;": '\U0001D52F', + "rhard;": '\U000021C1', + "rharu;": '\U000021C0', + "rharul;": '\U0000296C', + "rho;": '\U000003C1', + "rhov;": '\U000003F1', + "rightarrow;": '\U00002192', + "rightarrowtail;": '\U000021A3', + "rightharpoondown;": '\U000021C1', + "rightharpoonup;": '\U000021C0', + "rightleftarrows;": '\U000021C4', + "rightleftharpoons;": '\U000021CC', + "rightrightarrows;": '\U000021C9', + "rightsquigarrow;": '\U0000219D', + "rightthreetimes;": '\U000022CC', + "ring;": '\U000002DA', + "risingdotseq;": '\U00002253', + "rlarr;": '\U000021C4', + "rlhar;": '\U000021CC', + "rlm;": '\U0000200F', + "rmoust;": '\U000023B1', + "rmoustache;": '\U000023B1', + "rnmid;": '\U00002AEE', + "roang;": '\U000027ED', + "roarr;": '\U000021FE', + "robrk;": '\U000027E7', + "ropar;": '\U00002986', + "ropf;": '\U0001D563', + "roplus;": '\U00002A2E', + "rotimes;": '\U00002A35', + "rpar;": '\U00000029', + "rpargt;": '\U00002994', + "rppolint;": '\U00002A12', + "rrarr;": '\U000021C9', + "rsaquo;": '\U0000203A', + "rscr;": '\U0001D4C7', + "rsh;": '\U000021B1', + "rsqb;": '\U0000005D', + "rsquo;": '\U00002019', + "rsquor;": '\U00002019', + "rthree;": '\U000022CC', + "rtimes;": '\U000022CA', + "rtri;": '\U000025B9', + "rtrie;": '\U000022B5', + "rtrif;": '\U000025B8', + "rtriltri;": '\U000029CE', + "ruluhar;": '\U00002968', + "rx;": '\U0000211E', + "sacute;": '\U0000015B', + "sbquo;": '\U0000201A', + "sc;": '\U0000227B', + "scE;": '\U00002AB4', + "scap;": '\U00002AB8', + "scaron;": '\U00000161', + "sccue;": '\U0000227D', + "sce;": '\U00002AB0', + "scedil;": '\U0000015F', + "scirc;": '\U0000015D', + "scnE;": '\U00002AB6', + "scnap;": '\U00002ABA', + "scnsim;": '\U000022E9', + "scpolint;": '\U00002A13', + "scsim;": '\U0000227F', + "scy;": '\U00000441', + "sdot;": '\U000022C5', + "sdotb;": '\U000022A1', + "sdote;": '\U00002A66', + "seArr;": '\U000021D8', + "searhk;": '\U00002925', + "searr;": '\U00002198', + "searrow;": '\U00002198', + "sect;": '\U000000A7', + "semi;": '\U0000003B', + "seswar;": '\U00002929', + "setminus;": '\U00002216', + "setmn;": '\U00002216', + "sext;": '\U00002736', + "sfr;": '\U0001D530', + "sfrown;": '\U00002322', + "sharp;": '\U0000266F', + "shchcy;": '\U00000449', + "shcy;": '\U00000448', + "shortmid;": '\U00002223', + "shortparallel;": '\U00002225', + "shy;": '\U000000AD', + "sigma;": '\U000003C3', + "sigmaf;": '\U000003C2', + "sigmav;": '\U000003C2', + "sim;": '\U0000223C', + "simdot;": '\U00002A6A', + "sime;": '\U00002243', + "simeq;": '\U00002243', + "simg;": '\U00002A9E', + "simgE;": '\U00002AA0', + "siml;": '\U00002A9D', + "simlE;": '\U00002A9F', + "simne;": '\U00002246', + "simplus;": '\U00002A24', + "simrarr;": '\U00002972', + "slarr;": '\U00002190', + "smallsetminus;": '\U00002216', + "smashp;": '\U00002A33', + "smeparsl;": '\U000029E4', + "smid;": '\U00002223', + "smile;": '\U00002323', + "smt;": '\U00002AAA', + "smte;": '\U00002AAC', + "softcy;": '\U0000044C', + "sol;": '\U0000002F', + "solb;": '\U000029C4', + "solbar;": '\U0000233F', + "sopf;": '\U0001D564', + "spades;": '\U00002660', + "spadesuit;": '\U00002660', + "spar;": '\U00002225', + "sqcap;": '\U00002293', + "sqcup;": '\U00002294', + "sqsub;": '\U0000228F', + "sqsube;": '\U00002291', + "sqsubset;": '\U0000228F', + "sqsubseteq;": '\U00002291', + "sqsup;": '\U00002290', + "sqsupe;": '\U00002292', + "sqsupset;": '\U00002290', + "sqsupseteq;": '\U00002292', + "squ;": '\U000025A1', + "square;": '\U000025A1', + "squarf;": '\U000025AA', + "squf;": '\U000025AA', + "srarr;": '\U00002192', + "sscr;": '\U0001D4C8', + "ssetmn;": '\U00002216', + "ssmile;": '\U00002323', + "sstarf;": '\U000022C6', + "star;": '\U00002606', + "starf;": '\U00002605', + "straightepsilon;": '\U000003F5', + "straightphi;": '\U000003D5', + "strns;": '\U000000AF', + "sub;": '\U00002282', + "subE;": '\U00002AC5', + "subdot;": '\U00002ABD', + "sube;": '\U00002286', + "subedot;": '\U00002AC3', + "submult;": '\U00002AC1', + "subnE;": '\U00002ACB', + "subne;": '\U0000228A', + "subplus;": '\U00002ABF', + "subrarr;": '\U00002979', + "subset;": '\U00002282', + "subseteq;": '\U00002286', + "subseteqq;": '\U00002AC5', + "subsetneq;": '\U0000228A', + "subsetneqq;": '\U00002ACB', + "subsim;": '\U00002AC7', + "subsub;": '\U00002AD5', + "subsup;": '\U00002AD3', + "succ;": '\U0000227B', + "succapprox;": '\U00002AB8', + "succcurlyeq;": '\U0000227D', + "succeq;": '\U00002AB0', + "succnapprox;": '\U00002ABA', + "succneqq;": '\U00002AB6', + "succnsim;": '\U000022E9', + "succsim;": '\U0000227F', + "sum;": '\U00002211', + "sung;": '\U0000266A', + "sup;": '\U00002283', + "sup1;": '\U000000B9', + "sup2;": '\U000000B2', + "sup3;": '\U000000B3', + "supE;": '\U00002AC6', + "supdot;": '\U00002ABE', + "supdsub;": '\U00002AD8', + "supe;": '\U00002287', + "supedot;": '\U00002AC4', + "suphsol;": '\U000027C9', + "suphsub;": '\U00002AD7', + "suplarr;": '\U0000297B', + "supmult;": '\U00002AC2', + "supnE;": '\U00002ACC', + "supne;": '\U0000228B', + "supplus;": '\U00002AC0', + "supset;": '\U00002283', + "supseteq;": '\U00002287', + "supseteqq;": '\U00002AC6', + "supsetneq;": '\U0000228B', + "supsetneqq;": '\U00002ACC', + "supsim;": '\U00002AC8', + "supsub;": '\U00002AD4', + "supsup;": '\U00002AD6', + "swArr;": '\U000021D9', + "swarhk;": '\U00002926', + "swarr;": '\U00002199', + "swarrow;": '\U00002199', + "swnwar;": '\U0000292A', + "szlig;": '\U000000DF', + "target;": '\U00002316', + "tau;": '\U000003C4', + "tbrk;": '\U000023B4', + "tcaron;": '\U00000165', + "tcedil;": '\U00000163', + "tcy;": '\U00000442', + "tdot;": '\U000020DB', + "telrec;": '\U00002315', + "tfr;": '\U0001D531', + "there4;": '\U00002234', + "therefore;": '\U00002234', + "theta;": '\U000003B8', + "thetasym;": '\U000003D1', + "thetav;": '\U000003D1', + "thickapprox;": '\U00002248', + "thicksim;": '\U0000223C', + "thinsp;": '\U00002009', + "thkap;": '\U00002248', + "thksim;": '\U0000223C', + "thorn;": '\U000000FE', + "tilde;": '\U000002DC', + "times;": '\U000000D7', + "timesb;": '\U000022A0', + "timesbar;": '\U00002A31', + "timesd;": '\U00002A30', + "tint;": '\U0000222D', + "toea;": '\U00002928', + "top;": '\U000022A4', + "topbot;": '\U00002336', + "topcir;": '\U00002AF1', + "topf;": '\U0001D565', + "topfork;": '\U00002ADA', + "tosa;": '\U00002929', + "tprime;": '\U00002034', + "trade;": '\U00002122', + "triangle;": '\U000025B5', + "triangledown;": '\U000025BF', + "triangleleft;": '\U000025C3', + "trianglelefteq;": '\U000022B4', + "triangleq;": '\U0000225C', + "triangleright;": '\U000025B9', + "trianglerighteq;": '\U000022B5', + "tridot;": '\U000025EC', + "trie;": '\U0000225C', + "triminus;": '\U00002A3A', + "triplus;": '\U00002A39', + "trisb;": '\U000029CD', + "tritime;": '\U00002A3B', + "trpezium;": '\U000023E2', + "tscr;": '\U0001D4C9', + "tscy;": '\U00000446', + "tshcy;": '\U0000045B', + "tstrok;": '\U00000167', + "twixt;": '\U0000226C', + "twoheadleftarrow;": '\U0000219E', + "twoheadrightarrow;": '\U000021A0', + "uArr;": '\U000021D1', + "uHar;": '\U00002963', + "uacute;": '\U000000FA', + "uarr;": '\U00002191', + "ubrcy;": '\U0000045E', + "ubreve;": '\U0000016D', + "ucirc;": '\U000000FB', + "ucy;": '\U00000443', + "udarr;": '\U000021C5', + "udblac;": '\U00000171', + "udhar;": '\U0000296E', + "ufisht;": '\U0000297E', + "ufr;": '\U0001D532', + "ugrave;": '\U000000F9', + "uharl;": '\U000021BF', + "uharr;": '\U000021BE', + "uhblk;": '\U00002580', + "ulcorn;": '\U0000231C', + "ulcorner;": '\U0000231C', + "ulcrop;": '\U0000230F', + "ultri;": '\U000025F8', + "umacr;": '\U0000016B', + "uml;": '\U000000A8', + "uogon;": '\U00000173', + "uopf;": '\U0001D566', + "uparrow;": '\U00002191', + "updownarrow;": '\U00002195', + "upharpoonleft;": '\U000021BF', + "upharpoonright;": '\U000021BE', + "uplus;": '\U0000228E', + "upsi;": '\U000003C5', + "upsih;": '\U000003D2', + "upsilon;": '\U000003C5', + "upuparrows;": '\U000021C8', + "urcorn;": '\U0000231D', + "urcorner;": '\U0000231D', + "urcrop;": '\U0000230E', + "uring;": '\U0000016F', + "urtri;": '\U000025F9', + "uscr;": '\U0001D4CA', + "utdot;": '\U000022F0', + "utilde;": '\U00000169', + "utri;": '\U000025B5', + "utrif;": '\U000025B4', + "uuarr;": '\U000021C8', + "uuml;": '\U000000FC', + "uwangle;": '\U000029A7', + "vArr;": '\U000021D5', + "vBar;": '\U00002AE8', + "vBarv;": '\U00002AE9', + "vDash;": '\U000022A8', + "vangrt;": '\U0000299C', + "varepsilon;": '\U000003F5', + "varkappa;": '\U000003F0', + "varnothing;": '\U00002205', + "varphi;": '\U000003D5', + "varpi;": '\U000003D6', + "varpropto;": '\U0000221D', + "varr;": '\U00002195', + "varrho;": '\U000003F1', + "varsigma;": '\U000003C2', + "vartheta;": '\U000003D1', + "vartriangleleft;": '\U000022B2', + "vartriangleright;": '\U000022B3', + "vcy;": '\U00000432', + "vdash;": '\U000022A2', + "vee;": '\U00002228', + "veebar;": '\U000022BB', + "veeeq;": '\U0000225A', + "vellip;": '\U000022EE', + "verbar;": '\U0000007C', + "vert;": '\U0000007C', + "vfr;": '\U0001D533', + "vltri;": '\U000022B2', + "vopf;": '\U0001D567', + "vprop;": '\U0000221D', + "vrtri;": '\U000022B3', + "vscr;": '\U0001D4CB', + "vzigzag;": '\U0000299A', + "wcirc;": '\U00000175', + "wedbar;": '\U00002A5F', + "wedge;": '\U00002227', + "wedgeq;": '\U00002259', + "weierp;": '\U00002118', + "wfr;": '\U0001D534', + "wopf;": '\U0001D568', + "wp;": '\U00002118', + "wr;": '\U00002240', + "wreath;": '\U00002240', + "wscr;": '\U0001D4CC', + "xcap;": '\U000022C2', + "xcirc;": '\U000025EF', + "xcup;": '\U000022C3', + "xdtri;": '\U000025BD', + "xfr;": '\U0001D535', + "xhArr;": '\U000027FA', + "xharr;": '\U000027F7', + "xi;": '\U000003BE', + "xlArr;": '\U000027F8', + "xlarr;": '\U000027F5', + "xmap;": '\U000027FC', + "xnis;": '\U000022FB', + "xodot;": '\U00002A00', + "xopf;": '\U0001D569', + "xoplus;": '\U00002A01', + "xotime;": '\U00002A02', + "xrArr;": '\U000027F9', + "xrarr;": '\U000027F6', + "xscr;": '\U0001D4CD', + "xsqcup;": '\U00002A06', + "xuplus;": '\U00002A04', + "xutri;": '\U000025B3', + "xvee;": '\U000022C1', + "xwedge;": '\U000022C0', + "yacute;": '\U000000FD', + "yacy;": '\U0000044F', + "ycirc;": '\U00000177', + "ycy;": '\U0000044B', + "yen;": '\U000000A5', + "yfr;": '\U0001D536', + "yicy;": '\U00000457', + "yopf;": '\U0001D56A', + "yscr;": '\U0001D4CE', + "yucy;": '\U0000044E', + "yuml;": '\U000000FF', + "zacute;": '\U0000017A', + "zcaron;": '\U0000017E', + "zcy;": '\U00000437', + "zdot;": '\U0000017C', + "zeetrf;": '\U00002128', + "zeta;": '\U000003B6', + "zfr;": '\U0001D537', + "zhcy;": '\U00000436', + "zigrarr;": '\U000021DD', + "zopf;": '\U0001D56B', + "zscr;": '\U0001D4CF', + "zwj;": '\U0000200D', + "zwnj;": '\U0000200C', + "AElig": '\U000000C6', + "AMP": '\U00000026', + "Aacute": '\U000000C1', + "Acirc": '\U000000C2', + "Agrave": '\U000000C0', + "Aring": '\U000000C5', + "Atilde": '\U000000C3', + "Auml": '\U000000C4', + "COPY": '\U000000A9', + "Ccedil": '\U000000C7', + "ETH": '\U000000D0', + "Eacute": '\U000000C9', + "Ecirc": '\U000000CA', + "Egrave": '\U000000C8', + "Euml": '\U000000CB', + "GT": '\U0000003E', + "Iacute": '\U000000CD', + "Icirc": '\U000000CE', + "Igrave": '\U000000CC', + "Iuml": '\U000000CF', + "LT": '\U0000003C', + "Ntilde": '\U000000D1', + "Oacute": '\U000000D3', + "Ocirc": '\U000000D4', + "Ograve": '\U000000D2', + "Oslash": '\U000000D8', + "Otilde": '\U000000D5', + "Ouml": '\U000000D6', + "QUOT": '\U00000022', + "REG": '\U000000AE', + "THORN": '\U000000DE', + "Uacute": '\U000000DA', + "Ucirc": '\U000000DB', + "Ugrave": '\U000000D9', + "Uuml": '\U000000DC', + "Yacute": '\U000000DD', + "aacute": '\U000000E1', + "acirc": '\U000000E2', + "acute": '\U000000B4', + "aelig": '\U000000E6', + "agrave": '\U000000E0', + "amp": '\U00000026', + "aring": '\U000000E5', + "atilde": '\U000000E3', + "auml": '\U000000E4', + "brvbar": '\U000000A6', + "ccedil": '\U000000E7', + "cedil": '\U000000B8', + "cent": '\U000000A2', + "copy": '\U000000A9', + "curren": '\U000000A4', + "deg": '\U000000B0', + "divide": '\U000000F7', + "eacute": '\U000000E9', + "ecirc": '\U000000EA', + "egrave": '\U000000E8', + "eth": '\U000000F0', + "euml": '\U000000EB', + "frac12": '\U000000BD', + "frac14": '\U000000BC', + "frac34": '\U000000BE', + "gt": '\U0000003E', + "iacute": '\U000000ED', + "icirc": '\U000000EE', + "iexcl": '\U000000A1', + "igrave": '\U000000EC', + "iquest": '\U000000BF', + "iuml": '\U000000EF', + "laquo": '\U000000AB', + "lt": '\U0000003C', + "macr": '\U000000AF', + "micro": '\U000000B5', + "middot": '\U000000B7', + "nbsp": '\U000000A0', + "not": '\U000000AC', + "ntilde": '\U000000F1', + "oacute": '\U000000F3', + "ocirc": '\U000000F4', + "ograve": '\U000000F2', + "ordf": '\U000000AA', + "ordm": '\U000000BA', + "oslash": '\U000000F8', + "otilde": '\U000000F5', + "ouml": '\U000000F6', + "para": '\U000000B6', + "plusmn": '\U000000B1', + "pound": '\U000000A3', + "quot": '\U00000022', + "raquo": '\U000000BB', + "reg": '\U000000AE', + "sect": '\U000000A7', + "shy": '\U000000AD', + "sup1": '\U000000B9', + "sup2": '\U000000B2', + "sup3": '\U000000B3', + "szlig": '\U000000DF', + "thorn": '\U000000FE', + "times": '\U000000D7', + "uacute": '\U000000FA', + "ucirc": '\U000000FB', + "ugrave": '\U000000F9', + "uml": '\U000000A8', + "uuml": '\U000000FC', + "yacute": '\U000000FD', + "yen": '\U000000A5', + "yuml": '\U000000FF', +} + +// HTML entities that are two unicode codepoints. +var entity2 = map[string][2]rune{ + // TODO(nigeltao): Handle replacements that are wider than their names. + // "nLt;": {'\u226A', '\u20D2'}, + // "nGt;": {'\u226B', '\u20D2'}, + "NotEqualTilde;": {'\u2242', '\u0338'}, + "NotGreaterFullEqual;": {'\u2267', '\u0338'}, + "NotGreaterGreater;": {'\u226B', '\u0338'}, + "NotGreaterSlantEqual;": {'\u2A7E', '\u0338'}, + "NotHumpDownHump;": {'\u224E', '\u0338'}, + "NotHumpEqual;": {'\u224F', '\u0338'}, + "NotLeftTriangleBar;": {'\u29CF', '\u0338'}, + "NotLessLess;": {'\u226A', '\u0338'}, + "NotLessSlantEqual;": {'\u2A7D', '\u0338'}, + "NotNestedGreaterGreater;": {'\u2AA2', '\u0338'}, + "NotNestedLessLess;": {'\u2AA1', '\u0338'}, + "NotPrecedesEqual;": {'\u2AAF', '\u0338'}, + "NotRightTriangleBar;": {'\u29D0', '\u0338'}, + "NotSquareSubset;": {'\u228F', '\u0338'}, + "NotSquareSuperset;": {'\u2290', '\u0338'}, + "NotSubset;": {'\u2282', '\u20D2'}, + "NotSucceedsEqual;": {'\u2AB0', '\u0338'}, + "NotSucceedsTilde;": {'\u227F', '\u0338'}, + "NotSuperset;": {'\u2283', '\u20D2'}, + "ThickSpace;": {'\u205F', '\u200A'}, + "acE;": {'\u223E', '\u0333'}, + "bne;": {'\u003D', '\u20E5'}, + "bnequiv;": {'\u2261', '\u20E5'}, + "caps;": {'\u2229', '\uFE00'}, + "cups;": {'\u222A', '\uFE00'}, + "fjlig;": {'\u0066', '\u006A'}, + "gesl;": {'\u22DB', '\uFE00'}, + "gvertneqq;": {'\u2269', '\uFE00'}, + "gvnE;": {'\u2269', '\uFE00'}, + "lates;": {'\u2AAD', '\uFE00'}, + "lesg;": {'\u22DA', '\uFE00'}, + "lvertneqq;": {'\u2268', '\uFE00'}, + "lvnE;": {'\u2268', '\uFE00'}, + "nGg;": {'\u22D9', '\u0338'}, + "nGtv;": {'\u226B', '\u0338'}, + "nLl;": {'\u22D8', '\u0338'}, + "nLtv;": {'\u226A', '\u0338'}, + "nang;": {'\u2220', '\u20D2'}, + "napE;": {'\u2A70', '\u0338'}, + "napid;": {'\u224B', '\u0338'}, + "nbump;": {'\u224E', '\u0338'}, + "nbumpe;": {'\u224F', '\u0338'}, + "ncongdot;": {'\u2A6D', '\u0338'}, + "nedot;": {'\u2250', '\u0338'}, + "nesim;": {'\u2242', '\u0338'}, + "ngE;": {'\u2267', '\u0338'}, + "ngeqq;": {'\u2267', '\u0338'}, + "ngeqslant;": {'\u2A7E', '\u0338'}, + "nges;": {'\u2A7E', '\u0338'}, + "nlE;": {'\u2266', '\u0338'}, + "nleqq;": {'\u2266', '\u0338'}, + "nleqslant;": {'\u2A7D', '\u0338'}, + "nles;": {'\u2A7D', '\u0338'}, + "notinE;": {'\u22F9', '\u0338'}, + "notindot;": {'\u22F5', '\u0338'}, + "nparsl;": {'\u2AFD', '\u20E5'}, + "npart;": {'\u2202', '\u0338'}, + "npre;": {'\u2AAF', '\u0338'}, + "npreceq;": {'\u2AAF', '\u0338'}, + "nrarrc;": {'\u2933', '\u0338'}, + "nrarrw;": {'\u219D', '\u0338'}, + "nsce;": {'\u2AB0', '\u0338'}, + "nsubE;": {'\u2AC5', '\u0338'}, + "nsubset;": {'\u2282', '\u20D2'}, + "nsubseteqq;": {'\u2AC5', '\u0338'}, + "nsucceq;": {'\u2AB0', '\u0338'}, + "nsupE;": {'\u2AC6', '\u0338'}, + "nsupset;": {'\u2283', '\u20D2'}, + "nsupseteqq;": {'\u2AC6', '\u0338'}, + "nvap;": {'\u224D', '\u20D2'}, + "nvge;": {'\u2265', '\u20D2'}, + "nvgt;": {'\u003E', '\u20D2'}, + "nvle;": {'\u2264', '\u20D2'}, + "nvlt;": {'\u003C', '\u20D2'}, + "nvltrie;": {'\u22B4', '\u20D2'}, + "nvrtrie;": {'\u22B5', '\u20D2'}, + "nvsim;": {'\u223C', '\u20D2'}, + "race;": {'\u223D', '\u0331'}, + "smtes;": {'\u2AAC', '\uFE00'}, + "sqcaps;": {'\u2293', '\uFE00'}, + "sqcups;": {'\u2294', '\uFE00'}, + "varsubsetneq;": {'\u228A', '\uFE00'}, + "varsubsetneqq;": {'\u2ACB', '\uFE00'}, + "varsupsetneq;": {'\u228B', '\uFE00'}, + "varsupsetneqq;": {'\u2ACC', '\uFE00'}, + "vnsub;": {'\u2282', '\u20D2'}, + "vnsup;": {'\u2283', '\u20D2'}, + "vsubnE;": {'\u2ACB', '\uFE00'}, + "vsubne;": {'\u228A', '\uFE00'}, + "vsupnE;": {'\u2ACC', '\uFE00'}, + "vsupne;": {'\u228B', '\uFE00'}, +} diff --git a/vendor/golang.org/x/net/html/escape.go b/vendor/golang.org/x/net/html/escape.go new file mode 100644 index 00000000..04c6bec2 --- /dev/null +++ b/vendor/golang.org/x/net/html/escape.go @@ -0,0 +1,339 @@ +// Copyright 2010 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package html + +import ( + "bytes" + "strings" + "unicode/utf8" +) + +// These replacements permit compatibility with old numeric entities that +// assumed Windows-1252 encoding. +// https://html.spec.whatwg.org/multipage/syntax.html#consume-a-character-reference +var replacementTable = [...]rune{ + '\u20AC', // First entry is what 0x80 should be replaced with. + '\u0081', + '\u201A', + '\u0192', + '\u201E', + '\u2026', + '\u2020', + '\u2021', + '\u02C6', + '\u2030', + '\u0160', + '\u2039', + '\u0152', + '\u008D', + '\u017D', + '\u008F', + '\u0090', + '\u2018', + '\u2019', + '\u201C', + '\u201D', + '\u2022', + '\u2013', + '\u2014', + '\u02DC', + '\u2122', + '\u0161', + '\u203A', + '\u0153', + '\u009D', + '\u017E', + '\u0178', // Last entry is 0x9F. + // 0x00->'\uFFFD' is handled programmatically. + // 0x0D->'\u000D' is a no-op. +} + +// unescapeEntity reads an entity like "<" from b[src:] and writes the +// corresponding "<" to b[dst:], returning the incremented dst and src cursors. +// Precondition: b[src] == '&' && dst <= src. +// attribute should be true if parsing an attribute value. +func unescapeEntity(b []byte, dst, src int, attribute bool) (dst1, src1 int) { + // https://html.spec.whatwg.org/multipage/syntax.html#consume-a-character-reference + + // i starts at 1 because we already know that s[0] == '&'. + i, s := 1, b[src:] + + if len(s) <= 1 { + b[dst] = b[src] + return dst + 1, src + 1 + } + + if s[i] == '#' { + if len(s) <= 3 { // We need to have at least "&#.". + b[dst] = b[src] + return dst + 1, src + 1 + } + i++ + c := s[i] + hex := false + if c == 'x' || c == 'X' { + hex = true + i++ + } + + x := '\x00' + for i < len(s) { + c = s[i] + i++ + if hex { + if '0' <= c && c <= '9' { + x = 16*x + rune(c) - '0' + continue + } else if 'a' <= c && c <= 'f' { + x = 16*x + rune(c) - 'a' + 10 + continue + } else if 'A' <= c && c <= 'F' { + x = 16*x + rune(c) - 'A' + 10 + continue + } + } else if '0' <= c && c <= '9' { + x = 10*x + rune(c) - '0' + continue + } + if c != ';' { + i-- + } + break + } + + if i <= 3 { // No characters matched. + b[dst] = b[src] + return dst + 1, src + 1 + } + + if 0x80 <= x && x <= 0x9F { + // Replace characters from Windows-1252 with UTF-8 equivalents. + x = replacementTable[x-0x80] + } else if x == 0 || (0xD800 <= x && x <= 0xDFFF) || x > 0x10FFFF { + // Replace invalid characters with the replacement character. + x = '\uFFFD' + } + + return dst + utf8.EncodeRune(b[dst:], x), src + i + } + + // Consume the maximum number of characters possible, with the + // consumed characters matching one of the named references. + + for i < len(s) { + c := s[i] + i++ + // Lower-cased characters are more common in entities, so we check for them first. + if 'a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9' { + continue + } + if c != ';' { + i-- + } + break + } + + entityName := string(s[1:i]) + if entityName == "" { + // No-op. + } else if attribute && entityName[len(entityName)-1] != ';' && len(s) > i && s[i] == '=' { + // No-op. + } else if x := entity[entityName]; x != 0 { + return dst + utf8.EncodeRune(b[dst:], x), src + i + } else if x := entity2[entityName]; x[0] != 0 { + dst1 := dst + utf8.EncodeRune(b[dst:], x[0]) + return dst1 + utf8.EncodeRune(b[dst1:], x[1]), src + i + } else if !attribute { + maxLen := len(entityName) - 1 + if maxLen > longestEntityWithoutSemicolon { + maxLen = longestEntityWithoutSemicolon + } + for j := maxLen; j > 1; j-- { + if x := entity[entityName[:j]]; x != 0 { + return dst + utf8.EncodeRune(b[dst:], x), src + j + 1 + } + } + } + + dst1, src1 = dst+i, src+i + copy(b[dst:dst1], b[src:src1]) + return dst1, src1 +} + +// unescape unescapes b's entities in-place, so that "a<b" becomes "a' byte that, per above, we'd like to avoid escaping unless we have to. +// +// Studying the summary table (and T actions in its '>' column) closely, we +// only need to escape in states 43, 44, 49, 51 and 52. State 43 is at the +// start of the comment data. State 52 is after a '!'. The other three states +// are after a '-'. +// +// Our algorithm is thus to escape every '&' and to escape '>' if and only if: +// - The '>' is after a '!' or '-' (in the unescaped data) or +// - The '>' is at the start of the comment data (after the opening ""); err != nil { + return err + } + return nil + case DoctypeNode: + if _, err := w.WriteString("') + case RawNode: + _, err := w.WriteString(n.Data) + return err + default: + return errors.New("html: unknown node type") + } + + // Render the opening tag. + if err := w.WriteByte('<'); err != nil { + return err + } + if _, err := w.WriteString(n.Data); err != nil { + return err + } + for _, a := range n.Attr { + if err := w.WriteByte(' '); err != nil { + return err + } + if a.Namespace != "" { + if _, err := w.WriteString(a.Namespace); err != nil { + return err + } + if err := w.WriteByte(':'); err != nil { + return err + } + } + if _, err := w.WriteString(a.Key); err != nil { + return err + } + if _, err := w.WriteString(`="`); err != nil { + return err + } + if err := escape(w, a.Val); err != nil { + return err + } + if err := w.WriteByte('"'); err != nil { + return err + } + } + if voidElements[n.Data] { + if n.FirstChild != nil { + return fmt.Errorf("html: void element <%s> has child nodes", n.Data) + } + _, err := w.WriteString("/>") + return err + } + if err := w.WriteByte('>'); err != nil { + return err + } + + // Add initial newline where there is danger of a newline beging ignored. + if c := n.FirstChild; c != nil && c.Type == TextNode && strings.HasPrefix(c.Data, "\n") { + switch n.Data { + case "pre", "listing", "textarea": + if err := w.WriteByte('\n'); err != nil { + return err + } + } + } + + // Render any child nodes + if childTextNodesAreLiteral(n) { + for c := n.FirstChild; c != nil; c = c.NextSibling { + if c.Type == TextNode { + if _, err := w.WriteString(c.Data); err != nil { + return err + } + } else { + if err := render1(w, c); err != nil { + return err + } + } + } + if n.Data == "plaintext" { + // Don't render anything else. must be the + // last element in the file, with no closing tag. + return plaintextAbort + } + } else { + for c := n.FirstChild; c != nil; c = c.NextSibling { + if err := render1(w, c); err != nil { + return err + } + } + } + + // Render the </xxx> closing tag. + if _, err := w.WriteString("</"); err != nil { + return err + } + if _, err := w.WriteString(n.Data); err != nil { + return err + } + return w.WriteByte('>') +} + +func childTextNodesAreLiteral(n *Node) bool { + // Per WHATWG HTML 13.3, if the parent of the current node is a style, + // script, xmp, iframe, noembed, noframes, or plaintext element, and the + // current node is a text node, append the value of the node's data + // literally. The specification is not explicit about it, but we only + // enforce this if we are in the HTML namespace (i.e. when the namespace is + // ""). + // NOTE: we also always include noscript elements, although the + // specification states that they should only be rendered as such if + // scripting is enabled for the node (which is not something we track). + if n.Namespace != "" { + return false + } + switch n.Data { + case "iframe", "noembed", "noframes", "noscript", "plaintext", "script", "style", "xmp": + return true + default: + return false + } +} + +// writeQuoted writes s to w surrounded by quotes. Normally it will use double +// quotes, but if s contains a double quote, it will use single quotes. +// It is used for writing the identifiers in a doctype declaration. +// In valid HTML, they can't contain both types of quotes. +func writeQuoted(w writer, s string) error { + var q byte = '"' + if strings.Contains(s, `"`) { + q = '\'' + } + if err := w.WriteByte(q); err != nil { + return err + } + if _, err := w.WriteString(s); err != nil { + return err + } + if err := w.WriteByte(q); err != nil { + return err + } + return nil +} + +// Section 12.1.2, "Elements", gives this list of void elements. Void elements +// are those that can't have any contents. +var voidElements = map[string]bool{ + "area": true, + "base": true, + "br": true, + "col": true, + "embed": true, + "hr": true, + "img": true, + "input": true, + "keygen": true, // "keygen" has been removed from the spec, but are kept here for backwards compatibility. + "link": true, + "meta": true, + "param": true, + "source": true, + "track": true, + "wbr": true, +} diff --git a/vendor/golang.org/x/net/html/token.go b/vendor/golang.org/x/net/html/token.go new file mode 100644 index 00000000..6598c1f7 --- /dev/null +++ b/vendor/golang.org/x/net/html/token.go @@ -0,0 +1,1286 @@ +// Copyright 2010 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package html + +import ( + "bytes" + "errors" + "io" + "strconv" + "strings" + + "golang.org/x/net/html/atom" +) + +// A TokenType is the type of a Token. +type TokenType uint32 + +const ( + // ErrorToken means that an error occurred during tokenization. + ErrorToken TokenType = iota + // TextToken means a text node. + TextToken + // A StartTagToken looks like <a>. + StartTagToken + // An EndTagToken looks like </a>. + EndTagToken + // A SelfClosingTagToken tag looks like <br/>. + SelfClosingTagToken + // A CommentToken looks like <!--x-->. + CommentToken + // A DoctypeToken looks like <!DOCTYPE x> + DoctypeToken +) + +// ErrBufferExceeded means that the buffering limit was exceeded. +var ErrBufferExceeded = errors.New("max buffer exceeded") + +// String returns a string representation of the TokenType. +func (t TokenType) String() string { + switch t { + case ErrorToken: + return "Error" + case TextToken: + return "Text" + case StartTagToken: + return "StartTag" + case EndTagToken: + return "EndTag" + case SelfClosingTagToken: + return "SelfClosingTag" + case CommentToken: + return "Comment" + case DoctypeToken: + return "Doctype" + } + return "Invalid(" + strconv.Itoa(int(t)) + ")" +} + +// An Attribute is an attribute namespace-key-value triple. Namespace is +// non-empty for foreign attributes like xlink, Key is alphabetic (and hence +// does not contain escapable characters like '&', '<' or '>'), and Val is +// unescaped (it looks like "a<b" rather than "a&lt;b"). +// +// Namespace is only used by the parser, not the tokenizer. +type Attribute struct { + Namespace, Key, Val string +} + +// A Token consists of a TokenType and some Data (tag name for start and end +// tags, content for text, comments and doctypes). A tag Token may also contain +// a slice of Attributes. Data is unescaped for all Tokens (it looks like "a<b" +// rather than "a&lt;b"). For tag Tokens, DataAtom is the atom for Data, or +// zero if Data is not a known tag name. +type Token struct { + Type TokenType + DataAtom atom.Atom + Data string + Attr []Attribute +} + +// tagString returns a string representation of a tag Token's Data and Attr. +func (t Token) tagString() string { + if len(t.Attr) == 0 { + return t.Data + } + buf := bytes.NewBufferString(t.Data) + for _, a := range t.Attr { + buf.WriteByte(' ') + buf.WriteString(a.Key) + buf.WriteString(`="`) + escape(buf, a.Val) + buf.WriteByte('"') + } + return buf.String() +} + +// String returns a string representation of the Token. +func (t Token) String() string { + switch t.Type { + case ErrorToken: + return "" + case TextToken: + return EscapeString(t.Data) + case StartTagToken: + return "<" + t.tagString() + ">" + case EndTagToken: + return "</" + t.tagString() + ">" + case SelfClosingTagToken: + return "<" + t.tagString() + "/>" + case CommentToken: + return "<!--" + escapeCommentString(t.Data) + "-->" + case DoctypeToken: + return "<!DOCTYPE " + EscapeString(t.Data) + ">" + } + return "Invalid(" + strconv.Itoa(int(t.Type)) + ")" +} + +// span is a range of bytes in a Tokenizer's buffer. The start is inclusive, +// the end is exclusive. +type span struct { + start, end int +} + +// A Tokenizer returns a stream of HTML Tokens. +type Tokenizer struct { + // r is the source of the HTML text. + r io.Reader + // tt is the TokenType of the current token. + tt TokenType + // err is the first error encountered during tokenization. It is possible + // for tt != Error && err != nil to hold: this means that Next returned a + // valid token but the subsequent Next call will return an error token. + // For example, if the HTML text input was just "plain", then the first + // Next call would set z.err to io.EOF but return a TextToken, and all + // subsequent Next calls would return an ErrorToken. + // err is never reset. Once it becomes non-nil, it stays non-nil. + err error + // readErr is the error returned by the io.Reader r. It is separate from + // err because it is valid for an io.Reader to return (n int, err1 error) + // such that n > 0 && err1 != nil, and callers should always process the + // n > 0 bytes before considering the error err1. + readErr error + // buf[raw.start:raw.end] holds the raw bytes of the current token. + // buf[raw.end:] is buffered input that will yield future tokens. + raw span + buf []byte + // maxBuf limits the data buffered in buf. A value of 0 means unlimited. + maxBuf int + // buf[data.start:data.end] holds the raw bytes of the current token's data: + // a text token's text, a tag token's tag name, etc. + data span + // pendingAttr is the attribute key and value currently being tokenized. + // When complete, pendingAttr is pushed onto attr. nAttrReturned is + // incremented on each call to TagAttr. + pendingAttr [2]span + attr [][2]span + nAttrReturned int + // rawTag is the "script" in "</script>" that closes the next token. If + // non-empty, the subsequent call to Next will return a raw or RCDATA text + // token: one that treats "<p>" as text instead of an element. + // rawTag's contents are lower-cased. + rawTag string + // textIsRaw is whether the current text token's data is not escaped. + textIsRaw bool + // convertNUL is whether NUL bytes in the current token's data should + // be converted into \ufffd replacement characters. + convertNUL bool + // allowCDATA is whether CDATA sections are allowed in the current context. + allowCDATA bool +} + +// AllowCDATA sets whether or not the tokenizer recognizes <![CDATA[foo]]> as +// the text "foo". The default value is false, which means to recognize it as +// a bogus comment "<!-- [CDATA[foo]] -->" instead. +// +// Strictly speaking, an HTML5 compliant tokenizer should allow CDATA if and +// only if tokenizing foreign content, such as MathML and SVG. However, +// tracking foreign-contentness is difficult to do purely in the tokenizer, +// as opposed to the parser, due to HTML integration points: an <svg> element +// can contain a <foreignObject> that is foreign-to-SVG but not foreign-to- +// HTML. For strict compliance with the HTML5 tokenization algorithm, it is the +// responsibility of the user of a tokenizer to call AllowCDATA as appropriate. +// In practice, if using the tokenizer without caring whether MathML or SVG +// CDATA is text or comments, such as tokenizing HTML to find all the anchor +// text, it is acceptable to ignore this responsibility. +func (z *Tokenizer) AllowCDATA(allowCDATA bool) { + z.allowCDATA = allowCDATA +} + +// NextIsNotRawText instructs the tokenizer that the next token should not be +// considered as 'raw text'. Some elements, such as script and title elements, +// normally require the next token after the opening tag to be 'raw text' that +// has no child elements. For example, tokenizing "<title>a<b>c</b>d</title>" +// yields a start tag token for "<title>", a text token for "a<b>c</b>d", and +// an end tag token for "</title>". There are no distinct start tag or end tag +// tokens for the "<b>" and "</b>". +// +// This tokenizer implementation will generally look for raw text at the right +// times. Strictly speaking, an HTML5 compliant tokenizer should not look for +// raw text if in foreign content: <title> generally needs raw text, but a +// <title> inside an <svg> does not. Another example is that a <textarea> +// generally needs raw text, but a <textarea> is not allowed as an immediate +// child of a <select>; in normal parsing, a <textarea> implies </select>, but +// one cannot close the implicit element when parsing a <select>'s InnerHTML. +// Similarly to AllowCDATA, tracking the correct moment to override raw-text- +// ness is difficult to do purely in the tokenizer, as opposed to the parser. +// For strict compliance with the HTML5 tokenization algorithm, it is the +// responsibility of the user of a tokenizer to call NextIsNotRawText as +// appropriate. In practice, like AllowCDATA, it is acceptable to ignore this +// responsibility for basic usage. +// +// Note that this 'raw text' concept is different from the one offered by the +// Tokenizer.Raw method. +func (z *Tokenizer) NextIsNotRawText() { + z.rawTag = "" +} + +// Err returns the error associated with the most recent ErrorToken token. +// This is typically io.EOF, meaning the end of tokenization. +func (z *Tokenizer) Err() error { + if z.tt != ErrorToken { + return nil + } + return z.err +} + +// readByte returns the next byte from the input stream, doing a buffered read +// from z.r into z.buf if necessary. z.buf[z.raw.start:z.raw.end] remains a contiguous byte +// slice that holds all the bytes read so far for the current token. +// It sets z.err if the underlying reader returns an error. +// Pre-condition: z.err == nil. +func (z *Tokenizer) readByte() byte { + if z.raw.end >= len(z.buf) { + // Our buffer is exhausted and we have to read from z.r. Check if the + // previous read resulted in an error. + if z.readErr != nil { + z.err = z.readErr + return 0 + } + // We copy z.buf[z.raw.start:z.raw.end] to the beginning of z.buf. If the length + // z.raw.end - z.raw.start is more than half the capacity of z.buf, then we + // allocate a new buffer before the copy. + c := cap(z.buf) + d := z.raw.end - z.raw.start + var buf1 []byte + if 2*d > c { + buf1 = make([]byte, d, 2*c) + } else { + buf1 = z.buf[:d] + } + copy(buf1, z.buf[z.raw.start:z.raw.end]) + if x := z.raw.start; x != 0 { + // Adjust the data/attr spans to refer to the same contents after the copy. + z.data.start -= x + z.data.end -= x + z.pendingAttr[0].start -= x + z.pendingAttr[0].end -= x + z.pendingAttr[1].start -= x + z.pendingAttr[1].end -= x + for i := range z.attr { + z.attr[i][0].start -= x + z.attr[i][0].end -= x + z.attr[i][1].start -= x + z.attr[i][1].end -= x + } + } + z.raw.start, z.raw.end, z.buf = 0, d, buf1[:d] + // Now that we have copied the live bytes to the start of the buffer, + // we read from z.r into the remainder. + var n int + n, z.readErr = readAtLeastOneByte(z.r, buf1[d:cap(buf1)]) + if n == 0 { + z.err = z.readErr + return 0 + } + z.buf = buf1[:d+n] + } + x := z.buf[z.raw.end] + z.raw.end++ + if z.maxBuf > 0 && z.raw.end-z.raw.start >= z.maxBuf { + z.err = ErrBufferExceeded + return 0 + } + return x +} + +// Buffered returns a slice containing data buffered but not yet tokenized. +func (z *Tokenizer) Buffered() []byte { + return z.buf[z.raw.end:] +} + +// readAtLeastOneByte wraps an io.Reader so that reading cannot return (0, nil). +// It returns io.ErrNoProgress if the underlying r.Read method returns (0, nil) +// too many times in succession. +func readAtLeastOneByte(r io.Reader, b []byte) (int, error) { + for i := 0; i < 100; i++ { + if n, err := r.Read(b); n != 0 || err != nil { + return n, err + } + } + return 0, io.ErrNoProgress +} + +// skipWhiteSpace skips past any white space. +func (z *Tokenizer) skipWhiteSpace() { + if z.err != nil { + return + } + for { + c := z.readByte() + if z.err != nil { + return + } + switch c { + case ' ', '\n', '\r', '\t', '\f': + // No-op. + default: + z.raw.end-- + return + } + } +} + +// readRawOrRCDATA reads until the next "</foo>", where "foo" is z.rawTag and +// is typically something like "script" or "textarea". +func (z *Tokenizer) readRawOrRCDATA() { + if z.rawTag == "script" { + z.readScript() + z.textIsRaw = true + z.rawTag = "" + return + } +loop: + for { + c := z.readByte() + if z.err != nil { + break loop + } + if c != '<' { + continue loop + } + c = z.readByte() + if z.err != nil { + break loop + } + if c != '/' { + z.raw.end-- + continue loop + } + if z.readRawEndTag() || z.err != nil { + break loop + } + } + z.data.end = z.raw.end + // A textarea's or title's RCDATA can contain escaped entities. + z.textIsRaw = z.rawTag != "textarea" && z.rawTag != "title" + z.rawTag = "" +} + +// readRawEndTag attempts to read a tag like "</foo>", where "foo" is z.rawTag. +// If it succeeds, it backs up the input position to reconsume the tag and +// returns true. Otherwise it returns false. The opening "</" has already been +// consumed. +func (z *Tokenizer) readRawEndTag() bool { + for i := 0; i < len(z.rawTag); i++ { + c := z.readByte() + if z.err != nil { + return false + } + if c != z.rawTag[i] && c != z.rawTag[i]-('a'-'A') { + z.raw.end-- + return false + } + } + c := z.readByte() + if z.err != nil { + return false + } + switch c { + case ' ', '\n', '\r', '\t', '\f', '/', '>': + // The 3 is 2 for the leading "</" plus 1 for the trailing character c. + z.raw.end -= 3 + len(z.rawTag) + return true + } + z.raw.end-- + return false +} + +// readScript reads until the next </script> tag, following the byzantine +// rules for escaping/hiding the closing tag. +func (z *Tokenizer) readScript() { + defer func() { + z.data.end = z.raw.end + }() + var c byte + +scriptData: + c = z.readByte() + if z.err != nil { + return + } + if c == '<' { + goto scriptDataLessThanSign + } + goto scriptData + +scriptDataLessThanSign: + c = z.readByte() + if z.err != nil { + return + } + switch c { + case '/': + goto scriptDataEndTagOpen + case '!': + goto scriptDataEscapeStart + } + z.raw.end-- + goto scriptData + +scriptDataEndTagOpen: + if z.readRawEndTag() || z.err != nil { + return + } + goto scriptData + +scriptDataEscapeStart: + c = z.readByte() + if z.err != nil { + return + } + if c == '-' { + goto scriptDataEscapeStartDash + } + z.raw.end-- + goto scriptData + +scriptDataEscapeStartDash: + c = z.readByte() + if z.err != nil { + return + } + if c == '-' { + goto scriptDataEscapedDashDash + } + z.raw.end-- + goto scriptData + +scriptDataEscaped: + c = z.readByte() + if z.err != nil { + return + } + switch c { + case '-': + goto scriptDataEscapedDash + case '<': + goto scriptDataEscapedLessThanSign + } + goto scriptDataEscaped + +scriptDataEscapedDash: + c = z.readByte() + if z.err != nil { + return + } + switch c { + case '-': + goto scriptDataEscapedDashDash + case '<': + goto scriptDataEscapedLessThanSign + } + goto scriptDataEscaped + +scriptDataEscapedDashDash: + c = z.readByte() + if z.err != nil { + return + } + switch c { + case '-': + goto scriptDataEscapedDashDash + case '<': + goto scriptDataEscapedLessThanSign + case '>': + goto scriptData + } + goto scriptDataEscaped + +scriptDataEscapedLessThanSign: + c = z.readByte() + if z.err != nil { + return + } + if c == '/' { + goto scriptDataEscapedEndTagOpen + } + if 'a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' { + goto scriptDataDoubleEscapeStart + } + z.raw.end-- + goto scriptData + +scriptDataEscapedEndTagOpen: + if z.readRawEndTag() || z.err != nil { + return + } + goto scriptDataEscaped + +scriptDataDoubleEscapeStart: + z.raw.end-- + for i := 0; i < len("script"); i++ { + c = z.readByte() + if z.err != nil { + return + } + if c != "script"[i] && c != "SCRIPT"[i] { + z.raw.end-- + goto scriptDataEscaped + } + } + c = z.readByte() + if z.err != nil { + return + } + switch c { + case ' ', '\n', '\r', '\t', '\f', '/', '>': + goto scriptDataDoubleEscaped + } + z.raw.end-- + goto scriptDataEscaped + +scriptDataDoubleEscaped: + c = z.readByte() + if z.err != nil { + return + } + switch c { + case '-': + goto scriptDataDoubleEscapedDash + case '<': + goto scriptDataDoubleEscapedLessThanSign + } + goto scriptDataDoubleEscaped + +scriptDataDoubleEscapedDash: + c = z.readByte() + if z.err != nil { + return + } + switch c { + case '-': + goto scriptDataDoubleEscapedDashDash + case '<': + goto scriptDataDoubleEscapedLessThanSign + } + goto scriptDataDoubleEscaped + +scriptDataDoubleEscapedDashDash: + c = z.readByte() + if z.err != nil { + return + } + switch c { + case '-': + goto scriptDataDoubleEscapedDashDash + case '<': + goto scriptDataDoubleEscapedLessThanSign + case '>': + goto scriptData + } + goto scriptDataDoubleEscaped + +scriptDataDoubleEscapedLessThanSign: + c = z.readByte() + if z.err != nil { + return + } + if c == '/' { + goto scriptDataDoubleEscapeEnd + } + z.raw.end-- + goto scriptDataDoubleEscaped + +scriptDataDoubleEscapeEnd: + if z.readRawEndTag() { + z.raw.end += len("</script>") + goto scriptDataEscaped + } + if z.err != nil { + return + } + goto scriptDataDoubleEscaped +} + +// readComment reads the next comment token starting with "<!--". The opening +// "<!--" has already been consumed. +func (z *Tokenizer) readComment() { + // When modifying this function, consider manually increasing the + // maxSuffixLen constant in func TestComments, from 6 to e.g. 9 or more. + // That increase should only be temporary, not committed, as it + // exponentially affects the test running time. + + z.data.start = z.raw.end + defer func() { + if z.data.end < z.data.start { + // It's a comment with no data, like <!-->. + z.data.end = z.data.start + } + }() + + var dashCount int + beginning := true + for { + c := z.readByte() + if z.err != nil { + z.data.end = z.calculateAbruptCommentDataEnd() + return + } + switch c { + case '-': + dashCount++ + continue + case '>': + if dashCount >= 2 || beginning { + z.data.end = z.raw.end - len("-->") + return + } + case '!': + if dashCount >= 2 { + c = z.readByte() + if z.err != nil { + z.data.end = z.calculateAbruptCommentDataEnd() + return + } else if c == '>' { + z.data.end = z.raw.end - len("--!>") + return + } else if c == '-' { + dashCount = 1 + beginning = false + continue + } + } + } + dashCount = 0 + beginning = false + } +} + +func (z *Tokenizer) calculateAbruptCommentDataEnd() int { + raw := z.Raw() + const prefixLen = len("<!--") + if len(raw) >= prefixLen { + raw = raw[prefixLen:] + if hasSuffix(raw, "--!") { + return z.raw.end - 3 + } else if hasSuffix(raw, "--") { + return z.raw.end - 2 + } else if hasSuffix(raw, "-") { + return z.raw.end - 1 + } + } + return z.raw.end +} + +func hasSuffix(b []byte, suffix string) bool { + if len(b) < len(suffix) { + return false + } + b = b[len(b)-len(suffix):] + for i := range b { + if b[i] != suffix[i] { + return false + } + } + return true +} + +// readUntilCloseAngle reads until the next ">". +func (z *Tokenizer) readUntilCloseAngle() { + z.data.start = z.raw.end + for { + c := z.readByte() + if z.err != nil { + z.data.end = z.raw.end + return + } + if c == '>' { + z.data.end = z.raw.end - len(">") + return + } + } +} + +// readMarkupDeclaration reads the next token starting with "<!". It might be +// a "<!--comment-->", a "<!DOCTYPE foo>", a "<![CDATA[section]]>" or +// "<!a bogus comment". The opening "<!" has already been consumed. +func (z *Tokenizer) readMarkupDeclaration() TokenType { + z.data.start = z.raw.end + var c [2]byte + for i := 0; i < 2; i++ { + c[i] = z.readByte() + if z.err != nil { + z.data.end = z.raw.end + return CommentToken + } + } + if c[0] == '-' && c[1] == '-' { + z.readComment() + return CommentToken + } + z.raw.end -= 2 + if z.readDoctype() { + return DoctypeToken + } + if z.allowCDATA && z.readCDATA() { + z.convertNUL = true + return TextToken + } + // It's a bogus comment. + z.readUntilCloseAngle() + return CommentToken +} + +// readDoctype attempts to read a doctype declaration and returns true if +// successful. The opening "<!" has already been consumed. +func (z *Tokenizer) readDoctype() bool { + const s = "DOCTYPE" + for i := 0; i < len(s); i++ { + c := z.readByte() + if z.err != nil { + z.data.end = z.raw.end + return false + } + if c != s[i] && c != s[i]+('a'-'A') { + // Back up to read the fragment of "DOCTYPE" again. + z.raw.end = z.data.start + return false + } + } + if z.skipWhiteSpace(); z.err != nil { + z.data.start = z.raw.end + z.data.end = z.raw.end + return true + } + z.readUntilCloseAngle() + return true +} + +// readCDATA attempts to read a CDATA section and returns true if +// successful. The opening "<!" has already been consumed. +func (z *Tokenizer) readCDATA() bool { + const s = "[CDATA[" + for i := 0; i < len(s); i++ { + c := z.readByte() + if z.err != nil { + z.data.end = z.raw.end + return false + } + if c != s[i] { + // Back up to read the fragment of "[CDATA[" again. + z.raw.end = z.data.start + return false + } + } + z.data.start = z.raw.end + brackets := 0 + for { + c := z.readByte() + if z.err != nil { + z.data.end = z.raw.end + return true + } + switch c { + case ']': + brackets++ + case '>': + if brackets >= 2 { + z.data.end = z.raw.end - len("]]>") + return true + } + brackets = 0 + default: + brackets = 0 + } + } +} + +// startTagIn returns whether the start tag in z.buf[z.data.start:z.data.end] +// case-insensitively matches any element of ss. +func (z *Tokenizer) startTagIn(ss ...string) bool { +loop: + for _, s := range ss { + if z.data.end-z.data.start != len(s) { + continue loop + } + for i := 0; i < len(s); i++ { + c := z.buf[z.data.start+i] + if 'A' <= c && c <= 'Z' { + c += 'a' - 'A' + } + if c != s[i] { + continue loop + } + } + return true + } + return false +} + +// readStartTag reads the next start tag token. The opening "<a" has already +// been consumed, where 'a' means anything in [A-Za-z]. +func (z *Tokenizer) readStartTag() TokenType { + z.readTag(true) + if z.err != nil { + return ErrorToken + } + // Several tags flag the tokenizer's next token as raw. + c, raw := z.buf[z.data.start], false + if 'A' <= c && c <= 'Z' { + c += 'a' - 'A' + } + switch c { + case 'i': + raw = z.startTagIn("iframe") + case 'n': + raw = z.startTagIn("noembed", "noframes", "noscript") + case 'p': + raw = z.startTagIn("plaintext") + case 's': + raw = z.startTagIn("script", "style") + case 't': + raw = z.startTagIn("textarea", "title") + case 'x': + raw = z.startTagIn("xmp") + } + if raw { + z.rawTag = strings.ToLower(string(z.buf[z.data.start:z.data.end])) + } + // Look for a self-closing token (e.g. <br/>). + // + // Originally, we did this by just checking that the last character of the + // tag (ignoring the closing bracket) was a solidus (/) character, but this + // is not always accurate. + // + // We need to be careful that we don't misinterpret a non-self-closing tag + // as self-closing, as can happen if the tag contains unquoted attribute + // values (i.e. <p a=/>). + // + // To avoid this, we check that the last non-bracket character of the tag + // (z.raw.end-2) isn't the same character as the last non-quote character of + // the last attribute of the tag (z.pendingAttr[1].end-1), if the tag has + // attributes. + nAttrs := len(z.attr) + if z.err == nil && z.buf[z.raw.end-2] == '/' && (nAttrs == 0 || z.raw.end-2 != z.attr[nAttrs-1][1].end-1) { + return SelfClosingTagToken + } + return StartTagToken +} + +// readTag reads the next tag token and its attributes. If saveAttr, those +// attributes are saved in z.attr, otherwise z.attr is set to an empty slice. +// The opening "<a" or "</a" has already been consumed, where 'a' means anything +// in [A-Za-z]. +func (z *Tokenizer) readTag(saveAttr bool) { + z.attr = z.attr[:0] + z.nAttrReturned = 0 + // Read the tag name and attribute key/value pairs. + z.readTagName() + if z.skipWhiteSpace(); z.err != nil { + return + } + for { + c := z.readByte() + if z.err != nil || c == '>' { + break + } + z.raw.end-- + z.readTagAttrKey() + z.readTagAttrVal() + // Save pendingAttr if saveAttr and that attribute has a non-empty key. + if saveAttr && z.pendingAttr[0].start != z.pendingAttr[0].end { + z.attr = append(z.attr, z.pendingAttr) + } + if z.skipWhiteSpace(); z.err != nil { + break + } + } +} + +// readTagName sets z.data to the "div" in "<div k=v>". The reader (z.raw.end) +// is positioned such that the first byte of the tag name (the "d" in "<div") +// has already been consumed. +func (z *Tokenizer) readTagName() { + z.data.start = z.raw.end - 1 + for { + c := z.readByte() + if z.err != nil { + z.data.end = z.raw.end + return + } + switch c { + case ' ', '\n', '\r', '\t', '\f': + z.data.end = z.raw.end - 1 + return + case '/', '>': + z.raw.end-- + z.data.end = z.raw.end + return + } + } +} + +// readTagAttrKey sets z.pendingAttr[0] to the "k" in "<div k=v>". +// Precondition: z.err == nil. +func (z *Tokenizer) readTagAttrKey() { + z.pendingAttr[0].start = z.raw.end + for { + c := z.readByte() + if z.err != nil { + z.pendingAttr[0].end = z.raw.end + return + } + switch c { + case '=': + if z.pendingAttr[0].start+1 == z.raw.end { + // WHATWG 13.2.5.32, if we see an equals sign before the attribute name + // begins, we treat it as a character in the attribute name and continue. + continue + } + fallthrough + case ' ', '\n', '\r', '\t', '\f', '/', '>': + // WHATWG 13.2.5.33 Attribute name state + // We need to reconsume the char in the after attribute name state to support the / character + z.raw.end-- + z.pendingAttr[0].end = z.raw.end + return + } + } +} + +// readTagAttrVal sets z.pendingAttr[1] to the "v" in "<div k=v>". +func (z *Tokenizer) readTagAttrVal() { + z.pendingAttr[1].start = z.raw.end + z.pendingAttr[1].end = z.raw.end + if z.skipWhiteSpace(); z.err != nil { + return + } + c := z.readByte() + if z.err != nil { + return + } + if c == '/' { + // WHATWG 13.2.5.34 After attribute name state + // U+002F SOLIDUS (/) - Switch to the self-closing start tag state. + return + } + if c != '=' { + z.raw.end-- + return + } + if z.skipWhiteSpace(); z.err != nil { + return + } + quote := z.readByte() + if z.err != nil { + return + } + switch quote { + case '>': + z.raw.end-- + return + + case '\'', '"': + z.pendingAttr[1].start = z.raw.end + for { + c := z.readByte() + if z.err != nil { + z.pendingAttr[1].end = z.raw.end + return + } + if c == quote { + z.pendingAttr[1].end = z.raw.end - 1 + return + } + } + + default: + z.pendingAttr[1].start = z.raw.end - 1 + for { + c := z.readByte() + if z.err != nil { + z.pendingAttr[1].end = z.raw.end + return + } + switch c { + case ' ', '\n', '\r', '\t', '\f': + z.pendingAttr[1].end = z.raw.end - 1 + return + case '>': + z.raw.end-- + z.pendingAttr[1].end = z.raw.end + return + } + } + } +} + +// Next scans the next token and returns its type. +func (z *Tokenizer) Next() TokenType { + z.raw.start = z.raw.end + z.data.start = z.raw.end + z.data.end = z.raw.end + if z.err != nil { + z.tt = ErrorToken + return z.tt + } + if z.rawTag != "" { + if z.rawTag == "plaintext" { + // Read everything up to EOF. + for z.err == nil { + z.readByte() + } + z.data.end = z.raw.end + z.textIsRaw = true + } else { + z.readRawOrRCDATA() + } + if z.data.end > z.data.start { + z.tt = TextToken + z.convertNUL = true + return z.tt + } + } + z.textIsRaw = false + z.convertNUL = false + +loop: + for { + c := z.readByte() + if z.err != nil { + break loop + } + if c != '<' { + continue loop + } + + // Check if the '<' we have just read is part of a tag, comment + // or doctype. If not, it's part of the accumulated text token. + c = z.readByte() + if z.err != nil { + break loop + } + var tokenType TokenType + switch { + case 'a' <= c && c <= 'z' || 'A' <= c && c <= 'Z': + tokenType = StartTagToken + case c == '/': + tokenType = EndTagToken + case c == '!' || c == '?': + // We use CommentToken to mean any of "<!--actual comments-->", + // "<!DOCTYPE declarations>" and "<?xml processing instructions?>". + tokenType = CommentToken + default: + // Reconsume the current character. + z.raw.end-- + continue + } + + // We have a non-text token, but we might have accumulated some text + // before that. If so, we return the text first, and return the non- + // text token on the subsequent call to Next. + if x := z.raw.end - len("<a"); z.raw.start < x { + z.raw.end = x + z.data.end = x + z.tt = TextToken + return z.tt + } + switch tokenType { + case StartTagToken: + z.tt = z.readStartTag() + return z.tt + case EndTagToken: + c = z.readByte() + if z.err != nil { + break loop + } + if c == '>' { + // "</>" does not generate a token at all. Generate an empty comment + // to allow passthrough clients to pick up the data using Raw. + // Reset the tokenizer state and start again. + z.tt = CommentToken + return z.tt + } + if 'a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' { + z.readTag(false) + if z.err != nil { + z.tt = ErrorToken + } else { + z.tt = EndTagToken + } + return z.tt + } + z.raw.end-- + z.readUntilCloseAngle() + z.tt = CommentToken + return z.tt + case CommentToken: + if c == '!' { + z.tt = z.readMarkupDeclaration() + return z.tt + } + z.raw.end-- + z.readUntilCloseAngle() + z.tt = CommentToken + return z.tt + } + } + if z.raw.start < z.raw.end { + z.data.end = z.raw.end + z.tt = TextToken + return z.tt + } + z.tt = ErrorToken + return z.tt +} + +// Raw returns the unmodified text of the current token. Calling Next, Token, +// Text, TagName or TagAttr may change the contents of the returned slice. +// +// The token stream's raw bytes partition the byte stream (up until an +// ErrorToken). There are no overlaps or gaps between two consecutive token's +// raw bytes. One implication is that the byte offset of the current token is +// the sum of the lengths of all previous tokens' raw bytes. +func (z *Tokenizer) Raw() []byte { + return z.buf[z.raw.start:z.raw.end] +} + +// convertNewlines converts "\r" and "\r\n" in s to "\n". +// The conversion happens in place, but the resulting slice may be shorter. +func convertNewlines(s []byte) []byte { + for i, c := range s { + if c != '\r' { + continue + } + + src := i + 1 + if src >= len(s) || s[src] != '\n' { + s[i] = '\n' + continue + } + + dst := i + for src < len(s) { + if s[src] == '\r' { + if src+1 < len(s) && s[src+1] == '\n' { + src++ + } + s[dst] = '\n' + } else { + s[dst] = s[src] + } + src++ + dst++ + } + return s[:dst] + } + return s +} + +var ( + nul = []byte("\x00") + replacement = []byte("\ufffd") +) + +// Text returns the unescaped text of a text, comment or doctype token. The +// contents of the returned slice may change on the next call to Next. +func (z *Tokenizer) Text() []byte { + switch z.tt { + case TextToken, CommentToken, DoctypeToken: + s := z.buf[z.data.start:z.data.end] + z.data.start = z.raw.end + z.data.end = z.raw.end + s = convertNewlines(s) + if (z.convertNUL || z.tt == CommentToken) && bytes.Contains(s, nul) { + s = bytes.Replace(s, nul, replacement, -1) + } + if !z.textIsRaw { + s = unescape(s, false) + } + return s + } + return nil +} + +// TagName returns the lower-cased name of a tag token (the `img` out of +// `<IMG SRC="foo">`) and whether the tag has attributes. +// The contents of the returned slice may change on the next call to Next. +func (z *Tokenizer) TagName() (name []byte, hasAttr bool) { + if z.data.start < z.data.end { + switch z.tt { + case StartTagToken, EndTagToken, SelfClosingTagToken: + s := z.buf[z.data.start:z.data.end] + z.data.start = z.raw.end + z.data.end = z.raw.end + return lower(s), z.nAttrReturned < len(z.attr) + } + } + return nil, false +} + +// TagAttr returns the lower-cased key and unescaped value of the next unparsed +// attribute for the current tag token and whether there are more attributes. +// The contents of the returned slices may change on the next call to Next. +func (z *Tokenizer) TagAttr() (key, val []byte, moreAttr bool) { + if z.nAttrReturned < len(z.attr) { + switch z.tt { + case StartTagToken, SelfClosingTagToken: + x := z.attr[z.nAttrReturned] + z.nAttrReturned++ + key = z.buf[x[0].start:x[0].end] + val = z.buf[x[1].start:x[1].end] + return lower(key), unescape(convertNewlines(val), true), z.nAttrReturned < len(z.attr) + } + } + return nil, nil, false +} + +// Token returns the current Token. The result's Data and Attr values remain +// valid after subsequent Next calls. +func (z *Tokenizer) Token() Token { + t := Token{Type: z.tt} + switch z.tt { + case TextToken, CommentToken, DoctypeToken: + t.Data = string(z.Text()) + case StartTagToken, SelfClosingTagToken, EndTagToken: + name, moreAttr := z.TagName() + for moreAttr { + var key, val []byte + key, val, moreAttr = z.TagAttr() + t.Attr = append(t.Attr, Attribute{"", atom.String(key), string(val)}) + } + if a := atom.Lookup(name); a != 0 { + t.DataAtom, t.Data = a, a.String() + } else { + t.DataAtom, t.Data = 0, string(name) + } + } + return t +} + +// SetMaxBuf sets a limit on the amount of data buffered during tokenization. +// A value of 0 means unlimited. +func (z *Tokenizer) SetMaxBuf(n int) { + z.maxBuf = n +} + +// NewTokenizer returns a new HTML Tokenizer for the given Reader. +// The input is assumed to be UTF-8 encoded. +func NewTokenizer(r io.Reader) *Tokenizer { + return NewTokenizerFragment(r, "") +} + +// NewTokenizerFragment returns a new HTML Tokenizer for the given Reader, for +// tokenizing an existing element's InnerHTML fragment. contextTag is that +// element's tag, such as "div" or "iframe". +// +// For example, how the InnerHTML "a<b" is tokenized depends on whether it is +// for a <p> tag or a <script> tag. +// +// The input is assumed to be UTF-8 encoded. +func NewTokenizerFragment(r io.Reader, contextTag string) *Tokenizer { + z := &Tokenizer{ + r: r, + buf: make([]byte, 0, 4096), + } + if contextTag != "" { + switch s := strings.ToLower(contextTag); s { + case "iframe", "noembed", "noframes", "noscript", "plaintext", "script", "style", "title", "textarea", "xmp": + z.rawTag = s + } + } + return z +} diff --git a/vendor/golang.org/x/sys/cpu/asm_aix_ppc64.s b/vendor/golang.org/x/sys/cpu/asm_aix_ppc64.s new file mode 100644 index 00000000..269e173c --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/asm_aix_ppc64.s @@ -0,0 +1,17 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build gc + +#include "textflag.h" + +// +// System calls for ppc64, AIX are implemented in runtime/syscall_aix.go +// + +TEXT ·syscall6(SB),NOSPLIT,$0-88 + JMP syscall·syscall6(SB) + +TEXT ·rawSyscall6(SB),NOSPLIT,$0-88 + JMP syscall·rawSyscall6(SB) diff --git a/vendor/golang.org/x/sys/cpu/asm_darwin_x86_gc.s b/vendor/golang.org/x/sys/cpu/asm_darwin_x86_gc.s new file mode 100644 index 00000000..ec2acfe5 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/asm_darwin_x86_gc.s @@ -0,0 +1,17 @@ +// Copyright 2024 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build darwin && amd64 && gc + +#include "textflag.h" + +TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_sysctl(SB) +GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $8 +DATA ·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB) + +TEXT libc_sysctlbyname_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_sysctlbyname(SB) +GLOBL ·libc_sysctlbyname_trampoline_addr(SB), RODATA, $8 +DATA ·libc_sysctlbyname_trampoline_addr(SB)/8, $libc_sysctlbyname_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/cpu/byteorder.go b/vendor/golang.org/x/sys/cpu/byteorder.go new file mode 100644 index 00000000..271055be --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/byteorder.go @@ -0,0 +1,66 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cpu + +import ( + "runtime" +) + +// byteOrder is a subset of encoding/binary.ByteOrder. +type byteOrder interface { + Uint32([]byte) uint32 + Uint64([]byte) uint64 +} + +type littleEndian struct{} +type bigEndian struct{} + +func (littleEndian) Uint32(b []byte) uint32 { + _ = b[3] // bounds check hint to compiler; see golang.org/issue/14808 + return uint32(b[0]) | uint32(b[1])<<8 | uint32(b[2])<<16 | uint32(b[3])<<24 +} + +func (littleEndian) Uint64(b []byte) uint64 { + _ = b[7] // bounds check hint to compiler; see golang.org/issue/14808 + return uint64(b[0]) | uint64(b[1])<<8 | uint64(b[2])<<16 | uint64(b[3])<<24 | + uint64(b[4])<<32 | uint64(b[5])<<40 | uint64(b[6])<<48 | uint64(b[7])<<56 +} + +func (bigEndian) Uint32(b []byte) uint32 { + _ = b[3] // bounds check hint to compiler; see golang.org/issue/14808 + return uint32(b[3]) | uint32(b[2])<<8 | uint32(b[1])<<16 | uint32(b[0])<<24 +} + +func (bigEndian) Uint64(b []byte) uint64 { + _ = b[7] // bounds check hint to compiler; see golang.org/issue/14808 + return uint64(b[7]) | uint64(b[6])<<8 | uint64(b[5])<<16 | uint64(b[4])<<24 | + uint64(b[3])<<32 | uint64(b[2])<<40 | uint64(b[1])<<48 | uint64(b[0])<<56 +} + +// hostByteOrder returns littleEndian on little-endian machines and +// bigEndian on big-endian machines. +func hostByteOrder() byteOrder { + switch runtime.GOARCH { + case "386", "amd64", "amd64p32", + "alpha", + "arm", "arm64", + "loong64", + "mipsle", "mips64le", "mips64p32le", + "nios2", + "ppc64le", + "riscv", "riscv64", + "sh": + return littleEndian{} + case "armbe", "arm64be", + "m68k", + "mips", "mips64", "mips64p32", + "ppc", "ppc64", + "s390", "s390x", + "shbe", + "sparc", "sparc64": + return bigEndian{} + } + panic("unknown architecture") +} diff --git a/vendor/golang.org/x/sys/cpu/cpu.go b/vendor/golang.org/x/sys/cpu/cpu.go new file mode 100644 index 00000000..9c105f23 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu.go @@ -0,0 +1,315 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package cpu implements processor feature detection for +// various CPU architectures. +package cpu + +import ( + "os" + "strings" +) + +// Initialized reports whether the CPU features were initialized. +// +// For some GOOS/GOARCH combinations initialization of the CPU features depends +// on reading an operating specific file, e.g. /proc/self/auxv on linux/arm +// Initialized will report false if reading the file fails. +var Initialized bool + +// CacheLinePad is used to pad structs to avoid false sharing. +type CacheLinePad struct{ _ [cacheLineSize]byte } + +// X86 contains the supported CPU features of the +// current X86/AMD64 platform. If the current platform +// is not X86/AMD64 then all feature flags are false. +// +// X86 is padded to avoid false sharing. Further the HasAVX +// and HasAVX2 are only set if the OS supports XMM and YMM +// registers in addition to the CPUID feature bit being set. +var X86 struct { + _ CacheLinePad + HasAES bool // AES hardware implementation (AES NI) + HasADX bool // Multi-precision add-carry instruction extensions + HasAVX bool // Advanced vector extension + HasAVX2 bool // Advanced vector extension 2 + HasAVX512 bool // Advanced vector extension 512 + HasAVX512F bool // Advanced vector extension 512 Foundation Instructions + HasAVX512CD bool // Advanced vector extension 512 Conflict Detection Instructions + HasAVX512ER bool // Advanced vector extension 512 Exponential and Reciprocal Instructions + HasAVX512PF bool // Advanced vector extension 512 Prefetch Instructions + HasAVX512VL bool // Advanced vector extension 512 Vector Length Extensions + HasAVX512BW bool // Advanced vector extension 512 Byte and Word Instructions + HasAVX512DQ bool // Advanced vector extension 512 Doubleword and Quadword Instructions + HasAVX512IFMA bool // Advanced vector extension 512 Integer Fused Multiply Add + HasAVX512VBMI bool // Advanced vector extension 512 Vector Byte Manipulation Instructions + HasAVX5124VNNIW bool // Advanced vector extension 512 Vector Neural Network Instructions Word variable precision + HasAVX5124FMAPS bool // Advanced vector extension 512 Fused Multiply Accumulation Packed Single precision + HasAVX512VPOPCNTDQ bool // Advanced vector extension 512 Double and quad word population count instructions + HasAVX512VPCLMULQDQ bool // Advanced vector extension 512 Vector carry-less multiply operations + HasAVX512VNNI bool // Advanced vector extension 512 Vector Neural Network Instructions + HasAVX512GFNI bool // Advanced vector extension 512 Galois field New Instructions + HasAVX512VAES bool // Advanced vector extension 512 Vector AES instructions + HasAVX512VBMI2 bool // Advanced vector extension 512 Vector Byte Manipulation Instructions 2 + HasAVX512BITALG bool // Advanced vector extension 512 Bit Algorithms + HasAVX512BF16 bool // Advanced vector extension 512 BFloat16 Instructions + HasAMXTile bool // Advanced Matrix Extension Tile instructions + HasAMXInt8 bool // Advanced Matrix Extension Int8 instructions + HasAMXBF16 bool // Advanced Matrix Extension BFloat16 instructions + HasBMI1 bool // Bit manipulation instruction set 1 + HasBMI2 bool // Bit manipulation instruction set 2 + HasCX16 bool // Compare and exchange 16 Bytes + HasERMS bool // Enhanced REP for MOVSB and STOSB + HasFMA bool // Fused-multiply-add instructions + HasOSXSAVE bool // OS supports XSAVE/XRESTOR for saving/restoring XMM registers. + HasPCLMULQDQ bool // PCLMULQDQ instruction - most often used for AES-GCM + HasPOPCNT bool // Hamming weight instruction POPCNT. + HasRDRAND bool // RDRAND instruction (on-chip random number generator) + HasRDSEED bool // RDSEED instruction (on-chip random number generator) + HasSSE2 bool // Streaming SIMD extension 2 (always available on amd64) + HasSSE3 bool // Streaming SIMD extension 3 + HasSSSE3 bool // Supplemental streaming SIMD extension 3 + HasSSE41 bool // Streaming SIMD extension 4 and 4.1 + HasSSE42 bool // Streaming SIMD extension 4 and 4.2 + HasAVXIFMA bool // Advanced vector extension Integer Fused Multiply Add + HasAVXVNNI bool // Advanced vector extension Vector Neural Network Instructions + HasAVXVNNIInt8 bool // Advanced vector extension Vector Neural Network Int8 instructions + _ CacheLinePad +} + +// ARM64 contains the supported CPU features of the +// current ARMv8(aarch64) platform. If the current platform +// is not arm64 then all feature flags are false. +var ARM64 struct { + _ CacheLinePad + HasFP bool // Floating-point instruction set (always available) + HasASIMD bool // Advanced SIMD (always available) + HasEVTSTRM bool // Event stream support + HasAES bool // AES hardware implementation + HasPMULL bool // Polynomial multiplication instruction set + HasSHA1 bool // SHA1 hardware implementation + HasSHA2 bool // SHA2 hardware implementation + HasCRC32 bool // CRC32 hardware implementation + HasATOMICS bool // Atomic memory operation instruction set + HasFPHP bool // Half precision floating-point instruction set + HasASIMDHP bool // Advanced SIMD half precision instruction set + HasCPUID bool // CPUID identification scheme registers + HasASIMDRDM bool // Rounding double multiply add/subtract instruction set + HasJSCVT bool // Javascript conversion from floating-point to integer + HasFCMA bool // Floating-point multiplication and addition of complex numbers + HasLRCPC bool // Release Consistent processor consistent support + HasDCPOP bool // Persistent memory support + HasSHA3 bool // SHA3 hardware implementation + HasSM3 bool // SM3 hardware implementation + HasSM4 bool // SM4 hardware implementation + HasASIMDDP bool // Advanced SIMD double precision instruction set + HasSHA512 bool // SHA512 hardware implementation + HasSVE bool // Scalable Vector Extensions + HasSVE2 bool // Scalable Vector Extensions 2 + HasASIMDFHM bool // Advanced SIMD multiplication FP16 to FP32 + HasDIT bool // Data Independent Timing support + HasI8MM bool // Advanced SIMD Int8 matrix multiplication instructions + _ CacheLinePad +} + +// ARM contains the supported CPU features of the current ARM (32-bit) platform. +// All feature flags are false if: +// 1. the current platform is not arm, or +// 2. the current operating system is not Linux. +var ARM struct { + _ CacheLinePad + HasSWP bool // SWP instruction support + HasHALF bool // Half-word load and store support + HasTHUMB bool // ARM Thumb instruction set + Has26BIT bool // Address space limited to 26-bits + HasFASTMUL bool // 32-bit operand, 64-bit result multiplication support + HasFPA bool // Floating point arithmetic support + HasVFP bool // Vector floating point support + HasEDSP bool // DSP Extensions support + HasJAVA bool // Java instruction set + HasIWMMXT bool // Intel Wireless MMX technology support + HasCRUNCH bool // MaverickCrunch context switching and handling + HasTHUMBEE bool // Thumb EE instruction set + HasNEON bool // NEON instruction set + HasVFPv3 bool // Vector floating point version 3 support + HasVFPv3D16 bool // Vector floating point version 3 D8-D15 + HasTLS bool // Thread local storage support + HasVFPv4 bool // Vector floating point version 4 support + HasIDIVA bool // Integer divide instruction support in ARM mode + HasIDIVT bool // Integer divide instruction support in Thumb mode + HasVFPD32 bool // Vector floating point version 3 D15-D31 + HasLPAE bool // Large Physical Address Extensions + HasEVTSTRM bool // Event stream support + HasAES bool // AES hardware implementation + HasPMULL bool // Polynomial multiplication instruction set + HasSHA1 bool // SHA1 hardware implementation + HasSHA2 bool // SHA2 hardware implementation + HasCRC32 bool // CRC32 hardware implementation + _ CacheLinePad +} + +// MIPS64X contains the supported CPU features of the current mips64/mips64le +// platforms. If the current platform is not mips64/mips64le or the current +// operating system is not Linux then all feature flags are false. +var MIPS64X struct { + _ CacheLinePad + HasMSA bool // MIPS SIMD architecture + _ CacheLinePad +} + +// PPC64 contains the supported CPU features of the current ppc64/ppc64le platforms. +// If the current platform is not ppc64/ppc64le then all feature flags are false. +// +// For ppc64/ppc64le, it is safe to check only for ISA level starting on ISA v3.00, +// since there are no optional categories. There are some exceptions that also +// require kernel support to work (DARN, SCV), so there are feature bits for +// those as well. The struct is padded to avoid false sharing. +var PPC64 struct { + _ CacheLinePad + HasDARN bool // Hardware random number generator (requires kernel enablement) + HasSCV bool // Syscall vectored (requires kernel enablement) + IsPOWER8 bool // ISA v2.07 (POWER8) + IsPOWER9 bool // ISA v3.00 (POWER9), implies IsPOWER8 + _ CacheLinePad +} + +// S390X contains the supported CPU features of the current IBM Z +// (s390x) platform. If the current platform is not IBM Z then all +// feature flags are false. +// +// S390X is padded to avoid false sharing. Further HasVX is only set +// if the OS supports vector registers in addition to the STFLE +// feature bit being set. +var S390X struct { + _ CacheLinePad + HasZARCH bool // z/Architecture mode is active [mandatory] + HasSTFLE bool // store facility list extended + HasLDISP bool // long (20-bit) displacements + HasEIMM bool // 32-bit immediates + HasDFP bool // decimal floating point + HasETF3EH bool // ETF-3 enhanced + HasMSA bool // message security assist (CPACF) + HasAES bool // KM-AES{128,192,256} functions + HasAESCBC bool // KMC-AES{128,192,256} functions + HasAESCTR bool // KMCTR-AES{128,192,256} functions + HasAESGCM bool // KMA-GCM-AES{128,192,256} functions + HasGHASH bool // KIMD-GHASH function + HasSHA1 bool // K{I,L}MD-SHA-1 functions + HasSHA256 bool // K{I,L}MD-SHA-256 functions + HasSHA512 bool // K{I,L}MD-SHA-512 functions + HasSHA3 bool // K{I,L}MD-SHA3-{224,256,384,512} and K{I,L}MD-SHAKE-{128,256} functions + HasVX bool // vector facility + HasVXE bool // vector-enhancements facility 1 + _ CacheLinePad +} + +// RISCV64 contains the supported CPU features and performance characteristics for riscv64 +// platforms. The booleans in RISCV64, with the exception of HasFastMisaligned, indicate +// the presence of RISC-V extensions. +// +// It is safe to assume that all the RV64G extensions are supported and so they are omitted from +// this structure. As riscv64 Go programs require at least RV64G, the code that populates +// this structure cannot run successfully if some of the RV64G extensions are missing. +// The struct is padded to avoid false sharing. +var RISCV64 struct { + _ CacheLinePad + HasFastMisaligned bool // Fast misaligned accesses + HasC bool // Compressed instruction-set extension + HasV bool // Vector extension compatible with RVV 1.0 + HasZba bool // Address generation instructions extension + HasZbb bool // Basic bit-manipulation extension + HasZbs bool // Single-bit instructions extension + _ CacheLinePad +} + +func init() { + archInit() + initOptions() + processOptions() +} + +// options contains the cpu debug options that can be used in GODEBUG. +// Options are arch dependent and are added by the arch specific initOptions functions. +// Features that are mandatory for the specific GOARCH should have the Required field set +// (e.g. SSE2 on amd64). +var options []option + +// Option names should be lower case. e.g. avx instead of AVX. +type option struct { + Name string + Feature *bool + Specified bool // whether feature value was specified in GODEBUG + Enable bool // whether feature should be enabled + Required bool // whether feature is mandatory and can not be disabled +} + +func processOptions() { + env := os.Getenv("GODEBUG") +field: + for env != "" { + field := "" + i := strings.IndexByte(env, ',') + if i < 0 { + field, env = env, "" + } else { + field, env = env[:i], env[i+1:] + } + if len(field) < 4 || field[:4] != "cpu." { + continue + } + i = strings.IndexByte(field, '=') + if i < 0 { + print("GODEBUG sys/cpu: no value specified for \"", field, "\"\n") + continue + } + key, value := field[4:i], field[i+1:] // e.g. "SSE2", "on" + + var enable bool + switch value { + case "on": + enable = true + case "off": + enable = false + default: + print("GODEBUG sys/cpu: value \"", value, "\" not supported for cpu option \"", key, "\"\n") + continue field + } + + if key == "all" { + for i := range options { + options[i].Specified = true + options[i].Enable = enable || options[i].Required + } + continue field + } + + for i := range options { + if options[i].Name == key { + options[i].Specified = true + options[i].Enable = enable + continue field + } + } + + print("GODEBUG sys/cpu: unknown cpu feature \"", key, "\"\n") + } + + for _, o := range options { + if !o.Specified { + continue + } + + if o.Enable && !*o.Feature { + print("GODEBUG sys/cpu: can not enable \"", o.Name, "\", missing CPU support\n") + continue + } + + if !o.Enable && o.Required { + print("GODEBUG sys/cpu: can not disable \"", o.Name, "\", required CPU feature\n") + continue + } + + *o.Feature = o.Enable + } +} diff --git a/vendor/golang.org/x/sys/cpu/cpu_aix.go b/vendor/golang.org/x/sys/cpu/cpu_aix.go new file mode 100644 index 00000000..9bf0c32e --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_aix.go @@ -0,0 +1,33 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build aix + +package cpu + +const ( + // getsystemcfg constants + _SC_IMPL = 2 + _IMPL_POWER8 = 0x10000 + _IMPL_POWER9 = 0x20000 +) + +func archInit() { + impl := getsystemcfg(_SC_IMPL) + if impl&_IMPL_POWER8 != 0 { + PPC64.IsPOWER8 = true + } + if impl&_IMPL_POWER9 != 0 { + PPC64.IsPOWER8 = true + PPC64.IsPOWER9 = true + } + + Initialized = true +} + +func getsystemcfg(label int) (n uint64) { + r0, _ := callgetsystemcfg(label) + n = uint64(r0) + return +} diff --git a/vendor/golang.org/x/sys/cpu/cpu_arm.go b/vendor/golang.org/x/sys/cpu/cpu_arm.go new file mode 100644 index 00000000..301b752e --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_arm.go @@ -0,0 +1,73 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cpu + +const cacheLineSize = 32 + +// HWCAP/HWCAP2 bits. +// These are specific to Linux. +const ( + hwcap_SWP = 1 << 0 + hwcap_HALF = 1 << 1 + hwcap_THUMB = 1 << 2 + hwcap_26BIT = 1 << 3 + hwcap_FAST_MULT = 1 << 4 + hwcap_FPA = 1 << 5 + hwcap_VFP = 1 << 6 + hwcap_EDSP = 1 << 7 + hwcap_JAVA = 1 << 8 + hwcap_IWMMXT = 1 << 9 + hwcap_CRUNCH = 1 << 10 + hwcap_THUMBEE = 1 << 11 + hwcap_NEON = 1 << 12 + hwcap_VFPv3 = 1 << 13 + hwcap_VFPv3D16 = 1 << 14 + hwcap_TLS = 1 << 15 + hwcap_VFPv4 = 1 << 16 + hwcap_IDIVA = 1 << 17 + hwcap_IDIVT = 1 << 18 + hwcap_VFPD32 = 1 << 19 + hwcap_LPAE = 1 << 20 + hwcap_EVTSTRM = 1 << 21 + + hwcap2_AES = 1 << 0 + hwcap2_PMULL = 1 << 1 + hwcap2_SHA1 = 1 << 2 + hwcap2_SHA2 = 1 << 3 + hwcap2_CRC32 = 1 << 4 +) + +func initOptions() { + options = []option{ + {Name: "pmull", Feature: &ARM.HasPMULL}, + {Name: "sha1", Feature: &ARM.HasSHA1}, + {Name: "sha2", Feature: &ARM.HasSHA2}, + {Name: "swp", Feature: &ARM.HasSWP}, + {Name: "thumb", Feature: &ARM.HasTHUMB}, + {Name: "thumbee", Feature: &ARM.HasTHUMBEE}, + {Name: "tls", Feature: &ARM.HasTLS}, + {Name: "vfp", Feature: &ARM.HasVFP}, + {Name: "vfpd32", Feature: &ARM.HasVFPD32}, + {Name: "vfpv3", Feature: &ARM.HasVFPv3}, + {Name: "vfpv3d16", Feature: &ARM.HasVFPv3D16}, + {Name: "vfpv4", Feature: &ARM.HasVFPv4}, + {Name: "half", Feature: &ARM.HasHALF}, + {Name: "26bit", Feature: &ARM.Has26BIT}, + {Name: "fastmul", Feature: &ARM.HasFASTMUL}, + {Name: "fpa", Feature: &ARM.HasFPA}, + {Name: "edsp", Feature: &ARM.HasEDSP}, + {Name: "java", Feature: &ARM.HasJAVA}, + {Name: "iwmmxt", Feature: &ARM.HasIWMMXT}, + {Name: "crunch", Feature: &ARM.HasCRUNCH}, + {Name: "neon", Feature: &ARM.HasNEON}, + {Name: "idivt", Feature: &ARM.HasIDIVT}, + {Name: "idiva", Feature: &ARM.HasIDIVA}, + {Name: "lpae", Feature: &ARM.HasLPAE}, + {Name: "evtstrm", Feature: &ARM.HasEVTSTRM}, + {Name: "aes", Feature: &ARM.HasAES}, + {Name: "crc32", Feature: &ARM.HasCRC32}, + } + +} diff --git a/vendor/golang.org/x/sys/cpu/cpu_arm64.go b/vendor/golang.org/x/sys/cpu/cpu_arm64.go new file mode 100644 index 00000000..af2aa99f --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_arm64.go @@ -0,0 +1,194 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cpu + +import "runtime" + +// cacheLineSize is used to prevent false sharing of cache lines. +// We choose 128 because Apple Silicon, a.k.a. M1, has 128-byte cache line size. +// It doesn't cost much and is much more future-proof. +const cacheLineSize = 128 + +func initOptions() { + options = []option{ + {Name: "fp", Feature: &ARM64.HasFP}, + {Name: "asimd", Feature: &ARM64.HasASIMD}, + {Name: "evstrm", Feature: &ARM64.HasEVTSTRM}, + {Name: "aes", Feature: &ARM64.HasAES}, + {Name: "fphp", Feature: &ARM64.HasFPHP}, + {Name: "jscvt", Feature: &ARM64.HasJSCVT}, + {Name: "lrcpc", Feature: &ARM64.HasLRCPC}, + {Name: "pmull", Feature: &ARM64.HasPMULL}, + {Name: "sha1", Feature: &ARM64.HasSHA1}, + {Name: "sha2", Feature: &ARM64.HasSHA2}, + {Name: "sha3", Feature: &ARM64.HasSHA3}, + {Name: "sha512", Feature: &ARM64.HasSHA512}, + {Name: "sm3", Feature: &ARM64.HasSM3}, + {Name: "sm4", Feature: &ARM64.HasSM4}, + {Name: "sve", Feature: &ARM64.HasSVE}, + {Name: "sve2", Feature: &ARM64.HasSVE2}, + {Name: "crc32", Feature: &ARM64.HasCRC32}, + {Name: "atomics", Feature: &ARM64.HasATOMICS}, + {Name: "asimdhp", Feature: &ARM64.HasASIMDHP}, + {Name: "cpuid", Feature: &ARM64.HasCPUID}, + {Name: "asimrdm", Feature: &ARM64.HasASIMDRDM}, + {Name: "fcma", Feature: &ARM64.HasFCMA}, + {Name: "dcpop", Feature: &ARM64.HasDCPOP}, + {Name: "asimddp", Feature: &ARM64.HasASIMDDP}, + {Name: "asimdfhm", Feature: &ARM64.HasASIMDFHM}, + {Name: "dit", Feature: &ARM64.HasDIT}, + {Name: "i8mm", Feature: &ARM64.HasI8MM}, + } +} + +func archInit() { + switch runtime.GOOS { + case "freebsd": + readARM64Registers() + case "linux", "netbsd", "openbsd": + doinit() + default: + // Many platforms don't seem to allow reading these registers. + setMinimalFeatures() + } +} + +// setMinimalFeatures fakes the minimal ARM64 features expected by +// TestARM64minimalFeatures. +func setMinimalFeatures() { + ARM64.HasASIMD = true + ARM64.HasFP = true +} + +func readARM64Registers() { + Initialized = true + + parseARM64SystemRegisters(getisar0(), getisar1(), getpfr0()) +} + +func parseARM64SystemRegisters(isar0, isar1, pfr0 uint64) { + // ID_AA64ISAR0_EL1 + switch extractBits(isar0, 4, 7) { + case 1: + ARM64.HasAES = true + case 2: + ARM64.HasAES = true + ARM64.HasPMULL = true + } + + switch extractBits(isar0, 8, 11) { + case 1: + ARM64.HasSHA1 = true + } + + switch extractBits(isar0, 12, 15) { + case 1: + ARM64.HasSHA2 = true + case 2: + ARM64.HasSHA2 = true + ARM64.HasSHA512 = true + } + + switch extractBits(isar0, 16, 19) { + case 1: + ARM64.HasCRC32 = true + } + + switch extractBits(isar0, 20, 23) { + case 2: + ARM64.HasATOMICS = true + } + + switch extractBits(isar0, 28, 31) { + case 1: + ARM64.HasASIMDRDM = true + } + + switch extractBits(isar0, 32, 35) { + case 1: + ARM64.HasSHA3 = true + } + + switch extractBits(isar0, 36, 39) { + case 1: + ARM64.HasSM3 = true + } + + switch extractBits(isar0, 40, 43) { + case 1: + ARM64.HasSM4 = true + } + + switch extractBits(isar0, 44, 47) { + case 1: + ARM64.HasASIMDDP = true + } + + // ID_AA64ISAR1_EL1 + switch extractBits(isar1, 0, 3) { + case 1: + ARM64.HasDCPOP = true + } + + switch extractBits(isar1, 12, 15) { + case 1: + ARM64.HasJSCVT = true + } + + switch extractBits(isar1, 16, 19) { + case 1: + ARM64.HasFCMA = true + } + + switch extractBits(isar1, 20, 23) { + case 1: + ARM64.HasLRCPC = true + } + + switch extractBits(isar1, 52, 55) { + case 1: + ARM64.HasI8MM = true + } + + // ID_AA64PFR0_EL1 + switch extractBits(pfr0, 16, 19) { + case 0: + ARM64.HasFP = true + case 1: + ARM64.HasFP = true + ARM64.HasFPHP = true + } + + switch extractBits(pfr0, 20, 23) { + case 0: + ARM64.HasASIMD = true + case 1: + ARM64.HasASIMD = true + ARM64.HasASIMDHP = true + } + + switch extractBits(pfr0, 32, 35) { + case 1: + ARM64.HasSVE = true + + parseARM64SVERegister(getzfr0()) + } + + switch extractBits(pfr0, 48, 51) { + case 1: + ARM64.HasDIT = true + } +} + +func parseARM64SVERegister(zfr0 uint64) { + switch extractBits(zfr0, 0, 3) { + case 1: + ARM64.HasSVE2 = true + } +} + +func extractBits(data uint64, start, end uint) uint { + return (uint)(data>>start) & ((1 << (end - start + 1)) - 1) +} diff --git a/vendor/golang.org/x/sys/cpu/cpu_arm64.s b/vendor/golang.org/x/sys/cpu/cpu_arm64.s new file mode 100644 index 00000000..22cc9984 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_arm64.s @@ -0,0 +1,39 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build gc + +#include "textflag.h" + +// func getisar0() uint64 +TEXT ·getisar0(SB),NOSPLIT,$0-8 + // get Instruction Set Attributes 0 into x0 + // mrs x0, ID_AA64ISAR0_EL1 = d5380600 + WORD $0xd5380600 + MOVD R0, ret+0(FP) + RET + +// func getisar1() uint64 +TEXT ·getisar1(SB),NOSPLIT,$0-8 + // get Instruction Set Attributes 1 into x0 + // mrs x0, ID_AA64ISAR1_EL1 = d5380620 + WORD $0xd5380620 + MOVD R0, ret+0(FP) + RET + +// func getpfr0() uint64 +TEXT ·getpfr0(SB),NOSPLIT,$0-8 + // get Processor Feature Register 0 into x0 + // mrs x0, ID_AA64PFR0_EL1 = d5380400 + WORD $0xd5380400 + MOVD R0, ret+0(FP) + RET + +// func getzfr0() uint64 +TEXT ·getzfr0(SB),NOSPLIT,$0-8 + // get SVE Feature Register 0 into x0 + // mrs x0, ID_AA64ZFR0_EL1 = d5380480 + WORD $0xd5380480 + MOVD R0, ret+0(FP) + RET diff --git a/vendor/golang.org/x/sys/cpu/cpu_darwin_x86.go b/vendor/golang.org/x/sys/cpu/cpu_darwin_x86.go new file mode 100644 index 00000000..b838cb9e --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_darwin_x86.go @@ -0,0 +1,61 @@ +// Copyright 2024 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build darwin && amd64 && gc + +package cpu + +// darwinSupportsAVX512 checks Darwin kernel for AVX512 support via sysctl +// call (see issue 43089). It also restricts AVX512 support for Darwin to +// kernel version 21.3.0 (MacOS 12.2.0) or later (see issue 49233). +// +// Background: +// Darwin implements a special mechanism to economize on thread state when +// AVX512 specific registers are not in use. This scheme minimizes state when +// preempting threads that haven't yet used any AVX512 instructions, but adds +// special requirements to check for AVX512 hardware support at runtime (e.g. +// via sysctl call or commpage inspection). See issue 43089 and link below for +// full background: +// https://github.com/apple-oss-distributions/xnu/blob/xnu-11215.1.10/osfmk/i386/fpu.c#L214-L240 +// +// Additionally, all versions of the Darwin kernel from 19.6.0 through 21.2.0 +// (corresponding to MacOS 10.15.6 - 12.1) have a bug that can cause corruption +// of the AVX512 mask registers (K0-K7) upon signal return. For this reason +// AVX512 is considered unsafe to use on Darwin for kernel versions prior to +// 21.3.0, where a fix has been confirmed. See issue 49233 for full background. +func darwinSupportsAVX512() bool { + return darwinSysctlEnabled([]byte("hw.optional.avx512f\x00")) && darwinKernelVersionCheck(21, 3, 0) +} + +// Ensure Darwin kernel version is at least major.minor.patch, avoiding dependencies +func darwinKernelVersionCheck(major, minor, patch int) bool { + var release [256]byte + err := darwinOSRelease(&release) + if err != nil { + return false + } + + var mmp [3]int + c := 0 +Loop: + for _, b := range release[:] { + switch { + case b >= '0' && b <= '9': + mmp[c] = 10*mmp[c] + int(b-'0') + case b == '.': + c++ + if c > 2 { + return false + } + case b == 0: + break Loop + default: + return false + } + } + if c != 2 { + return false + } + return mmp[0] > major || mmp[0] == major && (mmp[1] > minor || mmp[1] == minor && mmp[2] >= patch) +} diff --git a/vendor/golang.org/x/sys/cpu/cpu_gc_arm64.go b/vendor/golang.org/x/sys/cpu/cpu_gc_arm64.go new file mode 100644 index 00000000..6ac6e1ef --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_gc_arm64.go @@ -0,0 +1,12 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build gc + +package cpu + +func getisar0() uint64 +func getisar1() uint64 +func getpfr0() uint64 +func getzfr0() uint64 diff --git a/vendor/golang.org/x/sys/cpu/cpu_gc_s390x.go b/vendor/golang.org/x/sys/cpu/cpu_gc_s390x.go new file mode 100644 index 00000000..c8ae6ddc --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_gc_s390x.go @@ -0,0 +1,21 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build gc + +package cpu + +// haveAsmFunctions reports whether the other functions in this file can +// be safely called. +func haveAsmFunctions() bool { return true } + +// The following feature detection functions are defined in cpu_s390x.s. +// They are likely to be expensive to call so the results should be cached. +func stfle() facilityList +func kmQuery() queryResult +func kmcQuery() queryResult +func kmctrQuery() queryResult +func kmaQuery() queryResult +func kimdQuery() queryResult +func klmdQuery() queryResult diff --git a/vendor/golang.org/x/sys/cpu/cpu_gc_x86.go b/vendor/golang.org/x/sys/cpu/cpu_gc_x86.go new file mode 100644 index 00000000..32a44514 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_gc_x86.go @@ -0,0 +1,15 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build (386 || amd64 || amd64p32) && gc + +package cpu + +// cpuid is implemented in cpu_gc_x86.s for gc compiler +// and in cpu_gccgo.c for gccgo. +func cpuid(eaxArg, ecxArg uint32) (eax, ebx, ecx, edx uint32) + +// xgetbv with ecx = 0 is implemented in cpu_gc_x86.s for gc compiler +// and in cpu_gccgo.c for gccgo. +func xgetbv() (eax, edx uint32) diff --git a/vendor/golang.org/x/sys/cpu/cpu_gc_x86.s b/vendor/golang.org/x/sys/cpu/cpu_gc_x86.s new file mode 100644 index 00000000..ce208ce6 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_gc_x86.s @@ -0,0 +1,26 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build (386 || amd64 || amd64p32) && gc + +#include "textflag.h" + +// func cpuid(eaxArg, ecxArg uint32) (eax, ebx, ecx, edx uint32) +TEXT ·cpuid(SB), NOSPLIT, $0-24 + MOVL eaxArg+0(FP), AX + MOVL ecxArg+4(FP), CX + CPUID + MOVL AX, eax+8(FP) + MOVL BX, ebx+12(FP) + MOVL CX, ecx+16(FP) + MOVL DX, edx+20(FP) + RET + +// func xgetbv() (eax, edx uint32) +TEXT ·xgetbv(SB), NOSPLIT, $0-8 + MOVL $0, CX + XGETBV + MOVL AX, eax+0(FP) + MOVL DX, edx+4(FP) + RET diff --git a/vendor/golang.org/x/sys/cpu/cpu_gccgo_arm64.go b/vendor/golang.org/x/sys/cpu/cpu_gccgo_arm64.go new file mode 100644 index 00000000..7f194678 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_gccgo_arm64.go @@ -0,0 +1,11 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build gccgo + +package cpu + +func getisar0() uint64 { return 0 } +func getisar1() uint64 { return 0 } +func getpfr0() uint64 { return 0 } diff --git a/vendor/golang.org/x/sys/cpu/cpu_gccgo_s390x.go b/vendor/golang.org/x/sys/cpu/cpu_gccgo_s390x.go new file mode 100644 index 00000000..9526d2ce --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_gccgo_s390x.go @@ -0,0 +1,22 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build gccgo + +package cpu + +// haveAsmFunctions reports whether the other functions in this file can +// be safely called. +func haveAsmFunctions() bool { return false } + +// TODO(mundaym): the following feature detection functions are currently +// stubs. See https://golang.org/cl/162887 for how to fix this. +// They are likely to be expensive to call so the results should be cached. +func stfle() facilityList { panic("not implemented for gccgo") } +func kmQuery() queryResult { panic("not implemented for gccgo") } +func kmcQuery() queryResult { panic("not implemented for gccgo") } +func kmctrQuery() queryResult { panic("not implemented for gccgo") } +func kmaQuery() queryResult { panic("not implemented for gccgo") } +func kimdQuery() queryResult { panic("not implemented for gccgo") } +func klmdQuery() queryResult { panic("not implemented for gccgo") } diff --git a/vendor/golang.org/x/sys/cpu/cpu_gccgo_x86.c b/vendor/golang.org/x/sys/cpu/cpu_gccgo_x86.c new file mode 100644 index 00000000..3f73a05d --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_gccgo_x86.c @@ -0,0 +1,37 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build (386 || amd64 || amd64p32) && gccgo + +#include <cpuid.h> +#include <stdint.h> +#include <x86intrin.h> + +// Need to wrap __get_cpuid_count because it's declared as static. +int +gccgoGetCpuidCount(uint32_t leaf, uint32_t subleaf, + uint32_t *eax, uint32_t *ebx, + uint32_t *ecx, uint32_t *edx) +{ + return __get_cpuid_count(leaf, subleaf, eax, ebx, ecx, edx); +} + +#pragma GCC diagnostic ignored "-Wunknown-pragmas" +#pragma GCC push_options +#pragma GCC target("xsave") +#pragma clang attribute push (__attribute__((target("xsave"))), apply_to=function) + +// xgetbv reads the contents of an XCR (Extended Control Register) +// specified in the ECX register into registers EDX:EAX. +// Currently, the only supported value for XCR is 0. +void +gccgoXgetbv(uint32_t *eax, uint32_t *edx) +{ + uint64_t v = _xgetbv(0); + *eax = v & 0xffffffff; + *edx = v >> 32; +} + +#pragma clang attribute pop +#pragma GCC pop_options diff --git a/vendor/golang.org/x/sys/cpu/cpu_gccgo_x86.go b/vendor/golang.org/x/sys/cpu/cpu_gccgo_x86.go new file mode 100644 index 00000000..170d21dd --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_gccgo_x86.go @@ -0,0 +1,25 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build (386 || amd64 || amd64p32) && gccgo + +package cpu + +//extern gccgoGetCpuidCount +func gccgoGetCpuidCount(eaxArg, ecxArg uint32, eax, ebx, ecx, edx *uint32) + +func cpuid(eaxArg, ecxArg uint32) (eax, ebx, ecx, edx uint32) { + var a, b, c, d uint32 + gccgoGetCpuidCount(eaxArg, ecxArg, &a, &b, &c, &d) + return a, b, c, d +} + +//extern gccgoXgetbv +func gccgoXgetbv(eax, edx *uint32) + +func xgetbv() (eax, edx uint32) { + var a, d uint32 + gccgoXgetbv(&a, &d) + return a, d +} diff --git a/vendor/golang.org/x/sys/cpu/cpu_linux.go b/vendor/golang.org/x/sys/cpu/cpu_linux.go new file mode 100644 index 00000000..743eb543 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_linux.go @@ -0,0 +1,15 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build !386 && !amd64 && !amd64p32 && !arm64 + +package cpu + +func archInit() { + if err := readHWCAP(); err != nil { + return + } + doinit() + Initialized = true +} diff --git a/vendor/golang.org/x/sys/cpu/cpu_linux_arm.go b/vendor/golang.org/x/sys/cpu/cpu_linux_arm.go new file mode 100644 index 00000000..2057006d --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_linux_arm.go @@ -0,0 +1,39 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cpu + +func doinit() { + ARM.HasSWP = isSet(hwCap, hwcap_SWP) + ARM.HasHALF = isSet(hwCap, hwcap_HALF) + ARM.HasTHUMB = isSet(hwCap, hwcap_THUMB) + ARM.Has26BIT = isSet(hwCap, hwcap_26BIT) + ARM.HasFASTMUL = isSet(hwCap, hwcap_FAST_MULT) + ARM.HasFPA = isSet(hwCap, hwcap_FPA) + ARM.HasVFP = isSet(hwCap, hwcap_VFP) + ARM.HasEDSP = isSet(hwCap, hwcap_EDSP) + ARM.HasJAVA = isSet(hwCap, hwcap_JAVA) + ARM.HasIWMMXT = isSet(hwCap, hwcap_IWMMXT) + ARM.HasCRUNCH = isSet(hwCap, hwcap_CRUNCH) + ARM.HasTHUMBEE = isSet(hwCap, hwcap_THUMBEE) + ARM.HasNEON = isSet(hwCap, hwcap_NEON) + ARM.HasVFPv3 = isSet(hwCap, hwcap_VFPv3) + ARM.HasVFPv3D16 = isSet(hwCap, hwcap_VFPv3D16) + ARM.HasTLS = isSet(hwCap, hwcap_TLS) + ARM.HasVFPv4 = isSet(hwCap, hwcap_VFPv4) + ARM.HasIDIVA = isSet(hwCap, hwcap_IDIVA) + ARM.HasIDIVT = isSet(hwCap, hwcap_IDIVT) + ARM.HasVFPD32 = isSet(hwCap, hwcap_VFPD32) + ARM.HasLPAE = isSet(hwCap, hwcap_LPAE) + ARM.HasEVTSTRM = isSet(hwCap, hwcap_EVTSTRM) + ARM.HasAES = isSet(hwCap2, hwcap2_AES) + ARM.HasPMULL = isSet(hwCap2, hwcap2_PMULL) + ARM.HasSHA1 = isSet(hwCap2, hwcap2_SHA1) + ARM.HasSHA2 = isSet(hwCap2, hwcap2_SHA2) + ARM.HasCRC32 = isSet(hwCap2, hwcap2_CRC32) +} + +func isSet(hwc uint, value uint) bool { + return hwc&value != 0 +} diff --git a/vendor/golang.org/x/sys/cpu/cpu_linux_arm64.go b/vendor/golang.org/x/sys/cpu/cpu_linux_arm64.go new file mode 100644 index 00000000..f1caf0f7 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_linux_arm64.go @@ -0,0 +1,120 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cpu + +import ( + "strings" + "syscall" +) + +// HWCAP/HWCAP2 bits. These are exposed by Linux. +const ( + hwcap_FP = 1 << 0 + hwcap_ASIMD = 1 << 1 + hwcap_EVTSTRM = 1 << 2 + hwcap_AES = 1 << 3 + hwcap_PMULL = 1 << 4 + hwcap_SHA1 = 1 << 5 + hwcap_SHA2 = 1 << 6 + hwcap_CRC32 = 1 << 7 + hwcap_ATOMICS = 1 << 8 + hwcap_FPHP = 1 << 9 + hwcap_ASIMDHP = 1 << 10 + hwcap_CPUID = 1 << 11 + hwcap_ASIMDRDM = 1 << 12 + hwcap_JSCVT = 1 << 13 + hwcap_FCMA = 1 << 14 + hwcap_LRCPC = 1 << 15 + hwcap_DCPOP = 1 << 16 + hwcap_SHA3 = 1 << 17 + hwcap_SM3 = 1 << 18 + hwcap_SM4 = 1 << 19 + hwcap_ASIMDDP = 1 << 20 + hwcap_SHA512 = 1 << 21 + hwcap_SVE = 1 << 22 + hwcap_ASIMDFHM = 1 << 23 + hwcap_DIT = 1 << 24 + + hwcap2_SVE2 = 1 << 1 + hwcap2_I8MM = 1 << 13 +) + +// linuxKernelCanEmulateCPUID reports whether we're running +// on Linux 4.11+. Ideally we'd like to ask the question about +// whether the current kernel contains +// https://git.kernel.org/pub/scm/linux/kernel/git/torvalds/linux.git/commit/?id=77c97b4ee21290f5f083173d957843b615abbff2 +// but the version number will have to do. +func linuxKernelCanEmulateCPUID() bool { + var un syscall.Utsname + syscall.Uname(&un) + var sb strings.Builder + for _, b := range un.Release[:] { + if b == 0 { + break + } + sb.WriteByte(byte(b)) + } + major, minor, _, ok := parseRelease(sb.String()) + return ok && (major > 4 || major == 4 && minor >= 11) +} + +func doinit() { + if err := readHWCAP(); err != nil { + // We failed to read /proc/self/auxv. This can happen if the binary has + // been given extra capabilities(7) with /bin/setcap. + // + // When this happens, we have two options. If the Linux kernel is new + // enough (4.11+), we can read the arm64 registers directly which'll + // trap into the kernel and then return back to userspace. + // + // But on older kernels, such as Linux 4.4.180 as used on many Synology + // devices, calling readARM64Registers (specifically getisar0) will + // cause a SIGILL and we'll die. So for older kernels, parse /proc/cpuinfo + // instead. + // + // See golang/go#57336. + if linuxKernelCanEmulateCPUID() { + readARM64Registers() + } else { + readLinuxProcCPUInfo() + } + return + } + + // HWCAP feature bits + ARM64.HasFP = isSet(hwCap, hwcap_FP) + ARM64.HasASIMD = isSet(hwCap, hwcap_ASIMD) + ARM64.HasEVTSTRM = isSet(hwCap, hwcap_EVTSTRM) + ARM64.HasAES = isSet(hwCap, hwcap_AES) + ARM64.HasPMULL = isSet(hwCap, hwcap_PMULL) + ARM64.HasSHA1 = isSet(hwCap, hwcap_SHA1) + ARM64.HasSHA2 = isSet(hwCap, hwcap_SHA2) + ARM64.HasCRC32 = isSet(hwCap, hwcap_CRC32) + ARM64.HasATOMICS = isSet(hwCap, hwcap_ATOMICS) + ARM64.HasFPHP = isSet(hwCap, hwcap_FPHP) + ARM64.HasASIMDHP = isSet(hwCap, hwcap_ASIMDHP) + ARM64.HasCPUID = isSet(hwCap, hwcap_CPUID) + ARM64.HasASIMDRDM = isSet(hwCap, hwcap_ASIMDRDM) + ARM64.HasJSCVT = isSet(hwCap, hwcap_JSCVT) + ARM64.HasFCMA = isSet(hwCap, hwcap_FCMA) + ARM64.HasLRCPC = isSet(hwCap, hwcap_LRCPC) + ARM64.HasDCPOP = isSet(hwCap, hwcap_DCPOP) + ARM64.HasSHA3 = isSet(hwCap, hwcap_SHA3) + ARM64.HasSM3 = isSet(hwCap, hwcap_SM3) + ARM64.HasSM4 = isSet(hwCap, hwcap_SM4) + ARM64.HasASIMDDP = isSet(hwCap, hwcap_ASIMDDP) + ARM64.HasSHA512 = isSet(hwCap, hwcap_SHA512) + ARM64.HasSVE = isSet(hwCap, hwcap_SVE) + ARM64.HasASIMDFHM = isSet(hwCap, hwcap_ASIMDFHM) + ARM64.HasDIT = isSet(hwCap, hwcap_DIT) + + // HWCAP2 feature bits + ARM64.HasSVE2 = isSet(hwCap2, hwcap2_SVE2) + ARM64.HasI8MM = isSet(hwCap2, hwcap2_I8MM) +} + +func isSet(hwc uint, value uint) bool { + return hwc&value != 0 +} diff --git a/vendor/golang.org/x/sys/cpu/cpu_linux_mips64x.go b/vendor/golang.org/x/sys/cpu/cpu_linux_mips64x.go new file mode 100644 index 00000000..4686c1d5 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_linux_mips64x.go @@ -0,0 +1,22 @@ +// Copyright 2020 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build linux && (mips64 || mips64le) + +package cpu + +// HWCAP bits. These are exposed by the Linux kernel 5.4. +const ( + // CPU features + hwcap_MIPS_MSA = 1 << 1 +) + +func doinit() { + // HWCAP feature bits + MIPS64X.HasMSA = isSet(hwCap, hwcap_MIPS_MSA) +} + +func isSet(hwc uint, value uint) bool { + return hwc&value != 0 +} diff --git a/vendor/golang.org/x/sys/cpu/cpu_linux_noinit.go b/vendor/golang.org/x/sys/cpu/cpu_linux_noinit.go new file mode 100644 index 00000000..7d902b68 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_linux_noinit.go @@ -0,0 +1,9 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build linux && !arm && !arm64 && !mips64 && !mips64le && !ppc64 && !ppc64le && !s390x && !riscv64 + +package cpu + +func doinit() {} diff --git a/vendor/golang.org/x/sys/cpu/cpu_linux_ppc64x.go b/vendor/golang.org/x/sys/cpu/cpu_linux_ppc64x.go new file mode 100644 index 00000000..197188e6 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_linux_ppc64x.go @@ -0,0 +1,30 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build linux && (ppc64 || ppc64le) + +package cpu + +// HWCAP/HWCAP2 bits. These are exposed by the kernel. +const ( + // ISA Level + _PPC_FEATURE2_ARCH_2_07 = 0x80000000 + _PPC_FEATURE2_ARCH_3_00 = 0x00800000 + + // CPU features + _PPC_FEATURE2_DARN = 0x00200000 + _PPC_FEATURE2_SCV = 0x00100000 +) + +func doinit() { + // HWCAP2 feature bits + PPC64.IsPOWER8 = isSet(hwCap2, _PPC_FEATURE2_ARCH_2_07) + PPC64.IsPOWER9 = isSet(hwCap2, _PPC_FEATURE2_ARCH_3_00) + PPC64.HasDARN = isSet(hwCap2, _PPC_FEATURE2_DARN) + PPC64.HasSCV = isSet(hwCap2, _PPC_FEATURE2_SCV) +} + +func isSet(hwc uint, value uint) bool { + return hwc&value != 0 +} diff --git a/vendor/golang.org/x/sys/cpu/cpu_linux_riscv64.go b/vendor/golang.org/x/sys/cpu/cpu_linux_riscv64.go new file mode 100644 index 00000000..cb4a0c57 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_linux_riscv64.go @@ -0,0 +1,137 @@ +// Copyright 2024 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cpu + +import ( + "syscall" + "unsafe" +) + +// RISC-V extension discovery code for Linux. The approach here is to first try the riscv_hwprobe +// syscall falling back to HWCAP to check for the C extension if riscv_hwprobe is not available. +// +// A note on detection of the Vector extension using HWCAP. +// +// Support for the Vector extension version 1.0 was added to the Linux kernel in release 6.5. +// Support for the riscv_hwprobe syscall was added in 6.4. It follows that if the riscv_hwprobe +// syscall is not available then neither is the Vector extension (which needs kernel support). +// The riscv_hwprobe syscall should then be all we need to detect the Vector extension. +// However, some RISC-V board manufacturers ship boards with an older kernel on top of which +// they have back-ported various versions of the Vector extension patches but not the riscv_hwprobe +// patches. These kernels advertise support for the Vector extension using HWCAP. Falling +// back to HWCAP to detect the Vector extension, if riscv_hwprobe is not available, or simply not +// bothering with riscv_hwprobe at all and just using HWCAP may then seem like an attractive option. +// +// Unfortunately, simply checking the 'V' bit in AT_HWCAP will not work as this bit is used by +// RISC-V board and cloud instance providers to mean different things. The Lichee Pi 4A board +// and the Scaleway RV1 cloud instances use the 'V' bit to advertise their support for the unratified +// 0.7.1 version of the Vector Specification. The Banana Pi BPI-F3 and the CanMV-K230 board use +// it to advertise support for 1.0 of the Vector extension. Versions 0.7.1 and 1.0 of the Vector +// extension are binary incompatible. HWCAP can then not be used in isolation to populate the +// HasV field as this field indicates that the underlying CPU is compatible with RVV 1.0. +// +// There is a way at runtime to distinguish between versions 0.7.1 and 1.0 of the Vector +// specification by issuing a RVV 1.0 vsetvli instruction and checking the vill bit of the vtype +// register. This check would allow us to safely detect version 1.0 of the Vector extension +// with HWCAP, if riscv_hwprobe were not available. However, the check cannot +// be added until the assembler supports the Vector instructions. +// +// Note the riscv_hwprobe syscall does not suffer from these ambiguities by design as all of the +// extensions it advertises support for are explicitly versioned. It's also worth noting that +// the riscv_hwprobe syscall is the only way to detect multi-letter RISC-V extensions, e.g., Zba. +// These cannot be detected using HWCAP and so riscv_hwprobe must be used to detect the majority +// of RISC-V extensions. +// +// Please see https://docs.kernel.org/arch/riscv/hwprobe.html for more information. + +// golang.org/x/sys/cpu is not allowed to depend on golang.org/x/sys/unix so we must +// reproduce the constants, types and functions needed to make the riscv_hwprobe syscall +// here. + +const ( + // Copied from golang.org/x/sys/unix/ztypes_linux_riscv64.go. + riscv_HWPROBE_KEY_IMA_EXT_0 = 0x4 + riscv_HWPROBE_IMA_C = 0x2 + riscv_HWPROBE_IMA_V = 0x4 + riscv_HWPROBE_EXT_ZBA = 0x8 + riscv_HWPROBE_EXT_ZBB = 0x10 + riscv_HWPROBE_EXT_ZBS = 0x20 + riscv_HWPROBE_KEY_CPUPERF_0 = 0x5 + riscv_HWPROBE_MISALIGNED_FAST = 0x3 + riscv_HWPROBE_MISALIGNED_MASK = 0x7 +) + +const ( + // sys_RISCV_HWPROBE is copied from golang.org/x/sys/unix/zsysnum_linux_riscv64.go. + sys_RISCV_HWPROBE = 258 +) + +// riscvHWProbePairs is copied from golang.org/x/sys/unix/ztypes_linux_riscv64.go. +type riscvHWProbePairs struct { + key int64 + value uint64 +} + +const ( + // CPU features + hwcap_RISCV_ISA_C = 1 << ('C' - 'A') +) + +func doinit() { + // A slice of key/value pair structures is passed to the RISCVHWProbe syscall. The key + // field should be initialised with one of the key constants defined above, e.g., + // RISCV_HWPROBE_KEY_IMA_EXT_0. The syscall will set the value field to the appropriate value. + // If the kernel does not recognise a key it will set the key field to -1 and the value field to 0. + + pairs := []riscvHWProbePairs{ + {riscv_HWPROBE_KEY_IMA_EXT_0, 0}, + {riscv_HWPROBE_KEY_CPUPERF_0, 0}, + } + + // This call only indicates that extensions are supported if they are implemented on all cores. + if riscvHWProbe(pairs, 0) { + if pairs[0].key != -1 { + v := uint(pairs[0].value) + RISCV64.HasC = isSet(v, riscv_HWPROBE_IMA_C) + RISCV64.HasV = isSet(v, riscv_HWPROBE_IMA_V) + RISCV64.HasZba = isSet(v, riscv_HWPROBE_EXT_ZBA) + RISCV64.HasZbb = isSet(v, riscv_HWPROBE_EXT_ZBB) + RISCV64.HasZbs = isSet(v, riscv_HWPROBE_EXT_ZBS) + } + if pairs[1].key != -1 { + v := pairs[1].value & riscv_HWPROBE_MISALIGNED_MASK + RISCV64.HasFastMisaligned = v == riscv_HWPROBE_MISALIGNED_FAST + } + } + + // Let's double check with HWCAP if the C extension does not appear to be supported. + // This may happen if we're running on a kernel older than 6.4. + + if !RISCV64.HasC { + RISCV64.HasC = isSet(hwCap, hwcap_RISCV_ISA_C) + } +} + +func isSet(hwc uint, value uint) bool { + return hwc&value != 0 +} + +// riscvHWProbe is a simplified version of the generated wrapper function found in +// golang.org/x/sys/unix/zsyscall_linux_riscv64.go. We simplify it by removing the +// cpuCount and cpus parameters which we do not need. We always want to pass 0 for +// these parameters here so the kernel only reports the extensions that are present +// on all cores. +func riscvHWProbe(pairs []riscvHWProbePairs, flags uint) bool { + var _zero uintptr + var p0 unsafe.Pointer + if len(pairs) > 0 { + p0 = unsafe.Pointer(&pairs[0]) + } else { + p0 = unsafe.Pointer(&_zero) + } + + _, _, e1 := syscall.Syscall6(sys_RISCV_HWPROBE, uintptr(p0), uintptr(len(pairs)), uintptr(0), uintptr(0), uintptr(flags), 0) + return e1 == 0 +} diff --git a/vendor/golang.org/x/sys/cpu/cpu_linux_s390x.go b/vendor/golang.org/x/sys/cpu/cpu_linux_s390x.go new file mode 100644 index 00000000..1517ac61 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_linux_s390x.go @@ -0,0 +1,40 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cpu + +const ( + // bit mask values from /usr/include/bits/hwcap.h + hwcap_ZARCH = 2 + hwcap_STFLE = 4 + hwcap_MSA = 8 + hwcap_LDISP = 16 + hwcap_EIMM = 32 + hwcap_DFP = 64 + hwcap_ETF3EH = 256 + hwcap_VX = 2048 + hwcap_VXE = 8192 +) + +func initS390Xbase() { + // test HWCAP bit vector + has := func(featureMask uint) bool { + return hwCap&featureMask == featureMask + } + + // mandatory + S390X.HasZARCH = has(hwcap_ZARCH) + + // optional + S390X.HasSTFLE = has(hwcap_STFLE) + S390X.HasLDISP = has(hwcap_LDISP) + S390X.HasEIMM = has(hwcap_EIMM) + S390X.HasETF3EH = has(hwcap_ETF3EH) + S390X.HasDFP = has(hwcap_DFP) + S390X.HasMSA = has(hwcap_MSA) + S390X.HasVX = has(hwcap_VX) + if S390X.HasVX { + S390X.HasVXE = has(hwcap_VXE) + } +} diff --git a/vendor/golang.org/x/sys/cpu/cpu_loong64.go b/vendor/golang.org/x/sys/cpu/cpu_loong64.go new file mode 100644 index 00000000..55863585 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_loong64.go @@ -0,0 +1,12 @@ +// Copyright 2022 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build loong64 + +package cpu + +const cacheLineSize = 64 + +func initOptions() { +} diff --git a/vendor/golang.org/x/sys/cpu/cpu_mips64x.go b/vendor/golang.org/x/sys/cpu/cpu_mips64x.go new file mode 100644 index 00000000..fedb00cc --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_mips64x.go @@ -0,0 +1,15 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build mips64 || mips64le + +package cpu + +const cacheLineSize = 32 + +func initOptions() { + options = []option{ + {Name: "msa", Feature: &MIPS64X.HasMSA}, + } +} diff --git a/vendor/golang.org/x/sys/cpu/cpu_mipsx.go b/vendor/golang.org/x/sys/cpu/cpu_mipsx.go new file mode 100644 index 00000000..ffb4ec7e --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_mipsx.go @@ -0,0 +1,11 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build mips || mipsle + +package cpu + +const cacheLineSize = 32 + +func initOptions() {} diff --git a/vendor/golang.org/x/sys/cpu/cpu_netbsd_arm64.go b/vendor/golang.org/x/sys/cpu/cpu_netbsd_arm64.go new file mode 100644 index 00000000..ebfb3fc8 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_netbsd_arm64.go @@ -0,0 +1,173 @@ +// Copyright 2020 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cpu + +import ( + "syscall" + "unsafe" +) + +// Minimal copy of functionality from x/sys/unix so the cpu package can call +// sysctl without depending on x/sys/unix. + +const ( + _CTL_QUERY = -2 + + _SYSCTL_VERS_1 = 0x1000000 +) + +var _zero uintptr + +func sysctl(mib []int32, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { + var _p0 unsafe.Pointer + if len(mib) > 0 { + _p0 = unsafe.Pointer(&mib[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + _, _, errno := syscall.Syscall6( + syscall.SYS___SYSCTL, + uintptr(_p0), + uintptr(len(mib)), + uintptr(unsafe.Pointer(old)), + uintptr(unsafe.Pointer(oldlen)), + uintptr(unsafe.Pointer(new)), + uintptr(newlen)) + if errno != 0 { + return errno + } + return nil +} + +type sysctlNode struct { + Flags uint32 + Num int32 + Name [32]int8 + Ver uint32 + __rsvd uint32 + Un [16]byte + _sysctl_size [8]byte + _sysctl_func [8]byte + _sysctl_parent [8]byte + _sysctl_desc [8]byte +} + +func sysctlNodes(mib []int32) ([]sysctlNode, error) { + var olen uintptr + + // Get a list of all sysctl nodes below the given MIB by performing + // a sysctl for the given MIB with CTL_QUERY appended. + mib = append(mib, _CTL_QUERY) + qnode := sysctlNode{Flags: _SYSCTL_VERS_1} + qp := (*byte)(unsafe.Pointer(&qnode)) + sz := unsafe.Sizeof(qnode) + if err := sysctl(mib, nil, &olen, qp, sz); err != nil { + return nil, err + } + + // Now that we know the size, get the actual nodes. + nodes := make([]sysctlNode, olen/sz) + np := (*byte)(unsafe.Pointer(&nodes[0])) + if err := sysctl(mib, np, &olen, qp, sz); err != nil { + return nil, err + } + + return nodes, nil +} + +func nametomib(name string) ([]int32, error) { + // Split name into components. + var parts []string + last := 0 + for i := 0; i < len(name); i++ { + if name[i] == '.' { + parts = append(parts, name[last:i]) + last = i + 1 + } + } + parts = append(parts, name[last:]) + + mib := []int32{} + // Discover the nodes and construct the MIB OID. + for partno, part := range parts { + nodes, err := sysctlNodes(mib) + if err != nil { + return nil, err + } + for _, node := range nodes { + n := make([]byte, 0) + for i := range node.Name { + if node.Name[i] != 0 { + n = append(n, byte(node.Name[i])) + } + } + if string(n) == part { + mib = append(mib, int32(node.Num)) + break + } + } + if len(mib) != partno+1 { + return nil, err + } + } + + return mib, nil +} + +// aarch64SysctlCPUID is struct aarch64_sysctl_cpu_id from NetBSD's <aarch64/armreg.h> +type aarch64SysctlCPUID struct { + midr uint64 /* Main ID Register */ + revidr uint64 /* Revision ID Register */ + mpidr uint64 /* Multiprocessor Affinity Register */ + aa64dfr0 uint64 /* A64 Debug Feature Register 0 */ + aa64dfr1 uint64 /* A64 Debug Feature Register 1 */ + aa64isar0 uint64 /* A64 Instruction Set Attribute Register 0 */ + aa64isar1 uint64 /* A64 Instruction Set Attribute Register 1 */ + aa64mmfr0 uint64 /* A64 Memory Model Feature Register 0 */ + aa64mmfr1 uint64 /* A64 Memory Model Feature Register 1 */ + aa64mmfr2 uint64 /* A64 Memory Model Feature Register 2 */ + aa64pfr0 uint64 /* A64 Processor Feature Register 0 */ + aa64pfr1 uint64 /* A64 Processor Feature Register 1 */ + aa64zfr0 uint64 /* A64 SVE Feature ID Register 0 */ + mvfr0 uint32 /* Media and VFP Feature Register 0 */ + mvfr1 uint32 /* Media and VFP Feature Register 1 */ + mvfr2 uint32 /* Media and VFP Feature Register 2 */ + pad uint32 + clidr uint64 /* Cache Level ID Register */ + ctr uint64 /* Cache Type Register */ +} + +func sysctlCPUID(name string) (*aarch64SysctlCPUID, error) { + mib, err := nametomib(name) + if err != nil { + return nil, err + } + + out := aarch64SysctlCPUID{} + n := unsafe.Sizeof(out) + _, _, errno := syscall.Syscall6( + syscall.SYS___SYSCTL, + uintptr(unsafe.Pointer(&mib[0])), + uintptr(len(mib)), + uintptr(unsafe.Pointer(&out)), + uintptr(unsafe.Pointer(&n)), + uintptr(0), + uintptr(0)) + if errno != 0 { + return nil, errno + } + return &out, nil +} + +func doinit() { + cpuid, err := sysctlCPUID("machdep.cpu0.cpu_id") + if err != nil { + setMinimalFeatures() + return + } + parseARM64SystemRegisters(cpuid.aa64isar0, cpuid.aa64isar1, cpuid.aa64pfr0) + + Initialized = true +} diff --git a/vendor/golang.org/x/sys/cpu/cpu_openbsd_arm64.go b/vendor/golang.org/x/sys/cpu/cpu_openbsd_arm64.go new file mode 100644 index 00000000..85b64d5c --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_openbsd_arm64.go @@ -0,0 +1,65 @@ +// Copyright 2022 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cpu + +import ( + "syscall" + "unsafe" +) + +// Minimal copy of functionality from x/sys/unix so the cpu package can call +// sysctl without depending on x/sys/unix. + +const ( + // From OpenBSD's sys/sysctl.h. + _CTL_MACHDEP = 7 + + // From OpenBSD's machine/cpu.h. + _CPU_ID_AA64ISAR0 = 2 + _CPU_ID_AA64ISAR1 = 3 +) + +// Implemented in the runtime package (runtime/sys_openbsd3.go) +func syscall_syscall6(fn, a1, a2, a3, a4, a5, a6 uintptr) (r1, r2 uintptr, err syscall.Errno) + +//go:linkname syscall_syscall6 syscall.syscall6 + +func sysctl(mib []uint32, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { + _, _, errno := syscall_syscall6(libc_sysctl_trampoline_addr, uintptr(unsafe.Pointer(&mib[0])), uintptr(len(mib)), uintptr(unsafe.Pointer(old)), uintptr(unsafe.Pointer(oldlen)), uintptr(unsafe.Pointer(new)), uintptr(newlen)) + if errno != 0 { + return errno + } + return nil +} + +var libc_sysctl_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_sysctl sysctl "libc.so" + +func sysctlUint64(mib []uint32) (uint64, bool) { + var out uint64 + nout := unsafe.Sizeof(out) + if err := sysctl(mib, (*byte)(unsafe.Pointer(&out)), &nout, nil, 0); err != nil { + return 0, false + } + return out, true +} + +func doinit() { + setMinimalFeatures() + + // Get ID_AA64ISAR0 and ID_AA64ISAR1 from sysctl. + isar0, ok := sysctlUint64([]uint32{_CTL_MACHDEP, _CPU_ID_AA64ISAR0}) + if !ok { + return + } + isar1, ok := sysctlUint64([]uint32{_CTL_MACHDEP, _CPU_ID_AA64ISAR1}) + if !ok { + return + } + parseARM64SystemRegisters(isar0, isar1, 0) + + Initialized = true +} diff --git a/vendor/golang.org/x/sys/cpu/cpu_openbsd_arm64.s b/vendor/golang.org/x/sys/cpu/cpu_openbsd_arm64.s new file mode 100644 index 00000000..054ba05d --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_openbsd_arm64.s @@ -0,0 +1,11 @@ +// Copyright 2022 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +#include "textflag.h" + +TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_sysctl(SB) + +GLOBL ·libc_sysctl_trampoline_addr(SB), RODATA, $8 +DATA ·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB) diff --git a/vendor/golang.org/x/sys/cpu/cpu_other_arm.go b/vendor/golang.org/x/sys/cpu/cpu_other_arm.go new file mode 100644 index 00000000..e9ecf2a4 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_other_arm.go @@ -0,0 +1,9 @@ +// Copyright 2020 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build !linux && arm + +package cpu + +func archInit() {} diff --git a/vendor/golang.org/x/sys/cpu/cpu_other_arm64.go b/vendor/golang.org/x/sys/cpu/cpu_other_arm64.go new file mode 100644 index 00000000..5341e7f8 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_other_arm64.go @@ -0,0 +1,9 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build !linux && !netbsd && !openbsd && arm64 + +package cpu + +func doinit() {} diff --git a/vendor/golang.org/x/sys/cpu/cpu_other_mips64x.go b/vendor/golang.org/x/sys/cpu/cpu_other_mips64x.go new file mode 100644 index 00000000..5f8f2419 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_other_mips64x.go @@ -0,0 +1,11 @@ +// Copyright 2020 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build !linux && (mips64 || mips64le) + +package cpu + +func archInit() { + Initialized = true +} diff --git a/vendor/golang.org/x/sys/cpu/cpu_other_ppc64x.go b/vendor/golang.org/x/sys/cpu/cpu_other_ppc64x.go new file mode 100644 index 00000000..89608fba --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_other_ppc64x.go @@ -0,0 +1,12 @@ +// Copyright 2022 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build !aix && !linux && (ppc64 || ppc64le) + +package cpu + +func archInit() { + PPC64.IsPOWER8 = true + Initialized = true +} diff --git a/vendor/golang.org/x/sys/cpu/cpu_other_riscv64.go b/vendor/golang.org/x/sys/cpu/cpu_other_riscv64.go new file mode 100644 index 00000000..5ab87808 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_other_riscv64.go @@ -0,0 +1,11 @@ +// Copyright 2022 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build !linux && riscv64 + +package cpu + +func archInit() { + Initialized = true +} diff --git a/vendor/golang.org/x/sys/cpu/cpu_other_x86.go b/vendor/golang.org/x/sys/cpu/cpu_other_x86.go new file mode 100644 index 00000000..a0fd7e2f --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_other_x86.go @@ -0,0 +1,11 @@ +// Copyright 2024 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build 386 || amd64p32 || (amd64 && (!darwin || !gc)) + +package cpu + +func darwinSupportsAVX512() bool { + panic("only implemented for gc && amd64 && darwin") +} diff --git a/vendor/golang.org/x/sys/cpu/cpu_ppc64x.go b/vendor/golang.org/x/sys/cpu/cpu_ppc64x.go new file mode 100644 index 00000000..c14f12b1 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_ppc64x.go @@ -0,0 +1,16 @@ +// Copyright 2020 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build ppc64 || ppc64le + +package cpu + +const cacheLineSize = 128 + +func initOptions() { + options = []option{ + {Name: "darn", Feature: &PPC64.HasDARN}, + {Name: "scv", Feature: &PPC64.HasSCV}, + } +} diff --git a/vendor/golang.org/x/sys/cpu/cpu_riscv64.go b/vendor/golang.org/x/sys/cpu/cpu_riscv64.go new file mode 100644 index 00000000..aca3199c --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_riscv64.go @@ -0,0 +1,20 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build riscv64 + +package cpu + +const cacheLineSize = 64 + +func initOptions() { + options = []option{ + {Name: "fastmisaligned", Feature: &RISCV64.HasFastMisaligned}, + {Name: "c", Feature: &RISCV64.HasC}, + {Name: "v", Feature: &RISCV64.HasV}, + {Name: "zba", Feature: &RISCV64.HasZba}, + {Name: "zbb", Feature: &RISCV64.HasZbb}, + {Name: "zbs", Feature: &RISCV64.HasZbs}, + } +} diff --git a/vendor/golang.org/x/sys/cpu/cpu_s390x.go b/vendor/golang.org/x/sys/cpu/cpu_s390x.go new file mode 100644 index 00000000..5881b883 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_s390x.go @@ -0,0 +1,172 @@ +// Copyright 2020 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cpu + +const cacheLineSize = 256 + +func initOptions() { + options = []option{ + {Name: "zarch", Feature: &S390X.HasZARCH, Required: true}, + {Name: "stfle", Feature: &S390X.HasSTFLE, Required: true}, + {Name: "ldisp", Feature: &S390X.HasLDISP, Required: true}, + {Name: "eimm", Feature: &S390X.HasEIMM, Required: true}, + {Name: "dfp", Feature: &S390X.HasDFP}, + {Name: "etf3eh", Feature: &S390X.HasETF3EH}, + {Name: "msa", Feature: &S390X.HasMSA}, + {Name: "aes", Feature: &S390X.HasAES}, + {Name: "aescbc", Feature: &S390X.HasAESCBC}, + {Name: "aesctr", Feature: &S390X.HasAESCTR}, + {Name: "aesgcm", Feature: &S390X.HasAESGCM}, + {Name: "ghash", Feature: &S390X.HasGHASH}, + {Name: "sha1", Feature: &S390X.HasSHA1}, + {Name: "sha256", Feature: &S390X.HasSHA256}, + {Name: "sha3", Feature: &S390X.HasSHA3}, + {Name: "sha512", Feature: &S390X.HasSHA512}, + {Name: "vx", Feature: &S390X.HasVX}, + {Name: "vxe", Feature: &S390X.HasVXE}, + } +} + +// bitIsSet reports whether the bit at index is set. The bit index +// is in big endian order, so bit index 0 is the leftmost bit. +func bitIsSet(bits []uint64, index uint) bool { + return bits[index/64]&((1<<63)>>(index%64)) != 0 +} + +// facility is a bit index for the named facility. +type facility uint8 + +const ( + // mandatory facilities + zarch facility = 1 // z architecture mode is active + stflef facility = 7 // store-facility-list-extended + ldisp facility = 18 // long-displacement + eimm facility = 21 // extended-immediate + + // miscellaneous facilities + dfp facility = 42 // decimal-floating-point + etf3eh facility = 30 // extended-translation 3 enhancement + + // cryptography facilities + msa facility = 17 // message-security-assist + msa3 facility = 76 // message-security-assist extension 3 + msa4 facility = 77 // message-security-assist extension 4 + msa5 facility = 57 // message-security-assist extension 5 + msa8 facility = 146 // message-security-assist extension 8 + msa9 facility = 155 // message-security-assist extension 9 + + // vector facilities + vx facility = 129 // vector facility + vxe facility = 135 // vector-enhancements 1 + vxe2 facility = 148 // vector-enhancements 2 +) + +// facilityList contains the result of an STFLE call. +// Bits are numbered in big endian order so the +// leftmost bit (the MSB) is at index 0. +type facilityList struct { + bits [4]uint64 +} + +// Has reports whether the given facilities are present. +func (s *facilityList) Has(fs ...facility) bool { + if len(fs) == 0 { + panic("no facility bits provided") + } + for _, f := range fs { + if !bitIsSet(s.bits[:], uint(f)) { + return false + } + } + return true +} + +// function is the code for the named cryptographic function. +type function uint8 + +const ( + // KM{,A,C,CTR} function codes + aes128 function = 18 // AES-128 + aes192 function = 19 // AES-192 + aes256 function = 20 // AES-256 + + // K{I,L}MD function codes + sha1 function = 1 // SHA-1 + sha256 function = 2 // SHA-256 + sha512 function = 3 // SHA-512 + sha3_224 function = 32 // SHA3-224 + sha3_256 function = 33 // SHA3-256 + sha3_384 function = 34 // SHA3-384 + sha3_512 function = 35 // SHA3-512 + shake128 function = 36 // SHAKE-128 + shake256 function = 37 // SHAKE-256 + + // KLMD function codes + ghash function = 65 // GHASH +) + +// queryResult contains the result of a Query function +// call. Bits are numbered in big endian order so the +// leftmost bit (the MSB) is at index 0. +type queryResult struct { + bits [2]uint64 +} + +// Has reports whether the given functions are present. +func (q *queryResult) Has(fns ...function) bool { + if len(fns) == 0 { + panic("no function codes provided") + } + for _, f := range fns { + if !bitIsSet(q.bits[:], uint(f)) { + return false + } + } + return true +} + +func doinit() { + initS390Xbase() + + // We need implementations of stfle, km and so on + // to detect cryptographic features. + if !haveAsmFunctions() { + return + } + + // optional cryptographic functions + if S390X.HasMSA { + aes := []function{aes128, aes192, aes256} + + // cipher message + km, kmc := kmQuery(), kmcQuery() + S390X.HasAES = km.Has(aes...) + S390X.HasAESCBC = kmc.Has(aes...) + if S390X.HasSTFLE { + facilities := stfle() + if facilities.Has(msa4) { + kmctr := kmctrQuery() + S390X.HasAESCTR = kmctr.Has(aes...) + } + if facilities.Has(msa8) { + kma := kmaQuery() + S390X.HasAESGCM = kma.Has(aes...) + } + } + + // compute message digest + kimd := kimdQuery() // intermediate (no padding) + klmd := klmdQuery() // last (padding) + S390X.HasSHA1 = kimd.Has(sha1) && klmd.Has(sha1) + S390X.HasSHA256 = kimd.Has(sha256) && klmd.Has(sha256) + S390X.HasSHA512 = kimd.Has(sha512) && klmd.Has(sha512) + S390X.HasGHASH = kimd.Has(ghash) // KLMD-GHASH does not exist + sha3 := []function{ + sha3_224, sha3_256, sha3_384, sha3_512, + shake128, shake256, + } + S390X.HasSHA3 = kimd.Has(sha3...) && klmd.Has(sha3...) + } +} diff --git a/vendor/golang.org/x/sys/cpu/cpu_s390x.s b/vendor/golang.org/x/sys/cpu/cpu_s390x.s new file mode 100644 index 00000000..1fb4b701 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_s390x.s @@ -0,0 +1,57 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build gc + +#include "textflag.h" + +// func stfle() facilityList +TEXT ·stfle(SB), NOSPLIT|NOFRAME, $0-32 + MOVD $ret+0(FP), R1 + MOVD $3, R0 // last doubleword index to store + XC $32, (R1), (R1) // clear 4 doublewords (32 bytes) + WORD $0xb2b01000 // store facility list extended (STFLE) + RET + +// func kmQuery() queryResult +TEXT ·kmQuery(SB), NOSPLIT|NOFRAME, $0-16 + MOVD $0, R0 // set function code to 0 (KM-Query) + MOVD $ret+0(FP), R1 // address of 16-byte return value + WORD $0xB92E0024 // cipher message (KM) + RET + +// func kmcQuery() queryResult +TEXT ·kmcQuery(SB), NOSPLIT|NOFRAME, $0-16 + MOVD $0, R0 // set function code to 0 (KMC-Query) + MOVD $ret+0(FP), R1 // address of 16-byte return value + WORD $0xB92F0024 // cipher message with chaining (KMC) + RET + +// func kmctrQuery() queryResult +TEXT ·kmctrQuery(SB), NOSPLIT|NOFRAME, $0-16 + MOVD $0, R0 // set function code to 0 (KMCTR-Query) + MOVD $ret+0(FP), R1 // address of 16-byte return value + WORD $0xB92D4024 // cipher message with counter (KMCTR) + RET + +// func kmaQuery() queryResult +TEXT ·kmaQuery(SB), NOSPLIT|NOFRAME, $0-16 + MOVD $0, R0 // set function code to 0 (KMA-Query) + MOVD $ret+0(FP), R1 // address of 16-byte return value + WORD $0xb9296024 // cipher message with authentication (KMA) + RET + +// func kimdQuery() queryResult +TEXT ·kimdQuery(SB), NOSPLIT|NOFRAME, $0-16 + MOVD $0, R0 // set function code to 0 (KIMD-Query) + MOVD $ret+0(FP), R1 // address of 16-byte return value + WORD $0xB93E0024 // compute intermediate message digest (KIMD) + RET + +// func klmdQuery() queryResult +TEXT ·klmdQuery(SB), NOSPLIT|NOFRAME, $0-16 + MOVD $0, R0 // set function code to 0 (KLMD-Query) + MOVD $ret+0(FP), R1 // address of 16-byte return value + WORD $0xB93F0024 // compute last message digest (KLMD) + RET diff --git a/vendor/golang.org/x/sys/cpu/cpu_wasm.go b/vendor/golang.org/x/sys/cpu/cpu_wasm.go new file mode 100644 index 00000000..384787ea --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_wasm.go @@ -0,0 +1,17 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build wasm + +package cpu + +// We're compiling the cpu package for an unknown (software-abstracted) CPU. +// Make CacheLinePad an empty struct and hope that the usual struct alignment +// rules are good enough. + +const cacheLineSize = 0 + +func initOptions() {} + +func archInit() {} diff --git a/vendor/golang.org/x/sys/cpu/cpu_x86.go b/vendor/golang.org/x/sys/cpu/cpu_x86.go new file mode 100644 index 00000000..1e642f33 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_x86.go @@ -0,0 +1,162 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build 386 || amd64 || amd64p32 + +package cpu + +import "runtime" + +const cacheLineSize = 64 + +func initOptions() { + options = []option{ + {Name: "adx", Feature: &X86.HasADX}, + {Name: "aes", Feature: &X86.HasAES}, + {Name: "avx", Feature: &X86.HasAVX}, + {Name: "avx2", Feature: &X86.HasAVX2}, + {Name: "avx512", Feature: &X86.HasAVX512}, + {Name: "avx512f", Feature: &X86.HasAVX512F}, + {Name: "avx512cd", Feature: &X86.HasAVX512CD}, + {Name: "avx512er", Feature: &X86.HasAVX512ER}, + {Name: "avx512pf", Feature: &X86.HasAVX512PF}, + {Name: "avx512vl", Feature: &X86.HasAVX512VL}, + {Name: "avx512bw", Feature: &X86.HasAVX512BW}, + {Name: "avx512dq", Feature: &X86.HasAVX512DQ}, + {Name: "avx512ifma", Feature: &X86.HasAVX512IFMA}, + {Name: "avx512vbmi", Feature: &X86.HasAVX512VBMI}, + {Name: "avx512vnniw", Feature: &X86.HasAVX5124VNNIW}, + {Name: "avx5124fmaps", Feature: &X86.HasAVX5124FMAPS}, + {Name: "avx512vpopcntdq", Feature: &X86.HasAVX512VPOPCNTDQ}, + {Name: "avx512vpclmulqdq", Feature: &X86.HasAVX512VPCLMULQDQ}, + {Name: "avx512vnni", Feature: &X86.HasAVX512VNNI}, + {Name: "avx512gfni", Feature: &X86.HasAVX512GFNI}, + {Name: "avx512vaes", Feature: &X86.HasAVX512VAES}, + {Name: "avx512vbmi2", Feature: &X86.HasAVX512VBMI2}, + {Name: "avx512bitalg", Feature: &X86.HasAVX512BITALG}, + {Name: "avx512bf16", Feature: &X86.HasAVX512BF16}, + {Name: "amxtile", Feature: &X86.HasAMXTile}, + {Name: "amxint8", Feature: &X86.HasAMXInt8}, + {Name: "amxbf16", Feature: &X86.HasAMXBF16}, + {Name: "bmi1", Feature: &X86.HasBMI1}, + {Name: "bmi2", Feature: &X86.HasBMI2}, + {Name: "cx16", Feature: &X86.HasCX16}, + {Name: "erms", Feature: &X86.HasERMS}, + {Name: "fma", Feature: &X86.HasFMA}, + {Name: "osxsave", Feature: &X86.HasOSXSAVE}, + {Name: "pclmulqdq", Feature: &X86.HasPCLMULQDQ}, + {Name: "popcnt", Feature: &X86.HasPOPCNT}, + {Name: "rdrand", Feature: &X86.HasRDRAND}, + {Name: "rdseed", Feature: &X86.HasRDSEED}, + {Name: "sse3", Feature: &X86.HasSSE3}, + {Name: "sse41", Feature: &X86.HasSSE41}, + {Name: "sse42", Feature: &X86.HasSSE42}, + {Name: "ssse3", Feature: &X86.HasSSSE3}, + {Name: "avxifma", Feature: &X86.HasAVXIFMA}, + {Name: "avxvnni", Feature: &X86.HasAVXVNNI}, + {Name: "avxvnniint8", Feature: &X86.HasAVXVNNIInt8}, + + // These capabilities should always be enabled on amd64: + {Name: "sse2", Feature: &X86.HasSSE2, Required: runtime.GOARCH == "amd64"}, + } +} + +func archInit() { + + Initialized = true + + maxID, _, _, _ := cpuid(0, 0) + + if maxID < 1 { + return + } + + _, _, ecx1, edx1 := cpuid(1, 0) + X86.HasSSE2 = isSet(26, edx1) + + X86.HasSSE3 = isSet(0, ecx1) + X86.HasPCLMULQDQ = isSet(1, ecx1) + X86.HasSSSE3 = isSet(9, ecx1) + X86.HasFMA = isSet(12, ecx1) + X86.HasCX16 = isSet(13, ecx1) + X86.HasSSE41 = isSet(19, ecx1) + X86.HasSSE42 = isSet(20, ecx1) + X86.HasPOPCNT = isSet(23, ecx1) + X86.HasAES = isSet(25, ecx1) + X86.HasOSXSAVE = isSet(27, ecx1) + X86.HasRDRAND = isSet(30, ecx1) + + var osSupportsAVX, osSupportsAVX512 bool + // For XGETBV, OSXSAVE bit is required and sufficient. + if X86.HasOSXSAVE { + eax, _ := xgetbv() + // Check if XMM and YMM registers have OS support. + osSupportsAVX = isSet(1, eax) && isSet(2, eax) + + if runtime.GOOS == "darwin" { + // Darwin requires special AVX512 checks, see cpu_darwin_x86.go + osSupportsAVX512 = osSupportsAVX && darwinSupportsAVX512() + } else { + // Check if OPMASK and ZMM registers have OS support. + osSupportsAVX512 = osSupportsAVX && isSet(5, eax) && isSet(6, eax) && isSet(7, eax) + } + } + + X86.HasAVX = isSet(28, ecx1) && osSupportsAVX + + if maxID < 7 { + return + } + + eax7, ebx7, ecx7, edx7 := cpuid(7, 0) + X86.HasBMI1 = isSet(3, ebx7) + X86.HasAVX2 = isSet(5, ebx7) && osSupportsAVX + X86.HasBMI2 = isSet(8, ebx7) + X86.HasERMS = isSet(9, ebx7) + X86.HasRDSEED = isSet(18, ebx7) + X86.HasADX = isSet(19, ebx7) + + X86.HasAVX512 = isSet(16, ebx7) && osSupportsAVX512 // Because avx-512 foundation is the core required extension + if X86.HasAVX512 { + X86.HasAVX512F = true + X86.HasAVX512CD = isSet(28, ebx7) + X86.HasAVX512ER = isSet(27, ebx7) + X86.HasAVX512PF = isSet(26, ebx7) + X86.HasAVX512VL = isSet(31, ebx7) + X86.HasAVX512BW = isSet(30, ebx7) + X86.HasAVX512DQ = isSet(17, ebx7) + X86.HasAVX512IFMA = isSet(21, ebx7) + X86.HasAVX512VBMI = isSet(1, ecx7) + X86.HasAVX5124VNNIW = isSet(2, edx7) + X86.HasAVX5124FMAPS = isSet(3, edx7) + X86.HasAVX512VPOPCNTDQ = isSet(14, ecx7) + X86.HasAVX512VPCLMULQDQ = isSet(10, ecx7) + X86.HasAVX512VNNI = isSet(11, ecx7) + X86.HasAVX512GFNI = isSet(8, ecx7) + X86.HasAVX512VAES = isSet(9, ecx7) + X86.HasAVX512VBMI2 = isSet(6, ecx7) + X86.HasAVX512BITALG = isSet(12, ecx7) + } + + X86.HasAMXTile = isSet(24, edx7) + X86.HasAMXInt8 = isSet(25, edx7) + X86.HasAMXBF16 = isSet(22, edx7) + + // These features depend on the second level of extended features. + if eax7 >= 1 { + eax71, _, _, edx71 := cpuid(7, 1) + if X86.HasAVX512 { + X86.HasAVX512BF16 = isSet(5, eax71) + } + if X86.HasAVX { + X86.HasAVXIFMA = isSet(23, eax71) + X86.HasAVXVNNI = isSet(4, eax71) + X86.HasAVXVNNIInt8 = isSet(4, edx71) + } + } +} + +func isSet(bitpos uint, value uint32) bool { + return value&(1<<bitpos) != 0 +} diff --git a/vendor/golang.org/x/sys/cpu/cpu_zos.go b/vendor/golang.org/x/sys/cpu/cpu_zos.go new file mode 100644 index 00000000..5f54683a --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_zos.go @@ -0,0 +1,10 @@ +// Copyright 2020 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cpu + +func archInit() { + doinit() + Initialized = true +} diff --git a/vendor/golang.org/x/sys/cpu/cpu_zos_s390x.go b/vendor/golang.org/x/sys/cpu/cpu_zos_s390x.go new file mode 100644 index 00000000..ccb1b708 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_zos_s390x.go @@ -0,0 +1,25 @@ +// Copyright 2020 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cpu + +func initS390Xbase() { + // get the facilities list + facilities := stfle() + + // mandatory + S390X.HasZARCH = facilities.Has(zarch) + S390X.HasSTFLE = facilities.Has(stflef) + S390X.HasLDISP = facilities.Has(ldisp) + S390X.HasEIMM = facilities.Has(eimm) + + // optional + S390X.HasETF3EH = facilities.Has(etf3eh) + S390X.HasDFP = facilities.Has(dfp) + S390X.HasMSA = facilities.Has(msa) + S390X.HasVX = facilities.Has(vx) + if S390X.HasVX { + S390X.HasVXE = facilities.Has(vxe) + } +} diff --git a/vendor/golang.org/x/sys/cpu/endian_big.go b/vendor/golang.org/x/sys/cpu/endian_big.go new file mode 100644 index 00000000..7fe04b0a --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/endian_big.go @@ -0,0 +1,10 @@ +// Copyright 2023 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build armbe || arm64be || m68k || mips || mips64 || mips64p32 || ppc || ppc64 || s390 || s390x || shbe || sparc || sparc64 + +package cpu + +// IsBigEndian records whether the GOARCH's byte order is big endian. +const IsBigEndian = true diff --git a/vendor/golang.org/x/sys/cpu/endian_little.go b/vendor/golang.org/x/sys/cpu/endian_little.go new file mode 100644 index 00000000..48eccc4c --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/endian_little.go @@ -0,0 +1,10 @@ +// Copyright 2023 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build 386 || amd64 || amd64p32 || alpha || arm || arm64 || loong64 || mipsle || mips64le || mips64p32le || nios2 || ppc64le || riscv || riscv64 || sh || wasm + +package cpu + +// IsBigEndian records whether the GOARCH's byte order is big endian. +const IsBigEndian = false diff --git a/vendor/golang.org/x/sys/cpu/hwcap_linux.go b/vendor/golang.org/x/sys/cpu/hwcap_linux.go new file mode 100644 index 00000000..34e49f95 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/hwcap_linux.go @@ -0,0 +1,71 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cpu + +import ( + "os" +) + +const ( + _AT_HWCAP = 16 + _AT_HWCAP2 = 26 + + procAuxv = "/proc/self/auxv" + + uintSize = int(32 << (^uint(0) >> 63)) +) + +// For those platforms don't have a 'cpuid' equivalent we use HWCAP/HWCAP2 +// These are initialized in cpu_$GOARCH.go +// and should not be changed after they are initialized. +var hwCap uint +var hwCap2 uint + +func readHWCAP() error { + // For Go 1.21+, get auxv from the Go runtime. + if a := getAuxv(); len(a) > 0 { + for len(a) >= 2 { + tag, val := a[0], uint(a[1]) + a = a[2:] + switch tag { + case _AT_HWCAP: + hwCap = val + case _AT_HWCAP2: + hwCap2 = val + } + } + return nil + } + + buf, err := os.ReadFile(procAuxv) + if err != nil { + // e.g. on android /proc/self/auxv is not accessible, so silently + // ignore the error and leave Initialized = false. On some + // architectures (e.g. arm64) doinit() implements a fallback + // readout and will set Initialized = true again. + return err + } + bo := hostByteOrder() + for len(buf) >= 2*(uintSize/8) { + var tag, val uint + switch uintSize { + case 32: + tag = uint(bo.Uint32(buf[0:])) + val = uint(bo.Uint32(buf[4:])) + buf = buf[8:] + case 64: + tag = uint(bo.Uint64(buf[0:])) + val = uint(bo.Uint64(buf[8:])) + buf = buf[16:] + } + switch tag { + case _AT_HWCAP: + hwCap = val + case _AT_HWCAP2: + hwCap2 = val + } + } + return nil +} diff --git a/vendor/golang.org/x/sys/cpu/parse.go b/vendor/golang.org/x/sys/cpu/parse.go new file mode 100644 index 00000000..762b63d6 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/parse.go @@ -0,0 +1,43 @@ +// Copyright 2022 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cpu + +import "strconv" + +// parseRelease parses a dot-separated version number. It follows the semver +// syntax, but allows the minor and patch versions to be elided. +// +// This is a copy of the Go runtime's parseRelease from +// https://golang.org/cl/209597. +func parseRelease(rel string) (major, minor, patch int, ok bool) { + // Strip anything after a dash or plus. + for i := 0; i < len(rel); i++ { + if rel[i] == '-' || rel[i] == '+' { + rel = rel[:i] + break + } + } + + next := func() (int, bool) { + for i := 0; i < len(rel); i++ { + if rel[i] == '.' { + ver, err := strconv.Atoi(rel[:i]) + rel = rel[i+1:] + return ver, err == nil + } + } + ver, err := strconv.Atoi(rel) + rel = "" + return ver, err == nil + } + if major, ok = next(); !ok || rel == "" { + return + } + if minor, ok = next(); !ok || rel == "" { + return + } + patch, ok = next() + return +} diff --git a/vendor/golang.org/x/sys/cpu/proc_cpuinfo_linux.go b/vendor/golang.org/x/sys/cpu/proc_cpuinfo_linux.go new file mode 100644 index 00000000..4cd64c70 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/proc_cpuinfo_linux.go @@ -0,0 +1,53 @@ +// Copyright 2022 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build linux && arm64 + +package cpu + +import ( + "errors" + "io" + "os" + "strings" +) + +func readLinuxProcCPUInfo() error { + f, err := os.Open("/proc/cpuinfo") + if err != nil { + return err + } + defer f.Close() + + var buf [1 << 10]byte // enough for first CPU + n, err := io.ReadFull(f, buf[:]) + if err != nil && err != io.ErrUnexpectedEOF { + return err + } + in := string(buf[:n]) + const features = "\nFeatures : " + i := strings.Index(in, features) + if i == -1 { + return errors.New("no CPU features found") + } + in = in[i+len(features):] + if i := strings.Index(in, "\n"); i != -1 { + in = in[:i] + } + m := map[string]*bool{} + + initOptions() // need it early here; it's harmless to call twice + for _, o := range options { + m[o.Name] = o.Feature + } + // The EVTSTRM field has alias "evstrm" in Go, but Linux calls it "evtstrm". + m["evtstrm"] = &ARM64.HasEVTSTRM + + for _, f := range strings.Fields(in) { + if p, ok := m[f]; ok { + *p = true + } + } + return nil +} diff --git a/vendor/golang.org/x/sys/cpu/runtime_auxv.go b/vendor/golang.org/x/sys/cpu/runtime_auxv.go new file mode 100644 index 00000000..5f92ac9a --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/runtime_auxv.go @@ -0,0 +1,16 @@ +// Copyright 2023 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cpu + +// getAuxvFn is non-nil on Go 1.21+ (via runtime_auxv_go121.go init) +// on platforms that use auxv. +var getAuxvFn func() []uintptr + +func getAuxv() []uintptr { + if getAuxvFn == nil { + return nil + } + return getAuxvFn() +} diff --git a/vendor/golang.org/x/sys/cpu/runtime_auxv_go121.go b/vendor/golang.org/x/sys/cpu/runtime_auxv_go121.go new file mode 100644 index 00000000..4c9788ea --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/runtime_auxv_go121.go @@ -0,0 +1,18 @@ +// Copyright 2023 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build go1.21 + +package cpu + +import ( + _ "unsafe" // for linkname +) + +//go:linkname runtime_getAuxv runtime.getAuxv +func runtime_getAuxv() []uintptr + +func init() { + getAuxvFn = runtime_getAuxv +} diff --git a/vendor/golang.org/x/sys/cpu/syscall_aix_gccgo.go b/vendor/golang.org/x/sys/cpu/syscall_aix_gccgo.go new file mode 100644 index 00000000..1b9ccb09 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/syscall_aix_gccgo.go @@ -0,0 +1,26 @@ +// Copyright 2020 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Recreate a getsystemcfg syscall handler instead of +// using the one provided by x/sys/unix to avoid having +// the dependency between them. (See golang.org/issue/32102) +// Moreover, this file will be used during the building of +// gccgo's libgo and thus must not used a CGo method. + +//go:build aix && gccgo + +package cpu + +import ( + "syscall" +) + +//extern getsystemcfg +func gccgoGetsystemcfg(label uint32) (r uint64) + +func callgetsystemcfg(label int) (r1 uintptr, e1 syscall.Errno) { + r1 = uintptr(gccgoGetsystemcfg(uint32(label))) + e1 = syscall.GetErrno() + return +} diff --git a/vendor/golang.org/x/sys/cpu/syscall_aix_ppc64_gc.go b/vendor/golang.org/x/sys/cpu/syscall_aix_ppc64_gc.go new file mode 100644 index 00000000..e8b6cdbe --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/syscall_aix_ppc64_gc.go @@ -0,0 +1,35 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Minimal copy of x/sys/unix so the cpu package can make a +// system call on AIX without depending on x/sys/unix. +// (See golang.org/issue/32102) + +//go:build aix && ppc64 && gc + +package cpu + +import ( + "syscall" + "unsafe" +) + +//go:cgo_import_dynamic libc_getsystemcfg getsystemcfg "libc.a/shr_64.o" + +//go:linkname libc_getsystemcfg libc_getsystemcfg + +type syscallFunc uintptr + +var libc_getsystemcfg syscallFunc + +type errno = syscall.Errno + +// Implemented in runtime/syscall_aix.go. +func rawSyscall6(trap, nargs, a1, a2, a3, a4, a5, a6 uintptr) (r1, r2 uintptr, err errno) +func syscall6(trap, nargs, a1, a2, a3, a4, a5, a6 uintptr) (r1, r2 uintptr, err errno) + +func callgetsystemcfg(label int) (r1 uintptr, e1 errno) { + r1, _, e1 = syscall6(uintptr(unsafe.Pointer(&libc_getsystemcfg)), 1, uintptr(label), 0, 0, 0, 0, 0) + return +} diff --git a/vendor/golang.org/x/sys/cpu/syscall_darwin_x86_gc.go b/vendor/golang.org/x/sys/cpu/syscall_darwin_x86_gc.go new file mode 100644 index 00000000..4d0888b0 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/syscall_darwin_x86_gc.go @@ -0,0 +1,98 @@ +// Copyright 2024 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Minimal copy of x/sys/unix so the cpu package can make a +// system call on Darwin without depending on x/sys/unix. + +//go:build darwin && amd64 && gc + +package cpu + +import ( + "syscall" + "unsafe" +) + +type _C_int int32 + +// adapted from unix.Uname() at x/sys/unix/syscall_darwin.go L419 +func darwinOSRelease(release *[256]byte) error { + // from x/sys/unix/zerrors_openbsd_amd64.go + const ( + CTL_KERN = 0x1 + KERN_OSRELEASE = 0x2 + ) + + mib := []_C_int{CTL_KERN, KERN_OSRELEASE} + n := unsafe.Sizeof(*release) + + return sysctl(mib, &release[0], &n, nil, 0) +} + +type Errno = syscall.Errno + +var _zero uintptr // Single-word zero for use when we need a valid pointer to 0 bytes. + +// from x/sys/unix/zsyscall_darwin_amd64.go L791-807 +func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) error { + var _p0 unsafe.Pointer + if len(mib) > 0 { + _p0 = unsafe.Pointer(&mib[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + if _, _, err := syscall_syscall6( + libc_sysctl_trampoline_addr, + uintptr(_p0), + uintptr(len(mib)), + uintptr(unsafe.Pointer(old)), + uintptr(unsafe.Pointer(oldlen)), + uintptr(unsafe.Pointer(new)), + uintptr(newlen), + ); err != 0 { + return err + } + + return nil +} + +var libc_sysctl_trampoline_addr uintptr + +// adapted from internal/cpu/cpu_arm64_darwin.go +func darwinSysctlEnabled(name []byte) bool { + out := int32(0) + nout := unsafe.Sizeof(out) + if ret := sysctlbyname(&name[0], (*byte)(unsafe.Pointer(&out)), &nout, nil, 0); ret != nil { + return false + } + return out > 0 +} + +//go:cgo_import_dynamic libc_sysctl sysctl "/usr/lib/libSystem.B.dylib" + +var libc_sysctlbyname_trampoline_addr uintptr + +// adapted from runtime/sys_darwin.go in the pattern of sysctl() above, as defined in x/sys/unix +func sysctlbyname(name *byte, old *byte, oldlen *uintptr, new *byte, newlen uintptr) error { + if _, _, err := syscall_syscall6( + libc_sysctlbyname_trampoline_addr, + uintptr(unsafe.Pointer(name)), + uintptr(unsafe.Pointer(old)), + uintptr(unsafe.Pointer(oldlen)), + uintptr(unsafe.Pointer(new)), + uintptr(newlen), + 0, + ); err != 0 { + return err + } + + return nil +} + +//go:cgo_import_dynamic libc_sysctlbyname sysctlbyname "/usr/lib/libSystem.B.dylib" + +// Implemented in the runtime package (runtime/sys_darwin.go) +func syscall_syscall6(fn, a1, a2, a3, a4, a5, a6 uintptr) (r1, r2 uintptr, err Errno) + +//go:linkname syscall_syscall6 syscall.syscall6 diff --git a/vendor/golang.org/x/text/internal/language/common.go b/vendor/golang.org/x/text/internal/language/common.go new file mode 100644 index 00000000..cdfdb749 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/common.go @@ -0,0 +1,16 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package language + +// This file contains code common to the maketables.go and the package code. + +// AliasType is the type of an alias in AliasMap. +type AliasType int8 + +const ( + Deprecated AliasType = iota + Macro + Legacy + + AliasTypeUnknown AliasType = -1 +) diff --git a/vendor/golang.org/x/text/internal/language/compact.go b/vendor/golang.org/x/text/internal/language/compact.go new file mode 100644 index 00000000..46a00150 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact.go @@ -0,0 +1,29 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +// CompactCoreInfo is a compact integer with the three core tags encoded. +type CompactCoreInfo uint32 + +// GetCompactCore generates a uint32 value that is guaranteed to be unique for +// different language, region, and script values. +func GetCompactCore(t Tag) (cci CompactCoreInfo, ok bool) { + if t.LangID > langNoIndexOffset { + return 0, false + } + cci |= CompactCoreInfo(t.LangID) << (8 + 12) + cci |= CompactCoreInfo(t.ScriptID) << 12 + cci |= CompactCoreInfo(t.RegionID) + return cci, true +} + +// Tag generates a tag from c. +func (c CompactCoreInfo) Tag() Tag { + return Tag{ + LangID: Language(c >> 20), + RegionID: Region(c & 0x3ff), + ScriptID: Script(c>>12) & 0xff, + } +} diff --git a/vendor/golang.org/x/text/internal/language/compact/compact.go b/vendor/golang.org/x/text/internal/language/compact/compact.go new file mode 100644 index 00000000..1b36935e --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/compact.go @@ -0,0 +1,61 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package compact defines a compact representation of language tags. +// +// Common language tags (at least all for which locale information is defined +// in CLDR) are assigned a unique index. Each Tag is associated with such an +// ID for selecting language-related resources (such as translations) as well +// as one for selecting regional defaults (currency, number formatting, etc.) +// +// It may want to export this functionality at some point, but at this point +// this is only available for use within x/text. +package compact // import "golang.org/x/text/internal/language/compact" + +import ( + "sort" + "strings" + + "golang.org/x/text/internal/language" +) + +// ID is an integer identifying a single tag. +type ID uint16 + +func getCoreIndex(t language.Tag) (id ID, ok bool) { + cci, ok := language.GetCompactCore(t) + if !ok { + return 0, false + } + i := sort.Search(len(coreTags), func(i int) bool { + return cci <= coreTags[i] + }) + if i == len(coreTags) || coreTags[i] != cci { + return 0, false + } + return ID(i), true +} + +// Parent returns the ID of the parent or the root ID if id is already the root. +func (id ID) Parent() ID { + return parents[id] +} + +// Tag converts id to an internal language Tag. +func (id ID) Tag() language.Tag { + if int(id) >= len(coreTags) { + return specialTags[int(id)-len(coreTags)] + } + return coreTags[id].Tag() +} + +var specialTags []language.Tag + +func init() { + tags := strings.Split(specialTagsStr, " ") + specialTags = make([]language.Tag, len(tags)) + for i, t := range tags { + specialTags[i] = language.MustParse(t) + } +} diff --git a/vendor/golang.org/x/text/internal/language/compact/language.go b/vendor/golang.org/x/text/internal/language/compact/language.go new file mode 100644 index 00000000..8c1b6666 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/language.go @@ -0,0 +1,260 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go gen_index.go -output tables.go +//go:generate go run gen_parents.go + +package compact + +// TODO: Remove above NOTE after: +// - verifying that tables are dropped correctly (most notably matcher tables). + +import ( + "strings" + + "golang.org/x/text/internal/language" +) + +// Tag represents a BCP 47 language tag. It is used to specify an instance of a +// specific language or locale. All language tag values are guaranteed to be +// well-formed. +type Tag struct { + // NOTE: exported tags will become part of the public API. + language ID + locale ID + full fullTag // always a language.Tag for now. +} + +const _und = 0 + +type fullTag interface { + IsRoot() bool + Parent() language.Tag +} + +// Make a compact Tag from a fully specified internal language Tag. +func Make(t language.Tag) (tag Tag) { + if region := t.TypeForKey("rg"); len(region) == 6 && region[2:] == "zzzz" { + if r, err := language.ParseRegion(region[:2]); err == nil { + tFull := t + t, _ = t.SetTypeForKey("rg", "") + // TODO: should we not consider "va" for the language tag? + var exact1, exact2 bool + tag.language, exact1 = FromTag(t) + t.RegionID = r + tag.locale, exact2 = FromTag(t) + if !exact1 || !exact2 { + tag.full = tFull + } + return tag + } + } + lang, ok := FromTag(t) + tag.language = lang + tag.locale = lang + if !ok { + tag.full = t + } + return tag +} + +// Tag returns an internal language Tag version of this tag. +func (t Tag) Tag() language.Tag { + if t.full != nil { + return t.full.(language.Tag) + } + tag := t.language.Tag() + if t.language != t.locale { + loc := t.locale.Tag() + tag, _ = tag.SetTypeForKey("rg", strings.ToLower(loc.RegionID.String())+"zzzz") + } + return tag +} + +// IsCompact reports whether this tag is fully defined in terms of ID. +func (t *Tag) IsCompact() bool { + return t.full == nil +} + +// MayHaveVariants reports whether a tag may have variants. If it returns false +// it is guaranteed the tag does not have variants. +func (t Tag) MayHaveVariants() bool { + return t.full != nil || int(t.language) >= len(coreTags) +} + +// MayHaveExtensions reports whether a tag may have extensions. If it returns +// false it is guaranteed the tag does not have them. +func (t Tag) MayHaveExtensions() bool { + return t.full != nil || + int(t.language) >= len(coreTags) || + t.language != t.locale +} + +// IsRoot returns true if t is equal to language "und". +func (t Tag) IsRoot() bool { + if t.full != nil { + return t.full.IsRoot() + } + return t.language == _und +} + +// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a +// specific language are substituted with fields from the parent language. +// The parent for a language may change for newer versions of CLDR. +func (t Tag) Parent() Tag { + if t.full != nil { + return Make(t.full.Parent()) + } + if t.language != t.locale { + // Simulate stripping -u-rg-xxxxxx + return Tag{language: t.language, locale: t.language} + } + // TODO: use parent lookup table once cycle from internal package is + // removed. Probably by internalizing the table and declaring this fast + // enough. + // lang := compactID(internal.Parent(uint16(t.language))) + lang, _ := FromTag(t.language.Tag().Parent()) + return Tag{language: lang, locale: lang} +} + +// nextToken returns token t and the rest of the string. +func nextToken(s string) (t, tail string) { + p := strings.Index(s[1:], "-") + if p == -1 { + return s[1:], "" + } + p++ + return s[1:p], s[p:] +} + +// LanguageID returns an index, where 0 <= index < NumCompactTags, for tags +// for which data exists in the text repository.The index will change over time +// and should not be stored in persistent storage. If t does not match a compact +// index, exact will be false and the compact index will be returned for the +// first match after repeatedly taking the Parent of t. +func LanguageID(t Tag) (id ID, exact bool) { + return t.language, t.full == nil +} + +// RegionalID returns the ID for the regional variant of this tag. This index is +// used to indicate region-specific overrides, such as default currency, default +// calendar and week data, default time cycle, and default measurement system +// and unit preferences. +// +// For instance, the tag en-GB-u-rg-uszzzz specifies British English with US +// settings for currency, number formatting, etc. The CompactIndex for this tag +// will be that for en-GB, while the RegionalID will be the one corresponding to +// en-US. +func RegionalID(t Tag) (id ID, exact bool) { + return t.locale, t.full == nil +} + +// LanguageTag returns t stripped of regional variant indicators. +// +// At the moment this means it is stripped of a regional and variant subtag "rg" +// and "va" in the "u" extension. +func (t Tag) LanguageTag() Tag { + if t.full == nil { + return Tag{language: t.language, locale: t.language} + } + tt := t.Tag() + tt.SetTypeForKey("rg", "") + tt.SetTypeForKey("va", "") + return Make(tt) +} + +// RegionalTag returns the regional variant of the tag. +// +// At the moment this means that the region is set from the regional subtag +// "rg" in the "u" extension. +func (t Tag) RegionalTag() Tag { + rt := Tag{language: t.locale, locale: t.locale} + if t.full == nil { + return rt + } + b := language.Builder{} + tag := t.Tag() + // tag, _ = tag.SetTypeForKey("rg", "") + b.SetTag(t.locale.Tag()) + if v := tag.Variants(); v != "" { + for _, v := range strings.Split(v, "-") { + b.AddVariant(v) + } + } + for _, e := range tag.Extensions() { + b.AddExt(e) + } + return t +} + +// FromTag reports closest matching ID for an internal language Tag. +func FromTag(t language.Tag) (id ID, exact bool) { + // TODO: perhaps give more frequent tags a lower index. + // TODO: we could make the indexes stable. This will excluded some + // possibilities for optimization, so don't do this quite yet. + exact = true + + b, s, r := t.Raw() + if t.HasString() { + if t.IsPrivateUse() { + // We have no entries for user-defined tags. + return 0, false + } + hasExtra := false + if t.HasVariants() { + if t.HasExtensions() { + build := language.Builder{} + build.SetTag(language.Tag{LangID: b, ScriptID: s, RegionID: r}) + build.AddVariant(t.Variants()) + exact = false + t = build.Make() + } + hasExtra = true + } else if _, ok := t.Extension('u'); ok { + // TODO: va may mean something else. Consider not considering it. + // Strip all but the 'va' entry. + old := t + variant := t.TypeForKey("va") + t = language.Tag{LangID: b, ScriptID: s, RegionID: r} + if variant != "" { + t, _ = t.SetTypeForKey("va", variant) + hasExtra = true + } + exact = old == t + } else { + exact = false + } + if hasExtra { + // We have some variants. + for i, s := range specialTags { + if s == t { + return ID(i + len(coreTags)), exact + } + } + exact = false + } + } + if x, ok := getCoreIndex(t); ok { + return x, exact + } + exact = false + if r != 0 && s == 0 { + // Deal with cases where an extra script is inserted for the region. + t, _ := t.Maximize() + if x, ok := getCoreIndex(t); ok { + return x, exact + } + } + for t = t.Parent(); t != root; t = t.Parent() { + // No variants specified: just compare core components. + // The key has the form lllssrrr, where l, s, and r are nibbles for + // respectively the langID, scriptID, and regionID. + if x, ok := getCoreIndex(t); ok { + return x, exact + } + } + return 0, exact +} + +var root = language.Tag{} diff --git a/vendor/golang.org/x/text/internal/language/compact/parents.go b/vendor/golang.org/x/text/internal/language/compact/parents.go new file mode 100644 index 00000000..8d810723 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/parents.go @@ -0,0 +1,120 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package compact + +// parents maps a compact index of a tag to the compact index of the parent of +// this tag. +var parents = []ID{ // 775 elements + // Entry 0 - 3F + 0x0000, 0x0000, 0x0001, 0x0001, 0x0000, 0x0004, 0x0000, 0x0006, + 0x0000, 0x0008, 0x0000, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, + 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, + 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, + 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x0000, + 0x0000, 0x0028, 0x0000, 0x002a, 0x0000, 0x002c, 0x0000, 0x0000, + 0x002f, 0x002e, 0x002e, 0x0000, 0x0033, 0x0000, 0x0035, 0x0000, + 0x0037, 0x0000, 0x0039, 0x0000, 0x003b, 0x0000, 0x0000, 0x003e, + // Entry 40 - 7F + 0x0000, 0x0040, 0x0040, 0x0000, 0x0043, 0x0043, 0x0000, 0x0046, + 0x0000, 0x0048, 0x0000, 0x0000, 0x004b, 0x004a, 0x004a, 0x0000, + 0x004f, 0x004f, 0x004f, 0x004f, 0x0000, 0x0054, 0x0054, 0x0000, + 0x0057, 0x0000, 0x0059, 0x0000, 0x005b, 0x0000, 0x005d, 0x005d, + 0x0000, 0x0060, 0x0000, 0x0062, 0x0000, 0x0064, 0x0000, 0x0066, + 0x0066, 0x0000, 0x0069, 0x0000, 0x006b, 0x006b, 0x006b, 0x006b, + 0x006b, 0x006b, 0x006b, 0x0000, 0x0073, 0x0000, 0x0075, 0x0000, + 0x0077, 0x0000, 0x0000, 0x007a, 0x0000, 0x007c, 0x0000, 0x007e, + // Entry 80 - BF + 0x0000, 0x0080, 0x0080, 0x0000, 0x0083, 0x0083, 0x0000, 0x0086, + 0x0087, 0x0087, 0x0087, 0x0086, 0x0088, 0x0087, 0x0087, 0x0087, + 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, 0x0088, 0x0087, + 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0086, + // Entry C0 - FF + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, + 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0086, 0x0087, + 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0000, + 0x00ef, 0x0000, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, + 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f1, 0x00f1, + // Entry 100 - 13F + 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, + 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x0000, 0x010e, + 0x0000, 0x0110, 0x0000, 0x0112, 0x0000, 0x0114, 0x0114, 0x0000, + 0x0117, 0x0117, 0x0117, 0x0117, 0x0000, 0x011c, 0x0000, 0x011e, + 0x0000, 0x0120, 0x0120, 0x0000, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + // Entry 140 - 17F + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0000, 0x0152, 0x0000, 0x0154, 0x0000, 0x0156, + 0x0000, 0x0158, 0x0000, 0x015a, 0x0000, 0x015c, 0x015c, 0x015c, + 0x0000, 0x0160, 0x0000, 0x0000, 0x0163, 0x0000, 0x0165, 0x0000, + 0x0167, 0x0167, 0x0167, 0x0000, 0x016b, 0x0000, 0x016d, 0x0000, + 0x016f, 0x0000, 0x0171, 0x0171, 0x0000, 0x0174, 0x0000, 0x0176, + 0x0000, 0x0178, 0x0000, 0x017a, 0x0000, 0x017c, 0x0000, 0x017e, + // Entry 180 - 1BF + 0x0000, 0x0000, 0x0000, 0x0182, 0x0000, 0x0184, 0x0184, 0x0184, + 0x0184, 0x0000, 0x0000, 0x0000, 0x018b, 0x0000, 0x0000, 0x018e, + 0x0000, 0x0000, 0x0191, 0x0000, 0x0000, 0x0000, 0x0195, 0x0000, + 0x0197, 0x0000, 0x0000, 0x019a, 0x0000, 0x0000, 0x019d, 0x0000, + 0x019f, 0x0000, 0x01a1, 0x0000, 0x01a3, 0x0000, 0x01a5, 0x0000, + 0x01a7, 0x0000, 0x01a9, 0x0000, 0x01ab, 0x0000, 0x01ad, 0x0000, + 0x01af, 0x0000, 0x01b1, 0x01b1, 0x0000, 0x01b4, 0x0000, 0x01b6, + 0x0000, 0x01b8, 0x0000, 0x01ba, 0x0000, 0x01bc, 0x0000, 0x0000, + // Entry 1C0 - 1FF + 0x01bf, 0x0000, 0x01c1, 0x0000, 0x01c3, 0x0000, 0x01c5, 0x0000, + 0x01c7, 0x0000, 0x01c9, 0x0000, 0x01cb, 0x01cb, 0x01cb, 0x01cb, + 0x0000, 0x01d0, 0x0000, 0x01d2, 0x01d2, 0x0000, 0x01d5, 0x0000, + 0x01d7, 0x0000, 0x01d9, 0x0000, 0x01db, 0x0000, 0x01dd, 0x0000, + 0x01df, 0x01df, 0x0000, 0x01e2, 0x0000, 0x01e4, 0x0000, 0x01e6, + 0x0000, 0x01e8, 0x0000, 0x01ea, 0x0000, 0x01ec, 0x0000, 0x01ee, + 0x0000, 0x01f0, 0x0000, 0x0000, 0x01f3, 0x0000, 0x01f5, 0x01f5, + 0x01f5, 0x0000, 0x01f9, 0x0000, 0x01fb, 0x0000, 0x01fd, 0x0000, + // Entry 200 - 23F + 0x01ff, 0x0000, 0x0000, 0x0202, 0x0000, 0x0204, 0x0204, 0x0000, + 0x0207, 0x0000, 0x0209, 0x0209, 0x0000, 0x020c, 0x020c, 0x0000, + 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x0000, + 0x0217, 0x0000, 0x0219, 0x0000, 0x021b, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0221, 0x0000, 0x0000, 0x0224, 0x0000, 0x0226, + 0x0226, 0x0000, 0x0229, 0x0000, 0x022b, 0x022b, 0x0000, 0x0000, + 0x022f, 0x022e, 0x022e, 0x0000, 0x0000, 0x0234, 0x0000, 0x0236, + 0x0000, 0x0238, 0x0000, 0x0244, 0x023a, 0x0244, 0x0244, 0x0244, + // Entry 240 - 27F + 0x0244, 0x0244, 0x0244, 0x0244, 0x023a, 0x0244, 0x0244, 0x0000, + 0x0247, 0x0247, 0x0247, 0x0000, 0x024b, 0x0000, 0x024d, 0x0000, + 0x024f, 0x024f, 0x0000, 0x0252, 0x0000, 0x0254, 0x0254, 0x0254, + 0x0254, 0x0254, 0x0254, 0x0000, 0x025b, 0x0000, 0x025d, 0x0000, + 0x025f, 0x0000, 0x0261, 0x0000, 0x0263, 0x0000, 0x0265, 0x0000, + 0x0000, 0x0268, 0x0268, 0x0268, 0x0000, 0x026c, 0x0000, 0x026e, + 0x0000, 0x0270, 0x0000, 0x0000, 0x0000, 0x0274, 0x0273, 0x0273, + 0x0000, 0x0278, 0x0000, 0x027a, 0x0000, 0x027c, 0x0000, 0x0000, + // Entry 280 - 2BF + 0x0000, 0x0000, 0x0281, 0x0000, 0x0000, 0x0284, 0x0000, 0x0286, + 0x0286, 0x0286, 0x0286, 0x0000, 0x028b, 0x028b, 0x028b, 0x0000, + 0x028f, 0x028f, 0x028f, 0x028f, 0x028f, 0x0000, 0x0295, 0x0295, + 0x0295, 0x0295, 0x0000, 0x0000, 0x0000, 0x0000, 0x029d, 0x029d, + 0x029d, 0x0000, 0x02a1, 0x02a1, 0x02a1, 0x02a1, 0x0000, 0x0000, + 0x02a7, 0x02a7, 0x02a7, 0x02a7, 0x0000, 0x02ac, 0x0000, 0x02ae, + 0x02ae, 0x0000, 0x02b1, 0x0000, 0x02b3, 0x0000, 0x02b5, 0x02b5, + 0x0000, 0x0000, 0x02b9, 0x0000, 0x0000, 0x0000, 0x02bd, 0x0000, + // Entry 2C0 - 2FF + 0x02bf, 0x02bf, 0x0000, 0x0000, 0x02c3, 0x0000, 0x02c5, 0x0000, + 0x02c7, 0x0000, 0x02c9, 0x0000, 0x02cb, 0x0000, 0x02cd, 0x02cd, + 0x0000, 0x0000, 0x02d1, 0x0000, 0x02d3, 0x02d0, 0x02d0, 0x0000, + 0x0000, 0x02d8, 0x02d7, 0x02d7, 0x0000, 0x0000, 0x02dd, 0x0000, + 0x02df, 0x0000, 0x02e1, 0x0000, 0x0000, 0x02e4, 0x0000, 0x02e6, + 0x0000, 0x0000, 0x02e9, 0x0000, 0x02eb, 0x0000, 0x02ed, 0x0000, + 0x02ef, 0x02ef, 0x0000, 0x0000, 0x02f3, 0x02f2, 0x02f2, 0x0000, + 0x02f7, 0x0000, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x0000, + // Entry 300 - 33F + 0x02ff, 0x0300, 0x02ff, 0x0000, 0x0303, 0x0051, 0x00e6, +} // Size: 1574 bytes + +// Total table size 1574 bytes (1KiB); checksum: 895AAF0B diff --git a/vendor/golang.org/x/text/internal/language/compact/tables.go b/vendor/golang.org/x/text/internal/language/compact/tables.go new file mode 100644 index 00000000..a09ed198 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/tables.go @@ -0,0 +1,1015 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package compact + +import "golang.org/x/text/internal/language" + +// CLDRVersion is the CLDR version from which the tables in this package are derived. +const CLDRVersion = "32" + +// NumCompactTags is the number of common tags. The maximum tag is +// NumCompactTags-1. +const NumCompactTags = 775 +const ( + undIndex ID = 0 + afIndex ID = 1 + afNAIndex ID = 2 + afZAIndex ID = 3 + agqIndex ID = 4 + agqCMIndex ID = 5 + akIndex ID = 6 + akGHIndex ID = 7 + amIndex ID = 8 + amETIndex ID = 9 + arIndex ID = 10 + ar001Index ID = 11 + arAEIndex ID = 12 + arBHIndex ID = 13 + arDJIndex ID = 14 + arDZIndex ID = 15 + arEGIndex ID = 16 + arEHIndex ID = 17 + arERIndex ID = 18 + arILIndex ID = 19 + arIQIndex ID = 20 + arJOIndex ID = 21 + arKMIndex ID = 22 + arKWIndex ID = 23 + arLBIndex ID = 24 + arLYIndex ID = 25 + arMAIndex ID = 26 + arMRIndex ID = 27 + arOMIndex ID = 28 + arPSIndex ID = 29 + arQAIndex ID = 30 + arSAIndex ID = 31 + arSDIndex ID = 32 + arSOIndex ID = 33 + arSSIndex ID = 34 + arSYIndex ID = 35 + arTDIndex ID = 36 + arTNIndex ID = 37 + arYEIndex ID = 38 + arsIndex ID = 39 + asIndex ID = 40 + asINIndex ID = 41 + asaIndex ID = 42 + asaTZIndex ID = 43 + astIndex ID = 44 + astESIndex ID = 45 + azIndex ID = 46 + azCyrlIndex ID = 47 + azCyrlAZIndex ID = 48 + azLatnIndex ID = 49 + azLatnAZIndex ID = 50 + basIndex ID = 51 + basCMIndex ID = 52 + beIndex ID = 53 + beBYIndex ID = 54 + bemIndex ID = 55 + bemZMIndex ID = 56 + bezIndex ID = 57 + bezTZIndex ID = 58 + bgIndex ID = 59 + bgBGIndex ID = 60 + bhIndex ID = 61 + bmIndex ID = 62 + bmMLIndex ID = 63 + bnIndex ID = 64 + bnBDIndex ID = 65 + bnINIndex ID = 66 + boIndex ID = 67 + boCNIndex ID = 68 + boINIndex ID = 69 + brIndex ID = 70 + brFRIndex ID = 71 + brxIndex ID = 72 + brxINIndex ID = 73 + bsIndex ID = 74 + bsCyrlIndex ID = 75 + bsCyrlBAIndex ID = 76 + bsLatnIndex ID = 77 + bsLatnBAIndex ID = 78 + caIndex ID = 79 + caADIndex ID = 80 + caESIndex ID = 81 + caFRIndex ID = 82 + caITIndex ID = 83 + ccpIndex ID = 84 + ccpBDIndex ID = 85 + ccpINIndex ID = 86 + ceIndex ID = 87 + ceRUIndex ID = 88 + cggIndex ID = 89 + cggUGIndex ID = 90 + chrIndex ID = 91 + chrUSIndex ID = 92 + ckbIndex ID = 93 + ckbIQIndex ID = 94 + ckbIRIndex ID = 95 + csIndex ID = 96 + csCZIndex ID = 97 + cuIndex ID = 98 + cuRUIndex ID = 99 + cyIndex ID = 100 + cyGBIndex ID = 101 + daIndex ID = 102 + daDKIndex ID = 103 + daGLIndex ID = 104 + davIndex ID = 105 + davKEIndex ID = 106 + deIndex ID = 107 + deATIndex ID = 108 + deBEIndex ID = 109 + deCHIndex ID = 110 + deDEIndex ID = 111 + deITIndex ID = 112 + deLIIndex ID = 113 + deLUIndex ID = 114 + djeIndex ID = 115 + djeNEIndex ID = 116 + dsbIndex ID = 117 + dsbDEIndex ID = 118 + duaIndex ID = 119 + duaCMIndex ID = 120 + dvIndex ID = 121 + dyoIndex ID = 122 + dyoSNIndex ID = 123 + dzIndex ID = 124 + dzBTIndex ID = 125 + ebuIndex ID = 126 + ebuKEIndex ID = 127 + eeIndex ID = 128 + eeGHIndex ID = 129 + eeTGIndex ID = 130 + elIndex ID = 131 + elCYIndex ID = 132 + elGRIndex ID = 133 + enIndex ID = 134 + en001Index ID = 135 + en150Index ID = 136 + enAGIndex ID = 137 + enAIIndex ID = 138 + enASIndex ID = 139 + enATIndex ID = 140 + enAUIndex ID = 141 + enBBIndex ID = 142 + enBEIndex ID = 143 + enBIIndex ID = 144 + enBMIndex ID = 145 + enBSIndex ID = 146 + enBWIndex ID = 147 + enBZIndex ID = 148 + enCAIndex ID = 149 + enCCIndex ID = 150 + enCHIndex ID = 151 + enCKIndex ID = 152 + enCMIndex ID = 153 + enCXIndex ID = 154 + enCYIndex ID = 155 + enDEIndex ID = 156 + enDGIndex ID = 157 + enDKIndex ID = 158 + enDMIndex ID = 159 + enERIndex ID = 160 + enFIIndex ID = 161 + enFJIndex ID = 162 + enFKIndex ID = 163 + enFMIndex ID = 164 + enGBIndex ID = 165 + enGDIndex ID = 166 + enGGIndex ID = 167 + enGHIndex ID = 168 + enGIIndex ID = 169 + enGMIndex ID = 170 + enGUIndex ID = 171 + enGYIndex ID = 172 + enHKIndex ID = 173 + enIEIndex ID = 174 + enILIndex ID = 175 + enIMIndex ID = 176 + enINIndex ID = 177 + enIOIndex ID = 178 + enJEIndex ID = 179 + enJMIndex ID = 180 + enKEIndex ID = 181 + enKIIndex ID = 182 + enKNIndex ID = 183 + enKYIndex ID = 184 + enLCIndex ID = 185 + enLRIndex ID = 186 + enLSIndex ID = 187 + enMGIndex ID = 188 + enMHIndex ID = 189 + enMOIndex ID = 190 + enMPIndex ID = 191 + enMSIndex ID = 192 + enMTIndex ID = 193 + enMUIndex ID = 194 + enMWIndex ID = 195 + enMYIndex ID = 196 + enNAIndex ID = 197 + enNFIndex ID = 198 + enNGIndex ID = 199 + enNLIndex ID = 200 + enNRIndex ID = 201 + enNUIndex ID = 202 + enNZIndex ID = 203 + enPGIndex ID = 204 + enPHIndex ID = 205 + enPKIndex ID = 206 + enPNIndex ID = 207 + enPRIndex ID = 208 + enPWIndex ID = 209 + enRWIndex ID = 210 + enSBIndex ID = 211 + enSCIndex ID = 212 + enSDIndex ID = 213 + enSEIndex ID = 214 + enSGIndex ID = 215 + enSHIndex ID = 216 + enSIIndex ID = 217 + enSLIndex ID = 218 + enSSIndex ID = 219 + enSXIndex ID = 220 + enSZIndex ID = 221 + enTCIndex ID = 222 + enTKIndex ID = 223 + enTOIndex ID = 224 + enTTIndex ID = 225 + enTVIndex ID = 226 + enTZIndex ID = 227 + enUGIndex ID = 228 + enUMIndex ID = 229 + enUSIndex ID = 230 + enVCIndex ID = 231 + enVGIndex ID = 232 + enVIIndex ID = 233 + enVUIndex ID = 234 + enWSIndex ID = 235 + enZAIndex ID = 236 + enZMIndex ID = 237 + enZWIndex ID = 238 + eoIndex ID = 239 + eo001Index ID = 240 + esIndex ID = 241 + es419Index ID = 242 + esARIndex ID = 243 + esBOIndex ID = 244 + esBRIndex ID = 245 + esBZIndex ID = 246 + esCLIndex ID = 247 + esCOIndex ID = 248 + esCRIndex ID = 249 + esCUIndex ID = 250 + esDOIndex ID = 251 + esEAIndex ID = 252 + esECIndex ID = 253 + esESIndex ID = 254 + esGQIndex ID = 255 + esGTIndex ID = 256 + esHNIndex ID = 257 + esICIndex ID = 258 + esMXIndex ID = 259 + esNIIndex ID = 260 + esPAIndex ID = 261 + esPEIndex ID = 262 + esPHIndex ID = 263 + esPRIndex ID = 264 + esPYIndex ID = 265 + esSVIndex ID = 266 + esUSIndex ID = 267 + esUYIndex ID = 268 + esVEIndex ID = 269 + etIndex ID = 270 + etEEIndex ID = 271 + euIndex ID = 272 + euESIndex ID = 273 + ewoIndex ID = 274 + ewoCMIndex ID = 275 + faIndex ID = 276 + faAFIndex ID = 277 + faIRIndex ID = 278 + ffIndex ID = 279 + ffCMIndex ID = 280 + ffGNIndex ID = 281 + ffMRIndex ID = 282 + ffSNIndex ID = 283 + fiIndex ID = 284 + fiFIIndex ID = 285 + filIndex ID = 286 + filPHIndex ID = 287 + foIndex ID = 288 + foDKIndex ID = 289 + foFOIndex ID = 290 + frIndex ID = 291 + frBEIndex ID = 292 + frBFIndex ID = 293 + frBIIndex ID = 294 + frBJIndex ID = 295 + frBLIndex ID = 296 + frCAIndex ID = 297 + frCDIndex ID = 298 + frCFIndex ID = 299 + frCGIndex ID = 300 + frCHIndex ID = 301 + frCIIndex ID = 302 + frCMIndex ID = 303 + frDJIndex ID = 304 + frDZIndex ID = 305 + frFRIndex ID = 306 + frGAIndex ID = 307 + frGFIndex ID = 308 + frGNIndex ID = 309 + frGPIndex ID = 310 + frGQIndex ID = 311 + frHTIndex ID = 312 + frKMIndex ID = 313 + frLUIndex ID = 314 + frMAIndex ID = 315 + frMCIndex ID = 316 + frMFIndex ID = 317 + frMGIndex ID = 318 + frMLIndex ID = 319 + frMQIndex ID = 320 + frMRIndex ID = 321 + frMUIndex ID = 322 + frNCIndex ID = 323 + frNEIndex ID = 324 + frPFIndex ID = 325 + frPMIndex ID = 326 + frREIndex ID = 327 + frRWIndex ID = 328 + frSCIndex ID = 329 + frSNIndex ID = 330 + frSYIndex ID = 331 + frTDIndex ID = 332 + frTGIndex ID = 333 + frTNIndex ID = 334 + frVUIndex ID = 335 + frWFIndex ID = 336 + frYTIndex ID = 337 + furIndex ID = 338 + furITIndex ID = 339 + fyIndex ID = 340 + fyNLIndex ID = 341 + gaIndex ID = 342 + gaIEIndex ID = 343 + gdIndex ID = 344 + gdGBIndex ID = 345 + glIndex ID = 346 + glESIndex ID = 347 + gswIndex ID = 348 + gswCHIndex ID = 349 + gswFRIndex ID = 350 + gswLIIndex ID = 351 + guIndex ID = 352 + guINIndex ID = 353 + guwIndex ID = 354 + guzIndex ID = 355 + guzKEIndex ID = 356 + gvIndex ID = 357 + gvIMIndex ID = 358 + haIndex ID = 359 + haGHIndex ID = 360 + haNEIndex ID = 361 + haNGIndex ID = 362 + hawIndex ID = 363 + hawUSIndex ID = 364 + heIndex ID = 365 + heILIndex ID = 366 + hiIndex ID = 367 + hiINIndex ID = 368 + hrIndex ID = 369 + hrBAIndex ID = 370 + hrHRIndex ID = 371 + hsbIndex ID = 372 + hsbDEIndex ID = 373 + huIndex ID = 374 + huHUIndex ID = 375 + hyIndex ID = 376 + hyAMIndex ID = 377 + idIndex ID = 378 + idIDIndex ID = 379 + igIndex ID = 380 + igNGIndex ID = 381 + iiIndex ID = 382 + iiCNIndex ID = 383 + inIndex ID = 384 + ioIndex ID = 385 + isIndex ID = 386 + isISIndex ID = 387 + itIndex ID = 388 + itCHIndex ID = 389 + itITIndex ID = 390 + itSMIndex ID = 391 + itVAIndex ID = 392 + iuIndex ID = 393 + iwIndex ID = 394 + jaIndex ID = 395 + jaJPIndex ID = 396 + jboIndex ID = 397 + jgoIndex ID = 398 + jgoCMIndex ID = 399 + jiIndex ID = 400 + jmcIndex ID = 401 + jmcTZIndex ID = 402 + jvIndex ID = 403 + jwIndex ID = 404 + kaIndex ID = 405 + kaGEIndex ID = 406 + kabIndex ID = 407 + kabDZIndex ID = 408 + kajIndex ID = 409 + kamIndex ID = 410 + kamKEIndex ID = 411 + kcgIndex ID = 412 + kdeIndex ID = 413 + kdeTZIndex ID = 414 + keaIndex ID = 415 + keaCVIndex ID = 416 + khqIndex ID = 417 + khqMLIndex ID = 418 + kiIndex ID = 419 + kiKEIndex ID = 420 + kkIndex ID = 421 + kkKZIndex ID = 422 + kkjIndex ID = 423 + kkjCMIndex ID = 424 + klIndex ID = 425 + klGLIndex ID = 426 + klnIndex ID = 427 + klnKEIndex ID = 428 + kmIndex ID = 429 + kmKHIndex ID = 430 + knIndex ID = 431 + knINIndex ID = 432 + koIndex ID = 433 + koKPIndex ID = 434 + koKRIndex ID = 435 + kokIndex ID = 436 + kokINIndex ID = 437 + ksIndex ID = 438 + ksINIndex ID = 439 + ksbIndex ID = 440 + ksbTZIndex ID = 441 + ksfIndex ID = 442 + ksfCMIndex ID = 443 + kshIndex ID = 444 + kshDEIndex ID = 445 + kuIndex ID = 446 + kwIndex ID = 447 + kwGBIndex ID = 448 + kyIndex ID = 449 + kyKGIndex ID = 450 + lagIndex ID = 451 + lagTZIndex ID = 452 + lbIndex ID = 453 + lbLUIndex ID = 454 + lgIndex ID = 455 + lgUGIndex ID = 456 + lktIndex ID = 457 + lktUSIndex ID = 458 + lnIndex ID = 459 + lnAOIndex ID = 460 + lnCDIndex ID = 461 + lnCFIndex ID = 462 + lnCGIndex ID = 463 + loIndex ID = 464 + loLAIndex ID = 465 + lrcIndex ID = 466 + lrcIQIndex ID = 467 + lrcIRIndex ID = 468 + ltIndex ID = 469 + ltLTIndex ID = 470 + luIndex ID = 471 + luCDIndex ID = 472 + luoIndex ID = 473 + luoKEIndex ID = 474 + luyIndex ID = 475 + luyKEIndex ID = 476 + lvIndex ID = 477 + lvLVIndex ID = 478 + masIndex ID = 479 + masKEIndex ID = 480 + masTZIndex ID = 481 + merIndex ID = 482 + merKEIndex ID = 483 + mfeIndex ID = 484 + mfeMUIndex ID = 485 + mgIndex ID = 486 + mgMGIndex ID = 487 + mghIndex ID = 488 + mghMZIndex ID = 489 + mgoIndex ID = 490 + mgoCMIndex ID = 491 + mkIndex ID = 492 + mkMKIndex ID = 493 + mlIndex ID = 494 + mlINIndex ID = 495 + mnIndex ID = 496 + mnMNIndex ID = 497 + moIndex ID = 498 + mrIndex ID = 499 + mrINIndex ID = 500 + msIndex ID = 501 + msBNIndex ID = 502 + msMYIndex ID = 503 + msSGIndex ID = 504 + mtIndex ID = 505 + mtMTIndex ID = 506 + muaIndex ID = 507 + muaCMIndex ID = 508 + myIndex ID = 509 + myMMIndex ID = 510 + mznIndex ID = 511 + mznIRIndex ID = 512 + nahIndex ID = 513 + naqIndex ID = 514 + naqNAIndex ID = 515 + nbIndex ID = 516 + nbNOIndex ID = 517 + nbSJIndex ID = 518 + ndIndex ID = 519 + ndZWIndex ID = 520 + ndsIndex ID = 521 + ndsDEIndex ID = 522 + ndsNLIndex ID = 523 + neIndex ID = 524 + neINIndex ID = 525 + neNPIndex ID = 526 + nlIndex ID = 527 + nlAWIndex ID = 528 + nlBEIndex ID = 529 + nlBQIndex ID = 530 + nlCWIndex ID = 531 + nlNLIndex ID = 532 + nlSRIndex ID = 533 + nlSXIndex ID = 534 + nmgIndex ID = 535 + nmgCMIndex ID = 536 + nnIndex ID = 537 + nnNOIndex ID = 538 + nnhIndex ID = 539 + nnhCMIndex ID = 540 + noIndex ID = 541 + nqoIndex ID = 542 + nrIndex ID = 543 + nsoIndex ID = 544 + nusIndex ID = 545 + nusSSIndex ID = 546 + nyIndex ID = 547 + nynIndex ID = 548 + nynUGIndex ID = 549 + omIndex ID = 550 + omETIndex ID = 551 + omKEIndex ID = 552 + orIndex ID = 553 + orINIndex ID = 554 + osIndex ID = 555 + osGEIndex ID = 556 + osRUIndex ID = 557 + paIndex ID = 558 + paArabIndex ID = 559 + paArabPKIndex ID = 560 + paGuruIndex ID = 561 + paGuruINIndex ID = 562 + papIndex ID = 563 + plIndex ID = 564 + plPLIndex ID = 565 + prgIndex ID = 566 + prg001Index ID = 567 + psIndex ID = 568 + psAFIndex ID = 569 + ptIndex ID = 570 + ptAOIndex ID = 571 + ptBRIndex ID = 572 + ptCHIndex ID = 573 + ptCVIndex ID = 574 + ptGQIndex ID = 575 + ptGWIndex ID = 576 + ptLUIndex ID = 577 + ptMOIndex ID = 578 + ptMZIndex ID = 579 + ptPTIndex ID = 580 + ptSTIndex ID = 581 + ptTLIndex ID = 582 + quIndex ID = 583 + quBOIndex ID = 584 + quECIndex ID = 585 + quPEIndex ID = 586 + rmIndex ID = 587 + rmCHIndex ID = 588 + rnIndex ID = 589 + rnBIIndex ID = 590 + roIndex ID = 591 + roMDIndex ID = 592 + roROIndex ID = 593 + rofIndex ID = 594 + rofTZIndex ID = 595 + ruIndex ID = 596 + ruBYIndex ID = 597 + ruKGIndex ID = 598 + ruKZIndex ID = 599 + ruMDIndex ID = 600 + ruRUIndex ID = 601 + ruUAIndex ID = 602 + rwIndex ID = 603 + rwRWIndex ID = 604 + rwkIndex ID = 605 + rwkTZIndex ID = 606 + sahIndex ID = 607 + sahRUIndex ID = 608 + saqIndex ID = 609 + saqKEIndex ID = 610 + sbpIndex ID = 611 + sbpTZIndex ID = 612 + sdIndex ID = 613 + sdPKIndex ID = 614 + sdhIndex ID = 615 + seIndex ID = 616 + seFIIndex ID = 617 + seNOIndex ID = 618 + seSEIndex ID = 619 + sehIndex ID = 620 + sehMZIndex ID = 621 + sesIndex ID = 622 + sesMLIndex ID = 623 + sgIndex ID = 624 + sgCFIndex ID = 625 + shIndex ID = 626 + shiIndex ID = 627 + shiLatnIndex ID = 628 + shiLatnMAIndex ID = 629 + shiTfngIndex ID = 630 + shiTfngMAIndex ID = 631 + siIndex ID = 632 + siLKIndex ID = 633 + skIndex ID = 634 + skSKIndex ID = 635 + slIndex ID = 636 + slSIIndex ID = 637 + smaIndex ID = 638 + smiIndex ID = 639 + smjIndex ID = 640 + smnIndex ID = 641 + smnFIIndex ID = 642 + smsIndex ID = 643 + snIndex ID = 644 + snZWIndex ID = 645 + soIndex ID = 646 + soDJIndex ID = 647 + soETIndex ID = 648 + soKEIndex ID = 649 + soSOIndex ID = 650 + sqIndex ID = 651 + sqALIndex ID = 652 + sqMKIndex ID = 653 + sqXKIndex ID = 654 + srIndex ID = 655 + srCyrlIndex ID = 656 + srCyrlBAIndex ID = 657 + srCyrlMEIndex ID = 658 + srCyrlRSIndex ID = 659 + srCyrlXKIndex ID = 660 + srLatnIndex ID = 661 + srLatnBAIndex ID = 662 + srLatnMEIndex ID = 663 + srLatnRSIndex ID = 664 + srLatnXKIndex ID = 665 + ssIndex ID = 666 + ssyIndex ID = 667 + stIndex ID = 668 + svIndex ID = 669 + svAXIndex ID = 670 + svFIIndex ID = 671 + svSEIndex ID = 672 + swIndex ID = 673 + swCDIndex ID = 674 + swKEIndex ID = 675 + swTZIndex ID = 676 + swUGIndex ID = 677 + syrIndex ID = 678 + taIndex ID = 679 + taINIndex ID = 680 + taLKIndex ID = 681 + taMYIndex ID = 682 + taSGIndex ID = 683 + teIndex ID = 684 + teINIndex ID = 685 + teoIndex ID = 686 + teoKEIndex ID = 687 + teoUGIndex ID = 688 + tgIndex ID = 689 + tgTJIndex ID = 690 + thIndex ID = 691 + thTHIndex ID = 692 + tiIndex ID = 693 + tiERIndex ID = 694 + tiETIndex ID = 695 + tigIndex ID = 696 + tkIndex ID = 697 + tkTMIndex ID = 698 + tlIndex ID = 699 + tnIndex ID = 700 + toIndex ID = 701 + toTOIndex ID = 702 + trIndex ID = 703 + trCYIndex ID = 704 + trTRIndex ID = 705 + tsIndex ID = 706 + ttIndex ID = 707 + ttRUIndex ID = 708 + twqIndex ID = 709 + twqNEIndex ID = 710 + tzmIndex ID = 711 + tzmMAIndex ID = 712 + ugIndex ID = 713 + ugCNIndex ID = 714 + ukIndex ID = 715 + ukUAIndex ID = 716 + urIndex ID = 717 + urINIndex ID = 718 + urPKIndex ID = 719 + uzIndex ID = 720 + uzArabIndex ID = 721 + uzArabAFIndex ID = 722 + uzCyrlIndex ID = 723 + uzCyrlUZIndex ID = 724 + uzLatnIndex ID = 725 + uzLatnUZIndex ID = 726 + vaiIndex ID = 727 + vaiLatnIndex ID = 728 + vaiLatnLRIndex ID = 729 + vaiVaiiIndex ID = 730 + vaiVaiiLRIndex ID = 731 + veIndex ID = 732 + viIndex ID = 733 + viVNIndex ID = 734 + voIndex ID = 735 + vo001Index ID = 736 + vunIndex ID = 737 + vunTZIndex ID = 738 + waIndex ID = 739 + waeIndex ID = 740 + waeCHIndex ID = 741 + woIndex ID = 742 + woSNIndex ID = 743 + xhIndex ID = 744 + xogIndex ID = 745 + xogUGIndex ID = 746 + yavIndex ID = 747 + yavCMIndex ID = 748 + yiIndex ID = 749 + yi001Index ID = 750 + yoIndex ID = 751 + yoBJIndex ID = 752 + yoNGIndex ID = 753 + yueIndex ID = 754 + yueHansIndex ID = 755 + yueHansCNIndex ID = 756 + yueHantIndex ID = 757 + yueHantHKIndex ID = 758 + zghIndex ID = 759 + zghMAIndex ID = 760 + zhIndex ID = 761 + zhHansIndex ID = 762 + zhHansCNIndex ID = 763 + zhHansHKIndex ID = 764 + zhHansMOIndex ID = 765 + zhHansSGIndex ID = 766 + zhHantIndex ID = 767 + zhHantHKIndex ID = 768 + zhHantMOIndex ID = 769 + zhHantTWIndex ID = 770 + zuIndex ID = 771 + zuZAIndex ID = 772 + caESvalenciaIndex ID = 773 + enUSuvaposixIndex ID = 774 +) + +var coreTags = []language.CompactCoreInfo{ // 773 elements + // Entry 0 - 1F + 0x00000000, 0x01600000, 0x016000d3, 0x01600162, + 0x01c00000, 0x01c00052, 0x02100000, 0x02100081, + 0x02700000, 0x02700070, 0x03a00000, 0x03a00001, + 0x03a00023, 0x03a00039, 0x03a00063, 0x03a00068, + 0x03a0006c, 0x03a0006d, 0x03a0006e, 0x03a00098, + 0x03a0009c, 0x03a000a2, 0x03a000a9, 0x03a000ad, + 0x03a000b1, 0x03a000ba, 0x03a000bb, 0x03a000ca, + 0x03a000e2, 0x03a000ee, 0x03a000f4, 0x03a00109, + // Entry 20 - 3F + 0x03a0010c, 0x03a00116, 0x03a00118, 0x03a0011d, + 0x03a00121, 0x03a00129, 0x03a0015f, 0x04000000, + 0x04300000, 0x0430009a, 0x04400000, 0x04400130, + 0x04800000, 0x0480006f, 0x05800000, 0x05820000, + 0x05820032, 0x0585b000, 0x0585b032, 0x05e00000, + 0x05e00052, 0x07100000, 0x07100047, 0x07500000, + 0x07500163, 0x07900000, 0x07900130, 0x07e00000, + 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c4, + // Entry 40 - 5F + 0x0a500000, 0x0a500035, 0x0a50009a, 0x0a900000, + 0x0a900053, 0x0a90009a, 0x0b200000, 0x0b200079, + 0x0b500000, 0x0b50009a, 0x0b700000, 0x0b720000, + 0x0b720033, 0x0b75b000, 0x0b75b033, 0x0d700000, + 0x0d700022, 0x0d70006f, 0x0d700079, 0x0d70009f, + 0x0db00000, 0x0db00035, 0x0db0009a, 0x0dc00000, + 0x0dc00107, 0x0df00000, 0x0df00132, 0x0e500000, + 0x0e500136, 0x0e900000, 0x0e90009c, 0x0e90009d, + // Entry 60 - 7F + 0x0fa00000, 0x0fa0005f, 0x0fe00000, 0x0fe00107, + 0x10000000, 0x1000007c, 0x10100000, 0x10100064, + 0x10100083, 0x10800000, 0x108000a5, 0x10d00000, + 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00061, + 0x10d0009f, 0x10d000b3, 0x10d000b8, 0x11700000, + 0x117000d5, 0x11f00000, 0x11f00061, 0x12400000, + 0x12400052, 0x12800000, 0x12b00000, 0x12b00115, + 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a5, + // Entry 80 - 9F + 0x13000000, 0x13000081, 0x13000123, 0x13600000, + 0x1360005e, 0x13600088, 0x13900000, 0x13900001, + 0x1390001a, 0x13900025, 0x13900026, 0x1390002d, + 0x1390002e, 0x1390002f, 0x13900034, 0x13900036, + 0x1390003a, 0x1390003d, 0x13900042, 0x13900046, + 0x13900048, 0x13900049, 0x1390004a, 0x1390004e, + 0x13900050, 0x13900052, 0x1390005d, 0x1390005e, + 0x13900061, 0x13900062, 0x13900064, 0x13900065, + // Entry A0 - BF + 0x1390006e, 0x13900073, 0x13900074, 0x13900075, + 0x13900076, 0x1390007c, 0x1390007d, 0x13900080, + 0x13900081, 0x13900082, 0x13900084, 0x1390008b, + 0x1390008d, 0x1390008e, 0x13900097, 0x13900098, + 0x13900099, 0x1390009a, 0x1390009b, 0x139000a0, + 0x139000a1, 0x139000a5, 0x139000a8, 0x139000aa, + 0x139000ae, 0x139000b2, 0x139000b5, 0x139000b6, + 0x139000c0, 0x139000c1, 0x139000c7, 0x139000c8, + // Entry C0 - DF + 0x139000cb, 0x139000cc, 0x139000cd, 0x139000cf, + 0x139000d1, 0x139000d3, 0x139000d6, 0x139000d7, + 0x139000da, 0x139000de, 0x139000e0, 0x139000e1, + 0x139000e7, 0x139000e8, 0x139000e9, 0x139000ec, + 0x139000ed, 0x139000f1, 0x13900108, 0x1390010a, + 0x1390010b, 0x1390010c, 0x1390010d, 0x1390010e, + 0x1390010f, 0x13900110, 0x13900113, 0x13900118, + 0x1390011c, 0x1390011e, 0x13900120, 0x13900126, + // Entry E0 - FF + 0x1390012a, 0x1390012d, 0x1390012e, 0x13900130, + 0x13900132, 0x13900134, 0x13900136, 0x1390013a, + 0x1390013d, 0x1390013e, 0x13900140, 0x13900143, + 0x13900162, 0x13900163, 0x13900165, 0x13c00000, + 0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c, + 0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051, + 0x13e00054, 0x13e00057, 0x13e0005a, 0x13e00066, + 0x13e00069, 0x13e0006a, 0x13e0006f, 0x13e00087, + // Entry 100 - 11F + 0x13e0008a, 0x13e00090, 0x13e00095, 0x13e000d0, + 0x13e000d9, 0x13e000e3, 0x13e000e5, 0x13e000e8, + 0x13e000ed, 0x13e000f2, 0x13e0011b, 0x13e00136, + 0x13e00137, 0x13e0013c, 0x14000000, 0x1400006b, + 0x14500000, 0x1450006f, 0x14600000, 0x14600052, + 0x14800000, 0x14800024, 0x1480009d, 0x14e00000, + 0x14e00052, 0x14e00085, 0x14e000ca, 0x14e00115, + 0x15100000, 0x15100073, 0x15300000, 0x153000e8, + // Entry 120 - 13F + 0x15800000, 0x15800064, 0x15800077, 0x15e00000, + 0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b, + 0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c, + 0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052, + 0x15e00063, 0x15e00068, 0x15e00079, 0x15e0007b, + 0x15e0007f, 0x15e00085, 0x15e00086, 0x15e00087, + 0x15e00092, 0x15e000a9, 0x15e000b8, 0x15e000bb, + 0x15e000bc, 0x15e000bf, 0x15e000c0, 0x15e000c4, + // Entry 140 - 15F + 0x15e000c9, 0x15e000ca, 0x15e000cd, 0x15e000d4, + 0x15e000d5, 0x15e000e6, 0x15e000eb, 0x15e00103, + 0x15e00108, 0x15e0010b, 0x15e00115, 0x15e0011d, + 0x15e00121, 0x15e00123, 0x15e00129, 0x15e00140, + 0x15e00141, 0x15e00160, 0x16900000, 0x1690009f, + 0x16d00000, 0x16d000da, 0x16e00000, 0x16e00097, + 0x17e00000, 0x17e0007c, 0x19000000, 0x1900006f, + 0x1a300000, 0x1a30004e, 0x1a300079, 0x1a3000b3, + // Entry 160 - 17F + 0x1a400000, 0x1a40009a, 0x1a900000, 0x1ab00000, + 0x1ab000a5, 0x1ac00000, 0x1ac00099, 0x1b400000, + 0x1b400081, 0x1b4000d5, 0x1b4000d7, 0x1b800000, + 0x1b800136, 0x1bc00000, 0x1bc00098, 0x1be00000, + 0x1be0009a, 0x1d100000, 0x1d100033, 0x1d100091, + 0x1d200000, 0x1d200061, 0x1d500000, 0x1d500093, + 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100096, + 0x1e700000, 0x1e7000d7, 0x1ea00000, 0x1ea00053, + // Entry 180 - 19F + 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009e, + 0x1f900000, 0x1f90004e, 0x1f90009f, 0x1f900114, + 0x1f900139, 0x1fa00000, 0x1fb00000, 0x20000000, + 0x200000a3, 0x20300000, 0x20700000, 0x20700052, + 0x20800000, 0x20a00000, 0x20a00130, 0x20e00000, + 0x20f00000, 0x21000000, 0x2100007e, 0x21200000, + 0x21200068, 0x21600000, 0x21700000, 0x217000a5, + 0x21f00000, 0x22300000, 0x22300130, 0x22700000, + // Entry 1A0 - 1BF + 0x2270005b, 0x23400000, 0x234000c4, 0x23900000, + 0x239000a5, 0x24200000, 0x242000af, 0x24400000, + 0x24400052, 0x24500000, 0x24500083, 0x24600000, + 0x246000a5, 0x24a00000, 0x24a000a7, 0x25100000, + 0x2510009a, 0x25400000, 0x254000ab, 0x254000ac, + 0x25600000, 0x2560009a, 0x26a00000, 0x26a0009a, + 0x26b00000, 0x26b00130, 0x26d00000, 0x26d00052, + 0x26e00000, 0x26e00061, 0x27400000, 0x28100000, + // Entry 1C0 - 1DF + 0x2810007c, 0x28a00000, 0x28a000a6, 0x29100000, + 0x29100130, 0x29500000, 0x295000b8, 0x2a300000, + 0x2a300132, 0x2af00000, 0x2af00136, 0x2b500000, + 0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d, + 0x2b800000, 0x2b8000b0, 0x2bf00000, 0x2bf0009c, + 0x2bf0009d, 0x2c000000, 0x2c0000b7, 0x2c200000, + 0x2c20004b, 0x2c400000, 0x2c4000a5, 0x2c500000, + 0x2c5000a5, 0x2c700000, 0x2c7000b9, 0x2d100000, + // Entry 1E0 - 1FF + 0x2d1000a5, 0x2d100130, 0x2e900000, 0x2e9000a5, + 0x2ed00000, 0x2ed000cd, 0x2f100000, 0x2f1000c0, + 0x2f200000, 0x2f2000d2, 0x2f400000, 0x2f400052, + 0x2ff00000, 0x2ff000c3, 0x30400000, 0x3040009a, + 0x30b00000, 0x30b000c6, 0x31000000, 0x31b00000, + 0x31b0009a, 0x31f00000, 0x31f0003e, 0x31f000d1, + 0x31f0010e, 0x32000000, 0x320000cc, 0x32500000, + 0x32500052, 0x33100000, 0x331000c5, 0x33a00000, + // Entry 200 - 21F + 0x33a0009d, 0x34100000, 0x34500000, 0x345000d3, + 0x34700000, 0x347000db, 0x34700111, 0x34e00000, + 0x34e00165, 0x35000000, 0x35000061, 0x350000da, + 0x35100000, 0x3510009a, 0x351000dc, 0x36700000, + 0x36700030, 0x36700036, 0x36700040, 0x3670005c, + 0x367000da, 0x36700117, 0x3670011c, 0x36800000, + 0x36800052, 0x36a00000, 0x36a000db, 0x36c00000, + 0x36c00052, 0x36f00000, 0x37500000, 0x37600000, + // Entry 220 - 23F + 0x37a00000, 0x38000000, 0x38000118, 0x38700000, + 0x38900000, 0x38900132, 0x39000000, 0x39000070, + 0x390000a5, 0x39500000, 0x3950009a, 0x39800000, + 0x3980007e, 0x39800107, 0x39d00000, 0x39d05000, + 0x39d050e9, 0x39d36000, 0x39d3609a, 0x3a100000, + 0x3b300000, 0x3b3000ea, 0x3bd00000, 0x3bd00001, + 0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a, + 0x3c000041, 0x3c00004e, 0x3c00005b, 0x3c000087, + // Entry 240 - 25F + 0x3c00008c, 0x3c0000b8, 0x3c0000c7, 0x3c0000d2, + 0x3c0000ef, 0x3c000119, 0x3c000127, 0x3c400000, + 0x3c40003f, 0x3c40006a, 0x3c4000e5, 0x3d400000, + 0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000, + 0x3dc000bd, 0x3dc00105, 0x3de00000, 0x3de00130, + 0x3e200000, 0x3e200047, 0x3e2000a6, 0x3e2000af, + 0x3e2000bd, 0x3e200107, 0x3e200131, 0x3e500000, + 0x3e500108, 0x3e600000, 0x3e600130, 0x3eb00000, + // Entry 260 - 27F + 0x3eb00107, 0x3ec00000, 0x3ec000a5, 0x3f300000, + 0x3f300130, 0x3fa00000, 0x3fa000e9, 0x3fc00000, + 0x3fd00000, 0x3fd00073, 0x3fd000db, 0x3fd0010d, + 0x3ff00000, 0x3ff000d2, 0x40100000, 0x401000c4, + 0x40200000, 0x4020004c, 0x40700000, 0x40800000, + 0x4085b000, 0x4085b0bb, 0x408eb000, 0x408eb0bb, + 0x40c00000, 0x40c000b4, 0x41200000, 0x41200112, + 0x41600000, 0x41600110, 0x41c00000, 0x41d00000, + // Entry 280 - 29F + 0x41e00000, 0x41f00000, 0x41f00073, 0x42200000, + 0x42300000, 0x42300165, 0x42900000, 0x42900063, + 0x42900070, 0x429000a5, 0x42900116, 0x43100000, + 0x43100027, 0x431000c3, 0x4310014e, 0x43200000, + 0x43220000, 0x43220033, 0x432200be, 0x43220106, + 0x4322014e, 0x4325b000, 0x4325b033, 0x4325b0be, + 0x4325b106, 0x4325b14e, 0x43700000, 0x43a00000, + 0x43b00000, 0x44400000, 0x44400031, 0x44400073, + // Entry 2A0 - 2BF + 0x4440010d, 0x44500000, 0x4450004b, 0x445000a5, + 0x44500130, 0x44500132, 0x44e00000, 0x45000000, + 0x4500009a, 0x450000b4, 0x450000d1, 0x4500010e, + 0x46100000, 0x4610009a, 0x46400000, 0x464000a5, + 0x46400132, 0x46700000, 0x46700125, 0x46b00000, + 0x46b00124, 0x46f00000, 0x46f0006e, 0x46f00070, + 0x47100000, 0x47600000, 0x47600128, 0x47a00000, + 0x48000000, 0x48200000, 0x4820012a, 0x48a00000, + // Entry 2C0 - 2DF + 0x48a0005e, 0x48a0012c, 0x48e00000, 0x49400000, + 0x49400107, 0x4a400000, 0x4a4000d5, 0x4a900000, + 0x4a9000bb, 0x4ac00000, 0x4ac00053, 0x4ae00000, + 0x4ae00131, 0x4b400000, 0x4b40009a, 0x4b4000e9, + 0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc20000, + 0x4bc20138, 0x4bc5b000, 0x4bc5b138, 0x4be00000, + 0x4be5b000, 0x4be5b0b5, 0x4bef4000, 0x4bef40b5, + 0x4c000000, 0x4c300000, 0x4c30013f, 0x4c900000, + // Entry 2E0 - 2FF + 0x4c900001, 0x4cc00000, 0x4cc00130, 0x4ce00000, + 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500115, + 0x4f200000, 0x4fb00000, 0x4fb00132, 0x50900000, + 0x50900052, 0x51200000, 0x51200001, 0x51800000, + 0x5180003b, 0x518000d7, 0x51f00000, 0x51f3b000, + 0x51f3b053, 0x51f3c000, 0x51f3c08e, 0x52800000, + 0x528000bb, 0x52900000, 0x5293b000, 0x5293b053, + 0x5293b08e, 0x5293b0c7, 0x5293b10e, 0x5293c000, + // Entry 300 - 31F + 0x5293c08e, 0x5293c0c7, 0x5293c12f, 0x52f00000, + 0x52f00162, +} // Size: 3116 bytes + +const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix" + +// Total table size 3147 bytes (3KiB); checksum: 5A8FFFA5 diff --git a/vendor/golang.org/x/text/internal/language/compact/tags.go b/vendor/golang.org/x/text/internal/language/compact/tags.go new file mode 100644 index 00000000..ca135d29 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/tags.go @@ -0,0 +1,91 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package compact + +var ( + und = Tag{} + + Und Tag = Tag{} + + Afrikaans Tag = Tag{language: afIndex, locale: afIndex} + Amharic Tag = Tag{language: amIndex, locale: amIndex} + Arabic Tag = Tag{language: arIndex, locale: arIndex} + ModernStandardArabic Tag = Tag{language: ar001Index, locale: ar001Index} + Azerbaijani Tag = Tag{language: azIndex, locale: azIndex} + Bulgarian Tag = Tag{language: bgIndex, locale: bgIndex} + Bengali Tag = Tag{language: bnIndex, locale: bnIndex} + Catalan Tag = Tag{language: caIndex, locale: caIndex} + Czech Tag = Tag{language: csIndex, locale: csIndex} + Danish Tag = Tag{language: daIndex, locale: daIndex} + German Tag = Tag{language: deIndex, locale: deIndex} + Greek Tag = Tag{language: elIndex, locale: elIndex} + English Tag = Tag{language: enIndex, locale: enIndex} + AmericanEnglish Tag = Tag{language: enUSIndex, locale: enUSIndex} + BritishEnglish Tag = Tag{language: enGBIndex, locale: enGBIndex} + Spanish Tag = Tag{language: esIndex, locale: esIndex} + EuropeanSpanish Tag = Tag{language: esESIndex, locale: esESIndex} + LatinAmericanSpanish Tag = Tag{language: es419Index, locale: es419Index} + Estonian Tag = Tag{language: etIndex, locale: etIndex} + Persian Tag = Tag{language: faIndex, locale: faIndex} + Finnish Tag = Tag{language: fiIndex, locale: fiIndex} + Filipino Tag = Tag{language: filIndex, locale: filIndex} + French Tag = Tag{language: frIndex, locale: frIndex} + CanadianFrench Tag = Tag{language: frCAIndex, locale: frCAIndex} + Gujarati Tag = Tag{language: guIndex, locale: guIndex} + Hebrew Tag = Tag{language: heIndex, locale: heIndex} + Hindi Tag = Tag{language: hiIndex, locale: hiIndex} + Croatian Tag = Tag{language: hrIndex, locale: hrIndex} + Hungarian Tag = Tag{language: huIndex, locale: huIndex} + Armenian Tag = Tag{language: hyIndex, locale: hyIndex} + Indonesian Tag = Tag{language: idIndex, locale: idIndex} + Icelandic Tag = Tag{language: isIndex, locale: isIndex} + Italian Tag = Tag{language: itIndex, locale: itIndex} + Japanese Tag = Tag{language: jaIndex, locale: jaIndex} + Georgian Tag = Tag{language: kaIndex, locale: kaIndex} + Kazakh Tag = Tag{language: kkIndex, locale: kkIndex} + Khmer Tag = Tag{language: kmIndex, locale: kmIndex} + Kannada Tag = Tag{language: knIndex, locale: knIndex} + Korean Tag = Tag{language: koIndex, locale: koIndex} + Kirghiz Tag = Tag{language: kyIndex, locale: kyIndex} + Lao Tag = Tag{language: loIndex, locale: loIndex} + Lithuanian Tag = Tag{language: ltIndex, locale: ltIndex} + Latvian Tag = Tag{language: lvIndex, locale: lvIndex} + Macedonian Tag = Tag{language: mkIndex, locale: mkIndex} + Malayalam Tag = Tag{language: mlIndex, locale: mlIndex} + Mongolian Tag = Tag{language: mnIndex, locale: mnIndex} + Marathi Tag = Tag{language: mrIndex, locale: mrIndex} + Malay Tag = Tag{language: msIndex, locale: msIndex} + Burmese Tag = Tag{language: myIndex, locale: myIndex} + Nepali Tag = Tag{language: neIndex, locale: neIndex} + Dutch Tag = Tag{language: nlIndex, locale: nlIndex} + Norwegian Tag = Tag{language: noIndex, locale: noIndex} + Punjabi Tag = Tag{language: paIndex, locale: paIndex} + Polish Tag = Tag{language: plIndex, locale: plIndex} + Portuguese Tag = Tag{language: ptIndex, locale: ptIndex} + BrazilianPortuguese Tag = Tag{language: ptBRIndex, locale: ptBRIndex} + EuropeanPortuguese Tag = Tag{language: ptPTIndex, locale: ptPTIndex} + Romanian Tag = Tag{language: roIndex, locale: roIndex} + Russian Tag = Tag{language: ruIndex, locale: ruIndex} + Sinhala Tag = Tag{language: siIndex, locale: siIndex} + Slovak Tag = Tag{language: skIndex, locale: skIndex} + Slovenian Tag = Tag{language: slIndex, locale: slIndex} + Albanian Tag = Tag{language: sqIndex, locale: sqIndex} + Serbian Tag = Tag{language: srIndex, locale: srIndex} + SerbianLatin Tag = Tag{language: srLatnIndex, locale: srLatnIndex} + Swedish Tag = Tag{language: svIndex, locale: svIndex} + Swahili Tag = Tag{language: swIndex, locale: swIndex} + Tamil Tag = Tag{language: taIndex, locale: taIndex} + Telugu Tag = Tag{language: teIndex, locale: teIndex} + Thai Tag = Tag{language: thIndex, locale: thIndex} + Turkish Tag = Tag{language: trIndex, locale: trIndex} + Ukrainian Tag = Tag{language: ukIndex, locale: ukIndex} + Urdu Tag = Tag{language: urIndex, locale: urIndex} + Uzbek Tag = Tag{language: uzIndex, locale: uzIndex} + Vietnamese Tag = Tag{language: viIndex, locale: viIndex} + Chinese Tag = Tag{language: zhIndex, locale: zhIndex} + SimplifiedChinese Tag = Tag{language: zhHansIndex, locale: zhHansIndex} + TraditionalChinese Tag = Tag{language: zhHantIndex, locale: zhHantIndex} + Zulu Tag = Tag{language: zuIndex, locale: zuIndex} +) diff --git a/vendor/golang.org/x/text/internal/language/compose.go b/vendor/golang.org/x/text/internal/language/compose.go new file mode 100644 index 00000000..4ae78e0f --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compose.go @@ -0,0 +1,167 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "sort" + "strings" +) + +// A Builder allows constructing a Tag from individual components. +// Its main user is Compose in the top-level language package. +type Builder struct { + Tag Tag + + private string // the x extension + variants []string + extensions []string +} + +// Make returns a new Tag from the current settings. +func (b *Builder) Make() Tag { + t := b.Tag + + if len(b.extensions) > 0 || len(b.variants) > 0 { + sort.Sort(sortVariants(b.variants)) + sort.Strings(b.extensions) + + if b.private != "" { + b.extensions = append(b.extensions, b.private) + } + n := maxCoreSize + tokenLen(b.variants...) + tokenLen(b.extensions...) + buf := make([]byte, n) + p := t.genCoreBytes(buf) + t.pVariant = byte(p) + p += appendTokens(buf[p:], b.variants...) + t.pExt = uint16(p) + p += appendTokens(buf[p:], b.extensions...) + t.str = string(buf[:p]) + // We may not always need to remake the string, but when or when not + // to do so is rather tricky. + scan := makeScanner(buf[:p]) + t, _ = parse(&scan, "") + return t + + } else if b.private != "" { + t.str = b.private + t.RemakeString() + } + return t +} + +// SetTag copies all the settings from a given Tag. Any previously set values +// are discarded. +func (b *Builder) SetTag(t Tag) { + b.Tag.LangID = t.LangID + b.Tag.RegionID = t.RegionID + b.Tag.ScriptID = t.ScriptID + // TODO: optimize + b.variants = b.variants[:0] + if variants := t.Variants(); variants != "" { + for _, vr := range strings.Split(variants[1:], "-") { + b.variants = append(b.variants, vr) + } + } + b.extensions, b.private = b.extensions[:0], "" + for _, e := range t.Extensions() { + b.AddExt(e) + } +} + +// AddExt adds extension e to the tag. e must be a valid extension as returned +// by Tag.Extension. If the extension already exists, it will be discarded, +// except for a -u extension, where non-existing key-type pairs will added. +func (b *Builder) AddExt(e string) { + if e[0] == 'x' { + if b.private == "" { + b.private = e + } + return + } + for i, s := range b.extensions { + if s[0] == e[0] { + if e[0] == 'u' { + b.extensions[i] += e[1:] + } + return + } + } + b.extensions = append(b.extensions, e) +} + +// SetExt sets the extension e to the tag. e must be a valid extension as +// returned by Tag.Extension. If the extension already exists, it will be +// overwritten, except for a -u extension, where the individual key-type pairs +// will be set. +func (b *Builder) SetExt(e string) { + if e[0] == 'x' { + b.private = e + return + } + for i, s := range b.extensions { + if s[0] == e[0] { + if e[0] == 'u' { + b.extensions[i] = e + s[1:] + } else { + b.extensions[i] = e + } + return + } + } + b.extensions = append(b.extensions, e) +} + +// AddVariant adds any number of variants. +func (b *Builder) AddVariant(v ...string) { + for _, v := range v { + if v != "" { + b.variants = append(b.variants, v) + } + } +} + +// ClearVariants removes any variants previously added, including those +// copied from a Tag in SetTag. +func (b *Builder) ClearVariants() { + b.variants = b.variants[:0] +} + +// ClearExtensions removes any extensions previously added, including those +// copied from a Tag in SetTag. +func (b *Builder) ClearExtensions() { + b.private = "" + b.extensions = b.extensions[:0] +} + +func tokenLen(token ...string) (n int) { + for _, t := range token { + n += len(t) + 1 + } + return +} + +func appendTokens(b []byte, token ...string) int { + p := 0 + for _, t := range token { + b[p] = '-' + copy(b[p+1:], t) + p += 1 + len(t) + } + return p +} + +type sortVariants []string + +func (s sortVariants) Len() int { + return len(s) +} + +func (s sortVariants) Swap(i, j int) { + s[j], s[i] = s[i], s[j] +} + +func (s sortVariants) Less(i, j int) bool { + return variantIndex[s[i]] < variantIndex[s[j]] +} diff --git a/vendor/golang.org/x/text/internal/language/coverage.go b/vendor/golang.org/x/text/internal/language/coverage.go new file mode 100644 index 00000000..9b20b88f --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/coverage.go @@ -0,0 +1,28 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +// BaseLanguages returns the list of all supported base languages. It generates +// the list by traversing the internal structures. +func BaseLanguages() []Language { + base := make([]Language, 0, NumLanguages) + for i := 0; i < langNoIndexOffset; i++ { + // We included "und" already for the value 0. + if i != nonCanonicalUnd { + base = append(base, Language(i)) + } + } + i := langNoIndexOffset + for _, v := range langNoIndex { + for k := 0; k < 8; k++ { + if v&1 == 1 { + base = append(base, Language(i)) + } + v >>= 1 + i++ + } + } + return base +} diff --git a/vendor/golang.org/x/text/internal/language/language.go b/vendor/golang.org/x/text/internal/language/language.go new file mode 100644 index 00000000..09d41c73 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/language.go @@ -0,0 +1,627 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go gen_common.go -output tables.go + +package language // import "golang.org/x/text/internal/language" + +// TODO: Remove above NOTE after: +// - verifying that tables are dropped correctly (most notably matcher tables). + +import ( + "errors" + "fmt" + "strings" +) + +const ( + // maxCoreSize is the maximum size of a BCP 47 tag without variants and + // extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes. + maxCoreSize = 12 + + // max99thPercentileSize is a somewhat arbitrary buffer size that presumably + // is large enough to hold at least 99% of the BCP 47 tags. + max99thPercentileSize = 32 + + // maxSimpleUExtensionSize is the maximum size of a -u extension with one + // key-type pair. Equals len("-u-") + key (2) + dash + max value (8). + maxSimpleUExtensionSize = 14 +) + +// Tag represents a BCP 47 language tag. It is used to specify an instance of a +// specific language or locale. All language tag values are guaranteed to be +// well-formed. The zero value of Tag is Und. +type Tag struct { + // TODO: the following fields have the form TagTypeID. This name is chosen + // to allow refactoring the public package without conflicting with its + // Base, Script, and Region methods. Once the transition is fully completed + // the ID can be stripped from the name. + + LangID Language + RegionID Region + // TODO: we will soon run out of positions for ScriptID. Idea: instead of + // storing lang, region, and ScriptID codes, store only the compact index and + // have a lookup table from this code to its expansion. This greatly speeds + // up table lookup, speed up common variant cases. + // This will also immediately free up 3 extra bytes. Also, the pVariant + // field can now be moved to the lookup table, as the compact index uniquely + // determines the offset of a possible variant. + ScriptID Script + pVariant byte // offset in str, includes preceding '-' + pExt uint16 // offset of first extension, includes preceding '-' + + // str is the string representation of the Tag. It will only be used if the + // tag has variants or extensions. + str string +} + +// Make is a convenience wrapper for Parse that omits the error. +// In case of an error, a sensible default is returned. +func Make(s string) Tag { + t, _ := Parse(s) + return t +} + +// Raw returns the raw base language, script and region, without making an +// attempt to infer their values. +// TODO: consider removing +func (t Tag) Raw() (b Language, s Script, r Region) { + return t.LangID, t.ScriptID, t.RegionID +} + +// equalTags compares language, script and region subtags only. +func (t Tag) equalTags(a Tag) bool { + return t.LangID == a.LangID && t.ScriptID == a.ScriptID && t.RegionID == a.RegionID +} + +// IsRoot returns true if t is equal to language "und". +func (t Tag) IsRoot() bool { + if int(t.pVariant) < len(t.str) { + return false + } + return t.equalTags(Und) +} + +// IsPrivateUse reports whether the Tag consists solely of an IsPrivateUse use +// tag. +func (t Tag) IsPrivateUse() bool { + return t.str != "" && t.pVariant == 0 +} + +// RemakeString is used to update t.str in case lang, script or region changed. +// It is assumed that pExt and pVariant still point to the start of the +// respective parts. +func (t *Tag) RemakeString() { + if t.str == "" { + return + } + extra := t.str[t.pVariant:] + if t.pVariant > 0 { + extra = extra[1:] + } + if t.equalTags(Und) && strings.HasPrefix(extra, "x-") { + t.str = extra + t.pVariant = 0 + t.pExt = 0 + return + } + var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases. + b := buf[:t.genCoreBytes(buf[:])] + if extra != "" { + diff := len(b) - int(t.pVariant) + b = append(b, '-') + b = append(b, extra...) + t.pVariant = uint8(int(t.pVariant) + diff) + t.pExt = uint16(int(t.pExt) + diff) + } else { + t.pVariant = uint8(len(b)) + t.pExt = uint16(len(b)) + } + t.str = string(b) +} + +// genCoreBytes writes a string for the base languages, script and region tags +// to the given buffer and returns the number of bytes written. It will never +// write more than maxCoreSize bytes. +func (t *Tag) genCoreBytes(buf []byte) int { + n := t.LangID.StringToBuf(buf[:]) + if t.ScriptID != 0 { + n += copy(buf[n:], "-") + n += copy(buf[n:], t.ScriptID.String()) + } + if t.RegionID != 0 { + n += copy(buf[n:], "-") + n += copy(buf[n:], t.RegionID.String()) + } + return n +} + +// String returns the canonical string representation of the language tag. +func (t Tag) String() string { + if t.str != "" { + return t.str + } + if t.ScriptID == 0 && t.RegionID == 0 { + return t.LangID.String() + } + buf := [maxCoreSize]byte{} + return string(buf[:t.genCoreBytes(buf[:])]) +} + +// MarshalText implements encoding.TextMarshaler. +func (t Tag) MarshalText() (text []byte, err error) { + if t.str != "" { + text = append(text, t.str...) + } else if t.ScriptID == 0 && t.RegionID == 0 { + text = append(text, t.LangID.String()...) + } else { + buf := [maxCoreSize]byte{} + text = buf[:t.genCoreBytes(buf[:])] + } + return text, nil +} + +// UnmarshalText implements encoding.TextUnmarshaler. +func (t *Tag) UnmarshalText(text []byte) error { + tag, err := Parse(string(text)) + *t = tag + return err +} + +// Variants returns the part of the tag holding all variants or the empty string +// if there are no variants defined. +func (t Tag) Variants() string { + if t.pVariant == 0 { + return "" + } + return t.str[t.pVariant:t.pExt] +} + +// VariantOrPrivateUseTags returns variants or private use tags. +func (t Tag) VariantOrPrivateUseTags() string { + if t.pExt > 0 { + return t.str[t.pVariant:t.pExt] + } + return t.str[t.pVariant:] +} + +// HasString reports whether this tag defines more than just the raw +// components. +func (t Tag) HasString() bool { + return t.str != "" +} + +// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a +// specific language are substituted with fields from the parent language. +// The parent for a language may change for newer versions of CLDR. +func (t Tag) Parent() Tag { + if t.str != "" { + // Strip the variants and extensions. + b, s, r := t.Raw() + t = Tag{LangID: b, ScriptID: s, RegionID: r} + if t.RegionID == 0 && t.ScriptID != 0 && t.LangID != 0 { + base, _ := addTags(Tag{LangID: t.LangID}) + if base.ScriptID == t.ScriptID { + return Tag{LangID: t.LangID} + } + } + return t + } + if t.LangID != 0 { + if t.RegionID != 0 { + maxScript := t.ScriptID + if maxScript == 0 { + max, _ := addTags(t) + maxScript = max.ScriptID + } + + for i := range parents { + if Language(parents[i].lang) == t.LangID && Script(parents[i].maxScript) == maxScript { + for _, r := range parents[i].fromRegion { + if Region(r) == t.RegionID { + return Tag{ + LangID: t.LangID, + ScriptID: Script(parents[i].script), + RegionID: Region(parents[i].toRegion), + } + } + } + } + } + + // Strip the script if it is the default one. + base, _ := addTags(Tag{LangID: t.LangID}) + if base.ScriptID != maxScript { + return Tag{LangID: t.LangID, ScriptID: maxScript} + } + return Tag{LangID: t.LangID} + } else if t.ScriptID != 0 { + // The parent for an base-script pair with a non-default script is + // "und" instead of the base language. + base, _ := addTags(Tag{LangID: t.LangID}) + if base.ScriptID != t.ScriptID { + return Und + } + return Tag{LangID: t.LangID} + } + } + return Und +} + +// ParseExtension parses s as an extension and returns it on success. +func ParseExtension(s string) (ext string, err error) { + defer func() { + if recover() != nil { + ext = "" + err = ErrSyntax + } + }() + + scan := makeScannerString(s) + var end int + if n := len(scan.token); n != 1 { + return "", ErrSyntax + } + scan.toLower(0, len(scan.b)) + end = parseExtension(&scan) + if end != len(s) { + return "", ErrSyntax + } + return string(scan.b), nil +} + +// HasVariants reports whether t has variants. +func (t Tag) HasVariants() bool { + return uint16(t.pVariant) < t.pExt +} + +// HasExtensions reports whether t has extensions. +func (t Tag) HasExtensions() bool { + return int(t.pExt) < len(t.str) +} + +// Extension returns the extension of type x for tag t. It will return +// false for ok if t does not have the requested extension. The returned +// extension will be invalid in this case. +func (t Tag) Extension(x byte) (ext string, ok bool) { + for i := int(t.pExt); i < len(t.str)-1; { + var ext string + i, ext = getExtension(t.str, i) + if ext[0] == x { + return ext, true + } + } + return "", false +} + +// Extensions returns all extensions of t. +func (t Tag) Extensions() []string { + e := []string{} + for i := int(t.pExt); i < len(t.str)-1; { + var ext string + i, ext = getExtension(t.str, i) + e = append(e, ext) + } + return e +} + +// TypeForKey returns the type associated with the given key, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// TypeForKey will traverse the inheritance chain to get the correct value. +// +// If there are multiple types associated with a key, only the first will be +// returned. If there is no type associated with a key, it returns the empty +// string. +func (t Tag) TypeForKey(key string) string { + if _, start, end, _ := t.findTypeForKey(key); end != start { + s := t.str[start:end] + if p := strings.IndexByte(s, '-'); p >= 0 { + s = s[:p] + } + return s + } + return "" +} + +var ( + errPrivateUse = errors.New("cannot set a key on a private use tag") + errInvalidArguments = errors.New("invalid key or type") +) + +// SetTypeForKey returns a new Tag with the key set to type, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// An empty value removes an existing pair with the same key. +func (t Tag) SetTypeForKey(key, value string) (Tag, error) { + if t.IsPrivateUse() { + return t, errPrivateUse + } + if len(key) != 2 { + return t, errInvalidArguments + } + + // Remove the setting if value is "". + if value == "" { + start, sep, end, _ := t.findTypeForKey(key) + if start != sep { + // Remove a possible empty extension. + switch { + case t.str[start-2] != '-': // has previous elements. + case end == len(t.str), // end of string + end+2 < len(t.str) && t.str[end+2] == '-': // end of extension + start -= 2 + } + if start == int(t.pVariant) && end == len(t.str) { + t.str = "" + t.pVariant, t.pExt = 0, 0 + } else { + t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:]) + } + } + return t, nil + } + + if len(value) < 3 || len(value) > 8 { + return t, errInvalidArguments + } + + var ( + buf [maxCoreSize + maxSimpleUExtensionSize]byte + uStart int // start of the -u extension. + ) + + // Generate the tag string if needed. + if t.str == "" { + uStart = t.genCoreBytes(buf[:]) + buf[uStart] = '-' + uStart++ + } + + // Create new key-type pair and parse it to verify. + b := buf[uStart:] + copy(b, "u-") + copy(b[2:], key) + b[4] = '-' + b = b[:5+copy(b[5:], value)] + scan := makeScanner(b) + if parseExtensions(&scan); scan.err != nil { + return t, scan.err + } + + // Assemble the replacement string. + if t.str == "" { + t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1) + t.str = string(buf[:uStart+len(b)]) + } else { + s := t.str + start, sep, end, hasExt := t.findTypeForKey(key) + if start == sep { + if hasExt { + b = b[2:] + } + t.str = fmt.Sprintf("%s-%s%s", s[:sep], b, s[end:]) + } else { + t.str = fmt.Sprintf("%s-%s%s", s[:start+3], value, s[end:]) + } + } + return t, nil +} + +// findTypeForKey returns the start and end position for the type corresponding +// to key or the point at which to insert the key-value pair if the type +// wasn't found. The hasExt return value reports whether an -u extension was present. +// Note: the extensions are typically very small and are likely to contain +// only one key-type pair. +func (t Tag) findTypeForKey(key string) (start, sep, end int, hasExt bool) { + p := int(t.pExt) + if len(key) != 2 || p == len(t.str) || p == 0 { + return p, p, p, false + } + s := t.str + + // Find the correct extension. + for p++; s[p] != 'u'; p++ { + if s[p] > 'u' { + p-- + return p, p, p, false + } + if p = nextExtension(s, p); p == len(s) { + return len(s), len(s), len(s), false + } + } + // Proceed to the hyphen following the extension name. + p++ + + // curKey is the key currently being processed. + curKey := "" + + // Iterate over keys until we get the end of a section. + for { + end = p + for p++; p < len(s) && s[p] != '-'; p++ { + } + n := p - end - 1 + if n <= 2 && curKey == key { + if sep < end { + sep++ + } + return start, sep, end, true + } + switch n { + case 0, // invalid string + 1: // next extension + return end, end, end, true + case 2: + // next key + curKey = s[end+1 : p] + if curKey > key { + return end, end, end, true + } + start = end + sep = p + } + } +} + +// ParseBase parses a 2- or 3-letter ISO 639 code. +// It returns a ValueError if s is a well-formed but unknown language identifier +// or another error if another error occurred. +func ParseBase(s string) (l Language, err error) { + defer func() { + if recover() != nil { + l = 0 + err = ErrSyntax + } + }() + + if n := len(s); n < 2 || 3 < n { + return 0, ErrSyntax + } + var buf [3]byte + return getLangID(buf[:copy(buf[:], s)]) +} + +// ParseScript parses a 4-letter ISO 15924 code. +// It returns a ValueError if s is a well-formed but unknown script identifier +// or another error if another error occurred. +func ParseScript(s string) (scr Script, err error) { + defer func() { + if recover() != nil { + scr = 0 + err = ErrSyntax + } + }() + + if len(s) != 4 { + return 0, ErrSyntax + } + var buf [4]byte + return getScriptID(script, buf[:copy(buf[:], s)]) +} + +// EncodeM49 returns the Region for the given UN M.49 code. +// It returns an error if r is not a valid code. +func EncodeM49(r int) (Region, error) { + return getRegionM49(r) +} + +// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code. +// It returns a ValueError if s is a well-formed but unknown region identifier +// or another error if another error occurred. +func ParseRegion(s string) (r Region, err error) { + defer func() { + if recover() != nil { + r = 0 + err = ErrSyntax + } + }() + + if n := len(s); n < 2 || 3 < n { + return 0, ErrSyntax + } + var buf [3]byte + return getRegionID(buf[:copy(buf[:], s)]) +} + +// IsCountry returns whether this region is a country or autonomous area. This +// includes non-standard definitions from CLDR. +func (r Region) IsCountry() bool { + if r == 0 || r.IsGroup() || r.IsPrivateUse() && r != _XK { + return false + } + return true +} + +// IsGroup returns whether this region defines a collection of regions. This +// includes non-standard definitions from CLDR. +func (r Region) IsGroup() bool { + if r == 0 { + return false + } + return int(regionInclusion[r]) < len(regionContainment) +} + +// Contains returns whether Region c is contained by Region r. It returns true +// if c == r. +func (r Region) Contains(c Region) bool { + if r == c { + return true + } + g := regionInclusion[r] + if g >= nRegionGroups { + return false + } + m := regionContainment[g] + + d := regionInclusion[c] + b := regionInclusionBits[d] + + // A contained country may belong to multiple disjoint groups. Matching any + // of these indicates containment. If the contained region is a group, it + // must strictly be a subset. + if d >= nRegionGroups { + return b&m != 0 + } + return b&^m == 0 +} + +var errNoTLD = errors.New("language: region is not a valid ccTLD") + +// TLD returns the country code top-level domain (ccTLD). UK is returned for GB. +// In all other cases it returns either the region itself or an error. +// +// This method may return an error for a region for which there exists a +// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The +// region will already be canonicalized it was obtained from a Tag that was +// obtained using any of the default methods. +func (r Region) TLD() (Region, error) { + // See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the + // difference between ISO 3166-1 and IANA ccTLD. + if r == _GB { + r = _UK + } + if (r.typ() & ccTLD) == 0 { + return 0, errNoTLD + } + return r, nil +} + +// Canonicalize returns the region or a possible replacement if the region is +// deprecated. It will not return a replacement for deprecated regions that +// are split into multiple regions. +func (r Region) Canonicalize() Region { + if cr := normRegion(r); cr != 0 { + return cr + } + return r +} + +// Variant represents a registered variant of a language as defined by BCP 47. +type Variant struct { + ID uint8 + str string +} + +// ParseVariant parses and returns a Variant. An error is returned if s is not +// a valid variant. +func ParseVariant(s string) (v Variant, err error) { + defer func() { + if recover() != nil { + v = Variant{} + err = ErrSyntax + } + }() + + s = strings.ToLower(s) + if id, ok := variantIndex[s]; ok { + return Variant{id, s}, nil + } + return Variant{}, NewValueError([]byte(s)) +} + +// String returns the string representation of the variant. +func (v Variant) String() string { + return v.str +} diff --git a/vendor/golang.org/x/text/internal/language/lookup.go b/vendor/golang.org/x/text/internal/language/lookup.go new file mode 100644 index 00000000..231b4fbd --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/lookup.go @@ -0,0 +1,412 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "bytes" + "fmt" + "sort" + "strconv" + + "golang.org/x/text/internal/tag" +) + +// findIndex tries to find the given tag in idx and returns a standardized error +// if it could not be found. +func findIndex(idx tag.Index, key []byte, form string) (index int, err error) { + if !tag.FixCase(form, key) { + return 0, ErrSyntax + } + i := idx.Index(key) + if i == -1 { + return 0, NewValueError(key) + } + return i, nil +} + +func searchUint(imap []uint16, key uint16) int { + return sort.Search(len(imap), func(i int) bool { + return imap[i] >= key + }) +} + +type Language uint16 + +// getLangID returns the langID of s if s is a canonical subtag +// or langUnknown if s is not a canonical subtag. +func getLangID(s []byte) (Language, error) { + if len(s) == 2 { + return getLangISO2(s) + } + return getLangISO3(s) +} + +// TODO language normalization as well as the AliasMaps could be moved to the +// higher level package, but it is a bit tricky to separate the generation. + +func (id Language) Canonicalize() (Language, AliasType) { + return normLang(id) +} + +// normLang returns the mapped langID of id according to mapping m. +func normLang(id Language) (Language, AliasType) { + k := sort.Search(len(AliasMap), func(i int) bool { + return AliasMap[i].From >= uint16(id) + }) + if k < len(AliasMap) && AliasMap[k].From == uint16(id) { + return Language(AliasMap[k].To), AliasTypes[k] + } + return id, AliasTypeUnknown +} + +// getLangISO2 returns the langID for the given 2-letter ISO language code +// or unknownLang if this does not exist. +func getLangISO2(s []byte) (Language, error) { + if !tag.FixCase("zz", s) { + return 0, ErrSyntax + } + if i := lang.Index(s); i != -1 && lang.Elem(i)[3] != 0 { + return Language(i), nil + } + return 0, NewValueError(s) +} + +const base = 'z' - 'a' + 1 + +func strToInt(s []byte) uint { + v := uint(0) + for i := 0; i < len(s); i++ { + v *= base + v += uint(s[i] - 'a') + } + return v +} + +// converts the given integer to the original ASCII string passed to strToInt. +// len(s) must match the number of characters obtained. +func intToStr(v uint, s []byte) { + for i := len(s) - 1; i >= 0; i-- { + s[i] = byte(v%base) + 'a' + v /= base + } +} + +// getLangISO3 returns the langID for the given 3-letter ISO language code +// or unknownLang if this does not exist. +func getLangISO3(s []byte) (Language, error) { + if tag.FixCase("und", s) { + // first try to match canonical 3-letter entries + for i := lang.Index(s[:2]); i != -1; i = lang.Next(s[:2], i) { + if e := lang.Elem(i); e[3] == 0 && e[2] == s[2] { + // We treat "und" as special and always translate it to "unspecified". + // Note that ZZ and Zzzz are private use and are not treated as + // unspecified by default. + id := Language(i) + if id == nonCanonicalUnd { + return 0, nil + } + return id, nil + } + } + if i := altLangISO3.Index(s); i != -1 { + return Language(altLangIndex[altLangISO3.Elem(i)[3]]), nil + } + n := strToInt(s) + if langNoIndex[n/8]&(1<<(n%8)) != 0 { + return Language(n) + langNoIndexOffset, nil + } + // Check for non-canonical uses of ISO3. + for i := lang.Index(s[:1]); i != -1; i = lang.Next(s[:1], i) { + if e := lang.Elem(i); e[2] == s[1] && e[3] == s[2] { + return Language(i), nil + } + } + return 0, NewValueError(s) + } + return 0, ErrSyntax +} + +// StringToBuf writes the string to b and returns the number of bytes +// written. cap(b) must be >= 3. +func (id Language) StringToBuf(b []byte) int { + if id >= langNoIndexOffset { + intToStr(uint(id)-langNoIndexOffset, b[:3]) + return 3 + } else if id == 0 { + return copy(b, "und") + } + l := lang[id<<2:] + if l[3] == 0 { + return copy(b, l[:3]) + } + return copy(b, l[:2]) +} + +// String returns the BCP 47 representation of the langID. +// Use b as variable name, instead of id, to ensure the variable +// used is consistent with that of Base in which this type is embedded. +func (b Language) String() string { + if b == 0 { + return "und" + } else if b >= langNoIndexOffset { + b -= langNoIndexOffset + buf := [3]byte{} + intToStr(uint(b), buf[:]) + return string(buf[:]) + } + l := lang.Elem(int(b)) + if l[3] == 0 { + return l[:3] + } + return l[:2] +} + +// ISO3 returns the ISO 639-3 language code. +func (b Language) ISO3() string { + if b == 0 || b >= langNoIndexOffset { + return b.String() + } + l := lang.Elem(int(b)) + if l[3] == 0 { + return l[:3] + } else if l[2] == 0 { + return altLangISO3.Elem(int(l[3]))[:3] + } + // This allocation will only happen for 3-letter ISO codes + // that are non-canonical BCP 47 language identifiers. + return l[0:1] + l[2:4] +} + +// IsPrivateUse reports whether this language code is reserved for private use. +func (b Language) IsPrivateUse() bool { + return langPrivateStart <= b && b <= langPrivateEnd +} + +// SuppressScript returns the script marked as SuppressScript in the IANA +// language tag repository, or 0 if there is no such script. +func (b Language) SuppressScript() Script { + if b < langNoIndexOffset { + return Script(suppressScript[b]) + } + return 0 +} + +type Region uint16 + +// getRegionID returns the region id for s if s is a valid 2-letter region code +// or unknownRegion. +func getRegionID(s []byte) (Region, error) { + if len(s) == 3 { + if isAlpha(s[0]) { + return getRegionISO3(s) + } + if i, err := strconv.ParseUint(string(s), 10, 10); err == nil { + return getRegionM49(int(i)) + } + } + return getRegionISO2(s) +} + +// getRegionISO2 returns the regionID for the given 2-letter ISO country code +// or unknownRegion if this does not exist. +func getRegionISO2(s []byte) (Region, error) { + i, err := findIndex(regionISO, s, "ZZ") + if err != nil { + return 0, err + } + return Region(i) + isoRegionOffset, nil +} + +// getRegionISO3 returns the regionID for the given 3-letter ISO country code +// or unknownRegion if this does not exist. +func getRegionISO3(s []byte) (Region, error) { + if tag.FixCase("ZZZ", s) { + for i := regionISO.Index(s[:1]); i != -1; i = regionISO.Next(s[:1], i) { + if e := regionISO.Elem(i); e[2] == s[1] && e[3] == s[2] { + return Region(i) + isoRegionOffset, nil + } + } + for i := 0; i < len(altRegionISO3); i += 3 { + if tag.Compare(altRegionISO3[i:i+3], s) == 0 { + return Region(altRegionIDs[i/3]), nil + } + } + return 0, NewValueError(s) + } + return 0, ErrSyntax +} + +func getRegionM49(n int) (Region, error) { + if 0 < n && n <= 999 { + const ( + searchBits = 7 + regionBits = 9 + regionMask = 1<<regionBits - 1 + ) + idx := n >> searchBits + buf := fromM49[m49Index[idx]:m49Index[idx+1]] + val := uint16(n) << regionBits // we rely on bits shifting out + i := sort.Search(len(buf), func(i int) bool { + return buf[i] >= val + }) + if r := fromM49[int(m49Index[idx])+i]; r&^regionMask == val { + return Region(r & regionMask), nil + } + } + var e ValueError + fmt.Fprint(bytes.NewBuffer([]byte(e.v[:])), n) + return 0, e +} + +// normRegion returns a region if r is deprecated or 0 otherwise. +// TODO: consider supporting BYS (-> BLR), CSK (-> 200 or CZ), PHI (-> PHL) and AFI (-> DJ). +// TODO: consider mapping split up regions to new most populous one (like CLDR). +func normRegion(r Region) Region { + m := regionOldMap + k := sort.Search(len(m), func(i int) bool { + return m[i].From >= uint16(r) + }) + if k < len(m) && m[k].From == uint16(r) { + return Region(m[k].To) + } + return 0 +} + +const ( + iso3166UserAssigned = 1 << iota + ccTLD + bcp47Region +) + +func (r Region) typ() byte { + return regionTypes[r] +} + +// String returns the BCP 47 representation for the region. +// It returns "ZZ" for an unspecified region. +func (r Region) String() string { + if r < isoRegionOffset { + if r == 0 { + return "ZZ" + } + return fmt.Sprintf("%03d", r.M49()) + } + r -= isoRegionOffset + return regionISO.Elem(int(r))[:2] +} + +// ISO3 returns the 3-letter ISO code of r. +// Note that not all regions have a 3-letter ISO code. +// In such cases this method returns "ZZZ". +func (r Region) ISO3() string { + if r < isoRegionOffset { + return "ZZZ" + } + r -= isoRegionOffset + reg := regionISO.Elem(int(r)) + switch reg[2] { + case 0: + return altRegionISO3[reg[3]:][:3] + case ' ': + return "ZZZ" + } + return reg[0:1] + reg[2:4] +} + +// M49 returns the UN M.49 encoding of r, or 0 if this encoding +// is not defined for r. +func (r Region) M49() int { + return int(m49[r]) +} + +// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This +// may include private-use tags that are assigned by CLDR and used in this +// implementation. So IsPrivateUse and IsCountry can be simultaneously true. +func (r Region) IsPrivateUse() bool { + return r.typ()&iso3166UserAssigned != 0 +} + +type Script uint16 + +// getScriptID returns the script id for string s. It assumes that s +// is of the format [A-Z][a-z]{3}. +func getScriptID(idx tag.Index, s []byte) (Script, error) { + i, err := findIndex(idx, s, "Zzzz") + return Script(i), err +} + +// String returns the script code in title case. +// It returns "Zzzz" for an unspecified script. +func (s Script) String() string { + if s == 0 { + return "Zzzz" + } + return script.Elem(int(s)) +} + +// IsPrivateUse reports whether this script code is reserved for private use. +func (s Script) IsPrivateUse() bool { + return _Qaaa <= s && s <= _Qabx +} + +const ( + maxAltTaglen = len("en-US-POSIX") + maxLen = maxAltTaglen +) + +var ( + // grandfatheredMap holds a mapping from legacy and grandfathered tags to + // their base language or index to more elaborate tag. + grandfatheredMap = map[[maxLen]byte]int16{ + [maxLen]byte{'a', 'r', 't', '-', 'l', 'o', 'j', 'b', 'a', 'n'}: _jbo, // art-lojban + [maxLen]byte{'i', '-', 'a', 'm', 'i'}: _ami, // i-ami + [maxLen]byte{'i', '-', 'b', 'n', 'n'}: _bnn, // i-bnn + [maxLen]byte{'i', '-', 'h', 'a', 'k'}: _hak, // i-hak + [maxLen]byte{'i', '-', 'k', 'l', 'i', 'n', 'g', 'o', 'n'}: _tlh, // i-klingon + [maxLen]byte{'i', '-', 'l', 'u', 'x'}: _lb, // i-lux + [maxLen]byte{'i', '-', 'n', 'a', 'v', 'a', 'j', 'o'}: _nv, // i-navajo + [maxLen]byte{'i', '-', 'p', 'w', 'n'}: _pwn, // i-pwn + [maxLen]byte{'i', '-', 't', 'a', 'o'}: _tao, // i-tao + [maxLen]byte{'i', '-', 't', 'a', 'y'}: _tay, // i-tay + [maxLen]byte{'i', '-', 't', 's', 'u'}: _tsu, // i-tsu + [maxLen]byte{'n', 'o', '-', 'b', 'o', 'k'}: _nb, // no-bok + [maxLen]byte{'n', 'o', '-', 'n', 'y', 'n'}: _nn, // no-nyn + [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'f', 'r'}: _sfb, // sgn-BE-FR + [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'n', 'l'}: _vgt, // sgn-BE-NL + [maxLen]byte{'s', 'g', 'n', '-', 'c', 'h', '-', 'd', 'e'}: _sgg, // sgn-CH-DE + [maxLen]byte{'z', 'h', '-', 'g', 'u', 'o', 'y', 'u'}: _cmn, // zh-guoyu + [maxLen]byte{'z', 'h', '-', 'h', 'a', 'k', 'k', 'a'}: _hak, // zh-hakka + [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n', '-', 'n', 'a', 'n'}: _nan, // zh-min-nan + [maxLen]byte{'z', 'h', '-', 'x', 'i', 'a', 'n', 'g'}: _hsn, // zh-xiang + + // Grandfathered tags with no modern replacement will be converted as + // follows: + [maxLen]byte{'c', 'e', 'l', '-', 'g', 'a', 'u', 'l', 'i', 's', 'h'}: -1, // cel-gaulish + [maxLen]byte{'e', 'n', '-', 'g', 'b', '-', 'o', 'e', 'd'}: -2, // en-GB-oed + [maxLen]byte{'i', '-', 'd', 'e', 'f', 'a', 'u', 'l', 't'}: -3, // i-default + [maxLen]byte{'i', '-', 'e', 'n', 'o', 'c', 'h', 'i', 'a', 'n'}: -4, // i-enochian + [maxLen]byte{'i', '-', 'm', 'i', 'n', 'g', 'o'}: -5, // i-mingo + [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n'}: -6, // zh-min + + // CLDR-specific tag. + [maxLen]byte{'r', 'o', 'o', 't'}: 0, // root + [maxLen]byte{'e', 'n', '-', 'u', 's', '-', 'p', 'o', 's', 'i', 'x'}: -7, // en_US_POSIX" + } + + altTagIndex = [...]uint8{0, 17, 31, 45, 61, 74, 86, 102} + + altTags = "xtg-x-cel-gaulishen-GB-oxendicten-x-i-defaultund-x-i-enochiansee-x-i-mingonan-x-zh-minen-US-u-va-posix" +) + +func grandfathered(s [maxAltTaglen]byte) (t Tag, ok bool) { + if v, ok := grandfatheredMap[s]; ok { + if v < 0 { + return Make(altTags[altTagIndex[-v-1]:altTagIndex[-v]]), true + } + t.LangID = Language(v) + return t, true + } + return t, false +} diff --git a/vendor/golang.org/x/text/internal/language/match.go b/vendor/golang.org/x/text/internal/language/match.go new file mode 100644 index 00000000..75a2dbca --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/match.go @@ -0,0 +1,226 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import "errors" + +type scriptRegionFlags uint8 + +const ( + isList = 1 << iota + scriptInFrom + regionInFrom +) + +func (t *Tag) setUndefinedLang(id Language) { + if t.LangID == 0 { + t.LangID = id + } +} + +func (t *Tag) setUndefinedScript(id Script) { + if t.ScriptID == 0 { + t.ScriptID = id + } +} + +func (t *Tag) setUndefinedRegion(id Region) { + if t.RegionID == 0 || t.RegionID.Contains(id) { + t.RegionID = id + } +} + +// ErrMissingLikelyTagsData indicates no information was available +// to compute likely values of missing tags. +var ErrMissingLikelyTagsData = errors.New("missing likely tags data") + +// addLikelySubtags sets subtags to their most likely value, given the locale. +// In most cases this means setting fields for unknown values, but in some +// cases it may alter a value. It returns an ErrMissingLikelyTagsData error +// if the given locale cannot be expanded. +func (t Tag) addLikelySubtags() (Tag, error) { + id, err := addTags(t) + if err != nil { + return t, err + } else if id.equalTags(t) { + return t, nil + } + id.RemakeString() + return id, nil +} + +// specializeRegion attempts to specialize a group region. +func specializeRegion(t *Tag) bool { + if i := regionInclusion[t.RegionID]; i < nRegionGroups { + x := likelyRegionGroup[i] + if Language(x.lang) == t.LangID && Script(x.script) == t.ScriptID { + t.RegionID = Region(x.region) + } + return true + } + return false +} + +// Maximize returns a new tag with missing tags filled in. +func (t Tag) Maximize() (Tag, error) { + return addTags(t) +} + +func addTags(t Tag) (Tag, error) { + // We leave private use identifiers alone. + if t.IsPrivateUse() { + return t, nil + } + if t.ScriptID != 0 && t.RegionID != 0 { + if t.LangID != 0 { + // already fully specified + specializeRegion(&t) + return t, nil + } + // Search matches for und-script-region. Note that for these cases + // region will never be a group so there is no need to check for this. + list := likelyRegion[t.RegionID : t.RegionID+1] + if x := list[0]; x.flags&isList != 0 { + list = likelyRegionList[x.lang : x.lang+uint16(x.script)] + } + for _, x := range list { + // Deviating from the spec. See match_test.go for details. + if Script(x.script) == t.ScriptID { + t.setUndefinedLang(Language(x.lang)) + return t, nil + } + } + } + if t.LangID != 0 { + // Search matches for lang-script and lang-region, where lang != und. + if t.LangID < langNoIndexOffset { + x := likelyLang[t.LangID] + if x.flags&isList != 0 { + list := likelyLangList[x.region : x.region+uint16(x.script)] + if t.ScriptID != 0 { + for _, x := range list { + if Script(x.script) == t.ScriptID && x.flags&scriptInFrom != 0 { + t.setUndefinedRegion(Region(x.region)) + return t, nil + } + } + } else if t.RegionID != 0 { + count := 0 + goodScript := true + tt := t + for _, x := range list { + // We visit all entries for which the script was not + // defined, including the ones where the region was not + // defined. This allows for proper disambiguation within + // regions. + if x.flags&scriptInFrom == 0 && t.RegionID.Contains(Region(x.region)) { + tt.RegionID = Region(x.region) + tt.setUndefinedScript(Script(x.script)) + goodScript = goodScript && tt.ScriptID == Script(x.script) + count++ + } + } + if count == 1 { + return tt, nil + } + // Even if we fail to find a unique Region, we might have + // an unambiguous script. + if goodScript { + t.ScriptID = tt.ScriptID + } + } + } + } + } else { + // Search matches for und-script. + if t.ScriptID != 0 { + x := likelyScript[t.ScriptID] + if x.region != 0 { + t.setUndefinedRegion(Region(x.region)) + t.setUndefinedLang(Language(x.lang)) + return t, nil + } + } + // Search matches for und-region. If und-script-region exists, it would + // have been found earlier. + if t.RegionID != 0 { + if i := regionInclusion[t.RegionID]; i < nRegionGroups { + x := likelyRegionGroup[i] + if x.region != 0 { + t.setUndefinedLang(Language(x.lang)) + t.setUndefinedScript(Script(x.script)) + t.RegionID = Region(x.region) + } + } else { + x := likelyRegion[t.RegionID] + if x.flags&isList != 0 { + x = likelyRegionList[x.lang] + } + if x.script != 0 && x.flags != scriptInFrom { + t.setUndefinedLang(Language(x.lang)) + t.setUndefinedScript(Script(x.script)) + return t, nil + } + } + } + } + + // Search matches for lang. + if t.LangID < langNoIndexOffset { + x := likelyLang[t.LangID] + if x.flags&isList != 0 { + x = likelyLangList[x.region] + } + if x.region != 0 { + t.setUndefinedScript(Script(x.script)) + t.setUndefinedRegion(Region(x.region)) + } + specializeRegion(&t) + if t.LangID == 0 { + t.LangID = _en // default language + } + return t, nil + } + return t, ErrMissingLikelyTagsData +} + +func (t *Tag) setTagsFrom(id Tag) { + t.LangID = id.LangID + t.ScriptID = id.ScriptID + t.RegionID = id.RegionID +} + +// minimize removes the region or script subtags from t such that +// t.addLikelySubtags() == t.minimize().addLikelySubtags(). +func (t Tag) minimize() (Tag, error) { + t, err := minimizeTags(t) + if err != nil { + return t, err + } + t.RemakeString() + return t, nil +} + +// minimizeTags mimics the behavior of the ICU 51 C implementation. +func minimizeTags(t Tag) (Tag, error) { + if t.equalTags(Und) { + return t, nil + } + max, err := addTags(t) + if err != nil { + return t, err + } + for _, id := range [...]Tag{ + {LangID: t.LangID}, + {LangID: t.LangID, RegionID: t.RegionID}, + {LangID: t.LangID, ScriptID: t.ScriptID}, + } { + if x, err := addTags(id); err == nil && max.equalTags(x) { + t.setTagsFrom(id) + break + } + } + return t, nil +} diff --git a/vendor/golang.org/x/text/internal/language/parse.go b/vendor/golang.org/x/text/internal/language/parse.go new file mode 100644 index 00000000..aad1e0ac --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/parse.go @@ -0,0 +1,608 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "bytes" + "errors" + "fmt" + "sort" + + "golang.org/x/text/internal/tag" +) + +// isAlpha returns true if the byte is not a digit. +// b must be an ASCII letter or digit. +func isAlpha(b byte) bool { + return b > '9' +} + +// isAlphaNum returns true if the string contains only ASCII letters or digits. +func isAlphaNum(s []byte) bool { + for _, c := range s { + if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') { + return false + } + } + return true +} + +// ErrSyntax is returned by any of the parsing functions when the +// input is not well-formed, according to BCP 47. +// TODO: return the position at which the syntax error occurred? +var ErrSyntax = errors.New("language: tag is not well-formed") + +// ErrDuplicateKey is returned when a tag contains the same key twice with +// different values in the -u section. +var ErrDuplicateKey = errors.New("language: different values for same key in -u extension") + +// ValueError is returned by any of the parsing functions when the +// input is well-formed but the respective subtag is not recognized +// as a valid value. +type ValueError struct { + v [8]byte +} + +// NewValueError creates a new ValueError. +func NewValueError(tag []byte) ValueError { + var e ValueError + copy(e.v[:], tag) + return e +} + +func (e ValueError) tag() []byte { + n := bytes.IndexByte(e.v[:], 0) + if n == -1 { + n = 8 + } + return e.v[:n] +} + +// Error implements the error interface. +func (e ValueError) Error() string { + return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag()) +} + +// Subtag returns the subtag for which the error occurred. +func (e ValueError) Subtag() string { + return string(e.tag()) +} + +// scanner is used to scan BCP 47 tokens, which are separated by _ or -. +type scanner struct { + b []byte + bytes [max99thPercentileSize]byte + token []byte + start int // start position of the current token + end int // end position of the current token + next int // next point for scan + err error + done bool +} + +func makeScannerString(s string) scanner { + scan := scanner{} + if len(s) <= len(scan.bytes) { + scan.b = scan.bytes[:copy(scan.bytes[:], s)] + } else { + scan.b = []byte(s) + } + scan.init() + return scan +} + +// makeScanner returns a scanner using b as the input buffer. +// b is not copied and may be modified by the scanner routines. +func makeScanner(b []byte) scanner { + scan := scanner{b: b} + scan.init() + return scan +} + +func (s *scanner) init() { + for i, c := range s.b { + if c == '_' { + s.b[i] = '-' + } + } + s.scan() +} + +// restToLower converts the string between start and end to lower case. +func (s *scanner) toLower(start, end int) { + for i := start; i < end; i++ { + c := s.b[i] + if 'A' <= c && c <= 'Z' { + s.b[i] += 'a' - 'A' + } + } +} + +func (s *scanner) setError(e error) { + if s.err == nil || (e == ErrSyntax && s.err != ErrSyntax) { + s.err = e + } +} + +// resizeRange shrinks or grows the array at position oldStart such that +// a new string of size newSize can fit between oldStart and oldEnd. +// Sets the scan point to after the resized range. +func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) { + s.start = oldStart + if end := oldStart + newSize; end != oldEnd { + diff := end - oldEnd + var b []byte + if n := len(s.b) + diff; n > cap(s.b) { + b = make([]byte, n) + copy(b, s.b[:oldStart]) + } else { + b = s.b[:n] + } + copy(b[end:], s.b[oldEnd:]) + s.b = b + s.next = end + (s.next - s.end) + s.end = end + } +} + +// replace replaces the current token with repl. +func (s *scanner) replace(repl string) { + s.resizeRange(s.start, s.end, len(repl)) + copy(s.b[s.start:], repl) +} + +// gobble removes the current token from the input. +// Caller must call scan after calling gobble. +func (s *scanner) gobble(e error) { + s.setError(e) + if s.start == 0 { + s.b = s.b[:+copy(s.b, s.b[s.next:])] + s.end = 0 + } else { + s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])] + s.end = s.start - 1 + } + s.next = s.start +} + +// deleteRange removes the given range from s.b before the current token. +func (s *scanner) deleteRange(start, end int) { + s.b = s.b[:start+copy(s.b[start:], s.b[end:])] + diff := end - start + s.next -= diff + s.start -= diff + s.end -= diff +} + +// scan parses the next token of a BCP 47 string. Tokens that are larger +// than 8 characters or include non-alphanumeric characters result in an error +// and are gobbled and removed from the output. +// It returns the end position of the last token consumed. +func (s *scanner) scan() (end int) { + end = s.end + s.token = nil + for s.start = s.next; s.next < len(s.b); { + i := bytes.IndexByte(s.b[s.next:], '-') + if i == -1 { + s.end = len(s.b) + s.next = len(s.b) + i = s.end - s.start + } else { + s.end = s.next + i + s.next = s.end + 1 + } + token := s.b[s.start:s.end] + if i < 1 || i > 8 || !isAlphaNum(token) { + s.gobble(ErrSyntax) + continue + } + s.token = token + return end + } + if n := len(s.b); n > 0 && s.b[n-1] == '-' { + s.setError(ErrSyntax) + s.b = s.b[:len(s.b)-1] + } + s.done = true + return end +} + +// acceptMinSize parses multiple tokens of the given size or greater. +// It returns the end position of the last token consumed. +func (s *scanner) acceptMinSize(min int) (end int) { + end = s.end + s.scan() + for ; len(s.token) >= min; s.scan() { + end = s.end + } + return end +} + +// Parse parses the given BCP 47 string and returns a valid Tag. If parsing +// failed it returns an error and any part of the tag that could be parsed. +// If parsing succeeded but an unknown value was found, it returns +// ValueError. The Tag returned in this case is just stripped of the unknown +// value. All other values are preserved. It accepts tags in the BCP 47 format +// and extensions to this standard defined in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +func Parse(s string) (t Tag, err error) { + // TODO: consider supporting old-style locale key-value pairs. + if s == "" { + return Und, ErrSyntax + } + defer func() { + if recover() != nil { + t = Und + err = ErrSyntax + return + } + }() + if len(s) <= maxAltTaglen { + b := [maxAltTaglen]byte{} + for i, c := range s { + // Generating invalid UTF-8 is okay as it won't match. + if 'A' <= c && c <= 'Z' { + c += 'a' - 'A' + } else if c == '_' { + c = '-' + } + b[i] = byte(c) + } + if t, ok := grandfathered(b); ok { + return t, nil + } + } + scan := makeScannerString(s) + return parse(&scan, s) +} + +func parse(scan *scanner, s string) (t Tag, err error) { + t = Und + var end int + if n := len(scan.token); n <= 1 { + scan.toLower(0, len(scan.b)) + if n == 0 || scan.token[0] != 'x' { + return t, ErrSyntax + } + end = parseExtensions(scan) + } else if n >= 4 { + return Und, ErrSyntax + } else { // the usual case + t, end = parseTag(scan, true) + if n := len(scan.token); n == 1 { + t.pExt = uint16(end) + end = parseExtensions(scan) + } else if end < len(scan.b) { + scan.setError(ErrSyntax) + scan.b = scan.b[:end] + } + } + if int(t.pVariant) < len(scan.b) { + if end < len(s) { + s = s[:end] + } + if len(s) > 0 && tag.Compare(s, scan.b) == 0 { + t.str = s + } else { + t.str = string(scan.b) + } + } else { + t.pVariant, t.pExt = 0, 0 + } + return t, scan.err +} + +// parseTag parses language, script, region and variants. +// It returns a Tag and the end position in the input that was parsed. +// If doNorm is true, then <lang>-<extlang> will be normalized to <extlang>. +func parseTag(scan *scanner, doNorm bool) (t Tag, end int) { + var e error + // TODO: set an error if an unknown lang, script or region is encountered. + t.LangID, e = getLangID(scan.token) + scan.setError(e) + scan.replace(t.LangID.String()) + langStart := scan.start + end = scan.scan() + for len(scan.token) == 3 && isAlpha(scan.token[0]) { + // From http://tools.ietf.org/html/bcp47, <lang>-<extlang> tags are equivalent + // to a tag of the form <extlang>. + if doNorm { + lang, e := getLangID(scan.token) + if lang != 0 { + t.LangID = lang + langStr := lang.String() + copy(scan.b[langStart:], langStr) + scan.b[langStart+len(langStr)] = '-' + scan.start = langStart + len(langStr) + 1 + } + scan.gobble(e) + } + end = scan.scan() + } + if len(scan.token) == 4 && isAlpha(scan.token[0]) { + t.ScriptID, e = getScriptID(script, scan.token) + if t.ScriptID == 0 { + scan.gobble(e) + } + end = scan.scan() + } + if n := len(scan.token); n >= 2 && n <= 3 { + t.RegionID, e = getRegionID(scan.token) + if t.RegionID == 0 { + scan.gobble(e) + } else { + scan.replace(t.RegionID.String()) + } + end = scan.scan() + } + scan.toLower(scan.start, len(scan.b)) + t.pVariant = byte(end) + end = parseVariants(scan, end, t) + t.pExt = uint16(end) + return t, end +} + +var separator = []byte{'-'} + +// parseVariants scans tokens as long as each token is a valid variant string. +// Duplicate variants are removed. +func parseVariants(scan *scanner, end int, t Tag) int { + start := scan.start + varIDBuf := [4]uint8{} + variantBuf := [4][]byte{} + varID := varIDBuf[:0] + variant := variantBuf[:0] + last := -1 + needSort := false + for ; len(scan.token) >= 4; scan.scan() { + // TODO: measure the impact of needing this conversion and redesign + // the data structure if there is an issue. + v, ok := variantIndex[string(scan.token)] + if !ok { + // unknown variant + // TODO: allow user-defined variants? + scan.gobble(NewValueError(scan.token)) + continue + } + varID = append(varID, v) + variant = append(variant, scan.token) + if !needSort { + if last < int(v) { + last = int(v) + } else { + needSort = true + // There is no legal combinations of more than 7 variants + // (and this is by no means a useful sequence). + const maxVariants = 8 + if len(varID) > maxVariants { + break + } + } + } + end = scan.end + } + if needSort { + sort.Sort(variantsSort{varID, variant}) + k, l := 0, -1 + for i, v := range varID { + w := int(v) + if l == w { + // Remove duplicates. + continue + } + varID[k] = varID[i] + variant[k] = variant[i] + k++ + l = w + } + if str := bytes.Join(variant[:k], separator); len(str) == 0 { + end = start - 1 + } else { + scan.resizeRange(start, end, len(str)) + copy(scan.b[scan.start:], str) + end = scan.end + } + } + return end +} + +type variantsSort struct { + i []uint8 + v [][]byte +} + +func (s variantsSort) Len() int { + return len(s.i) +} + +func (s variantsSort) Swap(i, j int) { + s.i[i], s.i[j] = s.i[j], s.i[i] + s.v[i], s.v[j] = s.v[j], s.v[i] +} + +func (s variantsSort) Less(i, j int) bool { + return s.i[i] < s.i[j] +} + +type bytesSort struct { + b [][]byte + n int // first n bytes to compare +} + +func (b bytesSort) Len() int { + return len(b.b) +} + +func (b bytesSort) Swap(i, j int) { + b.b[i], b.b[j] = b.b[j], b.b[i] +} + +func (b bytesSort) Less(i, j int) bool { + for k := 0; k < b.n; k++ { + if b.b[i][k] == b.b[j][k] { + continue + } + return b.b[i][k] < b.b[j][k] + } + return false +} + +// parseExtensions parses and normalizes the extensions in the buffer. +// It returns the last position of scan.b that is part of any extension. +// It also trims scan.b to remove excess parts accordingly. +func parseExtensions(scan *scanner) int { + start := scan.start + exts := [][]byte{} + private := []byte{} + end := scan.end + for len(scan.token) == 1 { + extStart := scan.start + ext := scan.token[0] + end = parseExtension(scan) + extension := scan.b[extStart:end] + if len(extension) < 3 || (ext != 'x' && len(extension) < 4) { + scan.setError(ErrSyntax) + end = extStart + continue + } else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) { + scan.b = scan.b[:end] + return end + } else if ext == 'x' { + private = extension + break + } + exts = append(exts, extension) + } + sort.Sort(bytesSort{exts, 1}) + if len(private) > 0 { + exts = append(exts, private) + } + scan.b = scan.b[:start] + if len(exts) > 0 { + scan.b = append(scan.b, bytes.Join(exts, separator)...) + } else if start > 0 { + // Strip trailing '-'. + scan.b = scan.b[:start-1] + } + return end +} + +// parseExtension parses a single extension and returns the position of +// the extension end. +func parseExtension(scan *scanner) int { + start, end := scan.start, scan.end + switch scan.token[0] { + case 'u': // https://www.ietf.org/rfc/rfc6067.txt + attrStart := end + scan.scan() + for last := []byte{}; len(scan.token) > 2; scan.scan() { + if bytes.Compare(scan.token, last) != -1 { + // Attributes are unsorted. Start over from scratch. + p := attrStart + 1 + scan.next = p + attrs := [][]byte{} + for scan.scan(); len(scan.token) > 2; scan.scan() { + attrs = append(attrs, scan.token) + end = scan.end + } + sort.Sort(bytesSort{attrs, 3}) + copy(scan.b[p:], bytes.Join(attrs, separator)) + break + } + last = scan.token + end = scan.end + } + // Scan key-type sequences. A key is of length 2 and may be followed + // by 0 or more "type" subtags from 3 to the maximum of 8 letters. + var last, key []byte + for attrEnd := end; len(scan.token) == 2; last = key { + key = scan.token + end = scan.end + for scan.scan(); end < scan.end && len(scan.token) > 2; scan.scan() { + end = scan.end + } + // TODO: check key value validity + if bytes.Compare(key, last) != 1 || scan.err != nil { + // We have an invalid key or the keys are not sorted. + // Start scanning keys from scratch and reorder. + p := attrEnd + 1 + scan.next = p + keys := [][]byte{} + for scan.scan(); len(scan.token) == 2; { + keyStart := scan.start + end = scan.end + for scan.scan(); end < scan.end && len(scan.token) > 2; scan.scan() { + end = scan.end + } + keys = append(keys, scan.b[keyStart:end]) + } + sort.Stable(bytesSort{keys, 2}) + if n := len(keys); n > 0 { + k := 0 + for i := 1; i < n; i++ { + if !bytes.Equal(keys[k][:2], keys[i][:2]) { + k++ + keys[k] = keys[i] + } else if !bytes.Equal(keys[k], keys[i]) { + scan.setError(ErrDuplicateKey) + } + } + keys = keys[:k+1] + } + reordered := bytes.Join(keys, separator) + if e := p + len(reordered); e < end { + scan.deleteRange(e, end) + end = e + } + copy(scan.b[p:], reordered) + break + } + } + case 't': // https://www.ietf.org/rfc/rfc6497.txt + scan.scan() + if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) { + _, end = parseTag(scan, false) + scan.toLower(start, end) + } + for len(scan.token) == 2 && !isAlpha(scan.token[1]) { + end = scan.acceptMinSize(3) + } + case 'x': + end = scan.acceptMinSize(1) + default: + end = scan.acceptMinSize(2) + } + return end +} + +// getExtension returns the name, body and end position of the extension. +func getExtension(s string, p int) (end int, ext string) { + if s[p] == '-' { + p++ + } + if s[p] == 'x' { + return len(s), s[p:] + } + end = nextExtension(s, p) + return end, s[p:end] +} + +// nextExtension finds the next extension within the string, searching +// for the -<char>- pattern from position p. +// In the fast majority of cases, language tags will have at most +// one extension and extensions tend to be small. +func nextExtension(s string, p int) int { + for n := len(s) - 3; p < n; { + if s[p] == '-' { + if s[p+2] == '-' { + return p + } + p += 3 + } else { + p++ + } + } + return len(s) +} diff --git a/vendor/golang.org/x/text/internal/language/tables.go b/vendor/golang.org/x/text/internal/language/tables.go new file mode 100644 index 00000000..14167e74 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/tables.go @@ -0,0 +1,3494 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package language + +import "golang.org/x/text/internal/tag" + +// CLDRVersion is the CLDR version from which the tables in this package are derived. +const CLDRVersion = "32" + +const NumLanguages = 8798 + +const NumScripts = 261 + +const NumRegions = 358 + +type FromTo struct { + From uint16 + To uint16 +} + +const nonCanonicalUnd = 1201 +const ( + _af = 22 + _am = 39 + _ar = 58 + _az = 88 + _bg = 126 + _bn = 165 + _ca = 215 + _cs = 250 + _da = 257 + _de = 269 + _el = 310 + _en = 313 + _es = 318 + _et = 320 + _fa = 328 + _fi = 337 + _fil = 339 + _fr = 350 + _gu = 420 + _he = 444 + _hi = 446 + _hr = 465 + _hu = 469 + _hy = 471 + _id = 481 + _is = 504 + _it = 505 + _ja = 512 + _ka = 528 + _kk = 578 + _km = 586 + _kn = 593 + _ko = 596 + _ky = 650 + _lo = 696 + _lt = 704 + _lv = 711 + _mk = 767 + _ml = 772 + _mn = 779 + _mo = 784 + _mr = 795 + _ms = 799 + _mul = 806 + _my = 817 + _nb = 839 + _ne = 849 + _nl = 871 + _no = 879 + _pa = 925 + _pl = 947 + _pt = 960 + _ro = 988 + _ru = 994 + _sh = 1031 + _si = 1036 + _sk = 1042 + _sl = 1046 + _sq = 1073 + _sr = 1074 + _sv = 1092 + _sw = 1093 + _ta = 1104 + _te = 1121 + _th = 1131 + _tl = 1146 + _tn = 1152 + _tr = 1162 + _uk = 1198 + _ur = 1204 + _uz = 1212 + _vi = 1219 + _zh = 1321 + _zu = 1327 + _jbo = 515 + _ami = 1650 + _bnn = 2357 + _hak = 438 + _tlh = 14467 + _lb = 661 + _nv = 899 + _pwn = 12055 + _tao = 14188 + _tay = 14198 + _tsu = 14662 + _nn = 874 + _sfb = 13629 + _vgt = 15701 + _sgg = 13660 + _cmn = 3007 + _nan = 835 + _hsn = 467 +) + +const langPrivateStart = 0x2f72 + +const langPrivateEnd = 0x3179 + +// lang holds an alphabetically sorted list of ISO-639 language identifiers. +// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag. +// For 2-byte language identifiers, the two successive bytes have the following meaning: +// - if the first letter of the 2- and 3-letter ISO codes are the same: +// the second and third letter of the 3-letter ISO code. +// - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3. +// +// For 3-byte language identifiers the 4th byte is 0. +const lang tag.Index = "" + // Size: 5324 bytes + "---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" + + "cd\x00ace\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey" + + "\x00affragc\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00a" + + "jg\x00akkaakk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00am" + + "p\x00anrganc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00" + + "ape\x00apr\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars" + + "\x00ary\x00arz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00a" + + "tj\x00auy\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx" + + "\x00ayymayb\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00" + + "bba\x00bbb\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bc" + + "m\x00bcn\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00" + + "bet\x00bew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn" + + "\x00bgx\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib" + + "\x00big\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn" + + "\x00bjo\x00bjr\x00bjt\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt" + + "\x00bmambmh\x00bmk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00" + + "bom\x00bon\x00bpy\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx" + + "\x00brz\x00bsosbsj\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00b" + + "uc\x00bud\x00bug\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr" + + "\x00bxh\x00bye\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf" + + "\x00bzh\x00bzw\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg" + + "\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00c" + + "kl\x00cko\x00cky\x00cla\x00cme\x00cmg\x00cooscop\x00cps\x00crrecrh\x00cr" + + "j\x00crk\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymda" + + "andad\x00daf\x00dag\x00dah\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00" + + "ddn\x00deeuded\x00den\x00dga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia" + + "\x00dje\x00dnj\x00dob\x00doi\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm" + + "\x00dtp\x00dts\x00dty\x00dua\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00d" + + "yo\x00dyu\x00dzzodzg\x00ebu\x00eeweefi\x00egl\x00egy\x00eka\x00eky\x00el" + + "llema\x00emi\x00enngenn\x00enq\x00eopoeri\x00es\x00\x05esu\x00etstetr" + + "\x00ett\x00etu\x00etx\x00euusewo\x00ext\x00faasfaa\x00fab\x00fag\x00fai" + + "\x00fan\x00ffulffi\x00ffm\x00fiinfia\x00fil\x00fit\x00fjijflr\x00fmp\x00" + + "foaofod\x00fon\x00for\x00fpe\x00fqs\x00frrafrc\x00frp\x00frr\x00frs\x00f" + + "ub\x00fud\x00fue\x00fuf\x00fuh\x00fuq\x00fur\x00fuv\x00fuy\x00fvr\x00fyr" + + "ygalegaa\x00gaf\x00gag\x00gah\x00gaj\x00gam\x00gan\x00gaw\x00gay\x00gba" + + "\x00gbf\x00gbm\x00gby\x00gbz\x00gcr\x00gdlagde\x00gdn\x00gdr\x00geb\x00g" + + "ej\x00gel\x00gez\x00gfk\x00ggn\x00ghs\x00gil\x00gim\x00gjk\x00gjn\x00gju" + + "\x00gkn\x00gkp\x00gllgglk\x00gmm\x00gmv\x00gnrngnd\x00gng\x00god\x00gof" + + "\x00goi\x00gom\x00gon\x00gor\x00gos\x00got\x00grb\x00grc\x00grt\x00grw" + + "\x00gsw\x00guujgub\x00guc\x00gud\x00gur\x00guw\x00gux\x00guz\x00gvlvgvf" + + "\x00gvr\x00gvs\x00gwc\x00gwi\x00gwt\x00gyi\x00haauhag\x00hak\x00ham\x00h" + + "aw\x00haz\x00hbb\x00hdy\x00heebhhy\x00hiinhia\x00hif\x00hig\x00hih\x00hi" + + "l\x00hla\x00hlu\x00hmd\x00hmt\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homo" + + "hoc\x00hoj\x00hot\x00hrrvhsb\x00hsn\x00htathuunhui\x00hyyehzerianaian" + + "\x00iar\x00iba\x00ibb\x00iby\x00ica\x00ich\x00idndidd\x00idi\x00idu\x00i" + + "eleife\x00igboigb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw\x00ikx\x00i" + + "lo\x00imo\x00inndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00\x03iwm\x00i" + + "ws\x00izh\x00izi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00jgk\x00jgo" + + "\x00ji\x00\x06jib\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatkaa\x00kab" + + "\x00kac\x00kad\x00kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp\x00kbq" + + "\x00kbx\x00kby\x00kcg\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl\x00kdt" + + "\x00kea\x00ken\x00kez\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00kgp\x00k" + + "ha\x00khb\x00khn\x00khq\x00khs\x00kht\x00khw\x00khz\x00kiikkij\x00kiu" + + "\x00kiw\x00kjuakjd\x00kjg\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klalkln\x00" + + "klq\x00klt\x00klx\x00kmhmkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw\x00knank" + + "nf\x00knp\x00koorkoi\x00kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo" + + "\x00kpr\x00kpx\x00kqb\x00kqf\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00k" + + "rl\x00krs\x00kru\x00ksasksb\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb" + + "\x00ktm\x00kto\x00kuurkub\x00kud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00k" + + "us\x00kvomkvg\x00kvr\x00kvx\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm" + + "\x00kxp\x00kxw\x00kxz\x00kyirkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag" + + "\x00lah\x00laj\x00las\x00lbtzlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00l" + + "ed\x00lee\x00lem\x00lep\x00leq\x00leu\x00lez\x00lguglgg\x00liimlia\x00li" + + "d\x00lif\x00lig\x00lih\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln" + + "\x00lmn\x00lmo\x00lmp\x00lninlns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor" + + "\x00los\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy\x00luz\x00lvav" + + "lwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00man\x00mas\x00ma" + + "w\x00maz\x00mbh\x00mbo\x00mbq\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr" + + "\x00mcu\x00mda\x00mde\x00mdf\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee" + + "\x00mek\x00men\x00mer\x00met\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq" + + "\x00mglgmgh\x00mgl\x00mgo\x00mgp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00" + + "min\x00mis\x00miw\x00mkkdmki\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00m" + + "ls\x00mmo\x00mmu\x00mmx\x00mnonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00mo" + + "e\x00moh\x00mos\x00mox\x00mpp\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00" + + "mrj\x00mro\x00mssamtltmtc\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00m" + + "us\x00mva\x00mvn\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk" + + "\x00mym\x00myv\x00myw\x00myx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw" + + "\x00mzz\x00naaunac\x00naf\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00n" + + "bobnca\x00nce\x00ncf\x00nch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb" + + "\x00new\x00nex\x00nfr\x00ngdonga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00n" + + "if\x00nii\x00nij\x00nin\x00niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nll" + + "dnmg\x00nmz\x00nnnonnf\x00nnh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00" + + "nop\x00nou\x00nqo\x00nrblnrb\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr" + + "\x00nui\x00nup\x00nus\x00nuv\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym" + + "\x00nyn\x00nzi\x00occiogc\x00ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00" + + "opm\x00orrioro\x00oru\x00osssosa\x00ota\x00otk\x00ozm\x00paanpag\x00pal" + + "\x00pam\x00pap\x00pau\x00pbi\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo" + + "\x00pex\x00pfl\x00phl\x00phn\x00pilipil\x00pip\x00pka\x00pko\x00plolpla" + + "\x00pms\x00png\x00pnn\x00pnt\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psusp" + + "ss\x00ptorptp\x00puu\x00pwa\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rc" + + "f\x00rej\x00rel\x00res\x00rgn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmoh" + + "rmf\x00rmo\x00rmt\x00rmu\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00r" + + "ro\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf" + + "\x00sah\x00saq\x00sas\x00sat\x00sav\x00saz\x00sba\x00sbe\x00sbp\x00scrds" + + "ck\x00scl\x00scn\x00sco\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00se" + + "i\x00ses\x00sgagsga\x00sgs\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn" + + "\x00shu\x00siinsid\x00sig\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks" + + "\x00sllvsld\x00sli\x00sll\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp" + + "\x00smq\x00sms\x00snnasnc\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq" + + "\x00sou\x00soy\x00spd\x00spl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx" + + "\x00ssswssd\x00ssg\x00ssy\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00" + + "sur\x00sus\x00svweswwaswb\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00s" + + "yl\x00syr\x00szl\x00taamtaj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf" + + "\x00tbg\x00tbo\x00tbw\x00tbz\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelt" + + "ed\x00tem\x00teo\x00tet\x00tfi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00th" + + "q\x00thr\x00tiirtif\x00tig\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr" + + "\x00tkt\x00tlgltlf\x00tlx\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00" + + "tog\x00toq\x00tpi\x00tpm\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssot" + + "sd\x00tsf\x00tsg\x00tsj\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts" + + "\x00ttt\x00tuh\x00tul\x00tum\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00t" + + "wq\x00txg\x00tyahtya\x00tyv\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli" + + "\x00umb\x00und\x00unr\x00unx\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00u" + + "vh\x00uvl\x00uzzbvag\x00vai\x00van\x00veenvec\x00vep\x00viievic\x00viv" + + "\x00vls\x00vmf\x00vmw\x00voolvot\x00vro\x00vun\x00vut\x00walnwae\x00waj" + + "\x00wal\x00wan\x00war\x00wbp\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg" + + "\x00wib\x00wiu\x00wiv\x00wja\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu" + + "\x00woolwob\x00wos\x00wrs\x00wsk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00x" + + "bi\x00xcr\x00xes\x00xhhoxla\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna" + + "\x00xnr\x00xog\x00xon\x00xpr\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe" + + "\x00yam\x00yao\x00yap\x00yas\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb" + + "\x00yby\x00yer\x00ygr\x00ygw\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00y" + + "ooryon\x00yrb\x00yre\x00yrl\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw" + + "\x00zahazag\x00zbl\x00zdj\x00zea\x00zgh\x00zhhozhx\x00zia\x00zlm\x00zmi" + + "\x00zne\x00zuulzxx\x00zza\x00\xff\xff\xff\xff" + +const langNoIndexOffset = 1330 + +// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index +// in lookup tables. The language ids for these language codes are derived directly +// from the letters and are not consecutive. +// Size: 2197 bytes, 2197 elements +var langNoIndex = [2197]uint8{ + // Entry 0 - 3F + 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2, + 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57, + 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70, + 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x72, + 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77, + 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2, + 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xbc, 0x0a, 0x6a, + 0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff, + // Entry 40 - 7F + 0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0, + 0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed, + 0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35, + 0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff, + 0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5, + 0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3, + 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce, + 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf, + // Entry 80 - BF + 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x7f, 0xff, 0xff, + 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7, + 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba, + 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff, + 0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff, + 0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5, + 0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c, + 0x08, 0x21, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80, + // Entry C0 - FF + 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96, + 0x1b, 0x14, 0x08, 0xf3, 0x2b, 0xe7, 0x17, 0x56, + 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7f, 0xf3, 0xef, + 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10, + 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xff, 0x7b, 0x35, + 0x3e, 0xc7, 0xc7, 0xdf, 0xff, 0x01, 0x81, 0x00, + 0xb0, 0x05, 0x80, 0x00, 0x20, 0x00, 0x00, 0x03, + 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d, + // Entry 100 - 13F + 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64, + 0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00, + 0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3, + 0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x41, 0x0c, + 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc7, 0x67, 0x5f, + 0x56, 0x99, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00, + 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56, + 0x90, 0x6d, 0x01, 0x2e, 0x96, 0x69, 0x20, 0xfb, + // Entry 140 - 17F + 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x0c, 0x16, + 0x03, 0x00, 0x00, 0xb0, 0x14, 0x23, 0x50, 0x06, + 0x0a, 0x00, 0x01, 0x00, 0x00, 0x10, 0x11, 0x09, + 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10, + 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x05, + 0x08, 0x00, 0x00, 0x05, 0x00, 0x80, 0x28, 0x04, + 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35, + 0x24, 0x52, 0xf4, 0xd5, 0xbf, 0x62, 0xc9, 0x03, + // Entry 180 - 1BF + 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98, + 0x21, 0x18, 0x81, 0x08, 0x00, 0x01, 0x40, 0x82, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea, + 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, + // Entry 1C0 - 1FF + 0x00, 0x03, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00, + 0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55, + 0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40, + 0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7a, 0xbf, + // Entry 200 - 23F + 0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27, + 0xed, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5, + 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe1, 0xdf, + 0x03, 0x44, 0x08, 0x90, 0x01, 0x04, 0x81, 0xe3, + 0x92, 0x54, 0xdb, 0x28, 0xd3, 0x5f, 0xfe, 0x6d, + 0x79, 0xed, 0x1c, 0x7f, 0x04, 0x08, 0x00, 0x01, + 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f, + 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54, + // Entry 240 - 27F + 0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00, + 0x20, 0x7b, 0x78, 0x02, 0x07, 0x84, 0x00, 0xf0, + 0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00, + 0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04, + 0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00, + 0x91, 0x24, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff, + 0x7b, 0x7f, 0x70, 0x00, 0x05, 0x9b, 0xdd, 0x66, + // Entry 280 - 2BF + 0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05, + 0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51, + 0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05, + 0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, + 0x0c, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60, + 0xe7, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80, + 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04, + 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20, + // Entry 2C0 - 2FF + 0x02, 0x50, 0x80, 0x11, 0x00, 0x99, 0x6c, 0xe2, + 0x50, 0x27, 0x1d, 0x11, 0x29, 0x0e, 0x59, 0xe9, + 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00, + 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d, + 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00, + 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01, + 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x40, 0x08, + 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x8d, 0x12, 0x00, + // Entry 300 - 33F + 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0, + 0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00, + 0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80, + 0x00, 0x01, 0xd0, 0x16, 0x40, 0x00, 0x10, 0xb0, + 0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00, + 0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80, + 0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00, + 0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00, + // Entry 340 - 37F + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01, + 0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3, + 0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb, + 0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6, + 0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff, + 0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff, + 0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0x7f, + 0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f, + // Entry 380 - 3BF + 0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f, + 0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d, + 0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf, + 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff, + 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb, + 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe, + 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x7d, 0x1f, + 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44, + // Entry 3C0 - 3FF + 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57, + 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7, + 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x20, + 0x40, 0x54, 0x9f, 0x8a, 0xdf, 0xf9, 0x6e, 0x11, + 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x03, + 0x05, 0xd1, 0x50, 0x5c, 0x00, 0x40, 0x00, 0x10, + 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2, + 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe, + // Entry 400 - 43F + 0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f, + 0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7, + 0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f, + 0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b, + 0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7, + 0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe, + 0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde, + 0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf, + // Entry 440 - 47F + 0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d, + 0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd, + 0x7f, 0x4e, 0xbf, 0x8f, 0xae, 0xff, 0xee, 0xdf, + 0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7, + 0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce, + 0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xfd, + 0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff, + 0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x06, 0xc4, + // Entry 480 - 4BF + 0x93, 0x50, 0x5d, 0xaf, 0xa6, 0xff, 0x99, 0xfb, + 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20, + 0x14, 0x00, 0x55, 0x51, 0xc2, 0x65, 0xf5, 0x41, + 0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x85, 0xc5, 0x05, + 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x05, + 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00, + 0x06, 0x11, 0x20, 0x00, 0x18, 0x01, 0x92, 0xf1, + // Entry 4C0 - 4FF + 0xfd, 0x47, 0x69, 0x06, 0x95, 0x06, 0x57, 0xed, + 0xfb, 0x4d, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40, + 0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83, + 0xb8, 0x4f, 0x10, 0x8e, 0x89, 0x46, 0xde, 0xf7, + 0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00, + 0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d, + 0xbe, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41, + // Entry 500 - 53F + 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49, + 0x2d, 0x14, 0x27, 0x5f, 0xed, 0xf1, 0x3f, 0xe7, + 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8, + 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe7, 0xf7, + 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10, + 0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9, + 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c, + 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40, + // Entry 540 - 57F + 0x00, 0x00, 0x01, 0x43, 0x19, 0x24, 0x08, 0x00, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + // Entry 580 - 5BF + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d, + 0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80, + 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf, + 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00, + 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00, + 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x20, 0x81, + 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40, + // Entry 5C0 - 5FF + 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0xbe, 0x02, + 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20, + 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02, + 0x3d, 0x40, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, + 0x31, 0x00, 0x00, 0x00, 0x01, 0x18, 0x02, 0x20, + 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00, + 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f, + 0x1f, 0x98, 0xcf, 0x9c, 0xff, 0xaf, 0x5f, 0xfe, + // Entry 600 - 63F + 0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9, + 0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1, + 0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7, + 0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd, + 0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x9f, + 0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe, + 0xbe, 0x5f, 0x46, 0x5b, 0xe9, 0x5f, 0x50, 0x18, + 0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f, + // Entry 640 - 67F + 0x75, 0xc4, 0x7d, 0x81, 0x92, 0xf5, 0x57, 0x6c, + 0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde, + 0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x3f, 0x00, 0x98, + 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff, + 0xb9, 0xda, 0x7d, 0xd0, 0x3e, 0x15, 0x7b, 0xb4, + 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7, + 0x5f, 0xff, 0xff, 0x9e, 0xdf, 0xf6, 0xd7, 0xb9, + 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3, + // Entry 680 - 6BF + 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37, + 0xce, 0x7f, 0x44, 0x1d, 0x73, 0x7f, 0xf8, 0xda, + 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x79, 0xa0, + 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08, + 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x09, 0x06, + 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00, + 0x04, 0x00, 0x10, 0xdc, 0x58, 0xd7, 0x0d, 0x0f, + // Entry 6C0 - 6FF + 0x54, 0x4d, 0xf1, 0x16, 0x44, 0xd5, 0x42, 0x08, + 0x40, 0x02, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, + 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x48, 0x41, + 0x24, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00, + 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab, + 0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00, + // Entry 700 - 73F + 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00, + 0x80, 0x86, 0xc2, 0x00, 0x00, 0x01, 0x00, 0x01, + 0xff, 0x18, 0x02, 0x00, 0x02, 0xf0, 0xfd, 0x79, + 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00, + 0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00, + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 740 - 77F + 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e, + 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x46, + 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04, + 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a, + 0x01, 0x00, 0x00, 0xb0, 0x80, 0x20, 0x55, 0x75, + 0x97, 0x7c, 0xdf, 0x31, 0xcc, 0x68, 0xd1, 0x03, + 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60, + // Entry 780 - 7BF + 0x83, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, + 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00, + 0x10, 0x03, 0x31, 0x02, 0x01, 0x00, 0x00, 0xf0, + 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78, + 0x78, 0x15, 0x50, 0x05, 0xa4, 0x84, 0xa9, 0x41, + 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x40, + 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02, + 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed, + // Entry 7C0 - 7FF + 0xdd, 0xbf, 0xf2, 0x5d, 0xc7, 0x0c, 0xd5, 0x42, + 0xfc, 0xff, 0xf7, 0x1f, 0x00, 0x80, 0x40, 0x56, + 0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff, + 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d, + 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80, + 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60, + 0xfe, 0x01, 0x02, 0x88, 0x2a, 0x40, 0x16, 0x01, + 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10, + // Entry 800 - 83F + 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf, + 0xbf, 0x03, 0x00, 0x00, 0x10, 0xdc, 0xa3, 0xd1, + 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3, + 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80, + 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84, + 0x2f, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93, + 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10, + 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00, + // Entry 840 - 87F + 0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x16, 0x89, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x03, + 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28, + 0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00, + 0x00, 0xcb, 0xe4, 0x3a, 0x46, 0x88, 0x54, 0xf1, + 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50, + 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40, + 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1, + // Entry 880 - 8BF + 0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00, + 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24, + 0x0a, 0x00, 0x80, 0x00, 0x00, +} + +// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives +// to 2-letter language codes that cannot be derived using the method described above. +// Each 3-letter code is followed by its 1-byte langID. +const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff" + +// altLangIndex is used to convert indexes in altLangISO3 to langIDs. +// Size: 12 bytes, 6 elements +var altLangIndex = [6]uint16{ + 0x0281, 0x0407, 0x01fb, 0x03e5, 0x013e, 0x0208, +} + +// AliasMap maps langIDs to their suggested replacements. +// Size: 772 bytes, 193 elements +var AliasMap = [193]FromTo{ + 0: {From: 0x82, To: 0x88}, + 1: {From: 0x187, To: 0x1ae}, + 2: {From: 0x1f3, To: 0x1e1}, + 3: {From: 0x1fb, To: 0x1bc}, + 4: {From: 0x208, To: 0x512}, + 5: {From: 0x20f, To: 0x20e}, + 6: {From: 0x310, To: 0x3dc}, + 7: {From: 0x347, To: 0x36f}, + 8: {From: 0x407, To: 0x432}, + 9: {From: 0x47a, To: 0x153}, + 10: {From: 0x490, To: 0x451}, + 11: {From: 0x4a2, To: 0x21}, + 12: {From: 0x53e, To: 0x544}, + 13: {From: 0x58f, To: 0x12d}, + 14: {From: 0x62b, To: 0x34}, + 15: {From: 0x62f, To: 0x14}, + 16: {From: 0x630, To: 0x1eb1}, + 17: {From: 0x651, To: 0x431}, + 18: {From: 0x662, To: 0x431}, + 19: {From: 0x6ed, To: 0x3a}, + 20: {From: 0x6f8, To: 0x1d7}, + 21: {From: 0x709, To: 0x3625}, + 22: {From: 0x73e, To: 0x21a1}, + 23: {From: 0x7b3, To: 0x56}, + 24: {From: 0x7b9, To: 0x299b}, + 25: {From: 0x7c5, To: 0x58}, + 26: {From: 0x7e6, To: 0x145}, + 27: {From: 0x80c, To: 0x5a}, + 28: {From: 0x815, To: 0x8d}, + 29: {From: 0x87e, To: 0x810}, + 30: {From: 0x8a8, To: 0x8b7}, + 31: {From: 0x8c3, To: 0xee3}, + 32: {From: 0x8fa, To: 0x1dc}, + 33: {From: 0x9ef, To: 0x331}, + 34: {From: 0xa36, To: 0x2c5}, + 35: {From: 0xa3d, To: 0xbf}, + 36: {From: 0xabe, To: 0x3322}, + 37: {From: 0xb38, To: 0x529}, + 38: {From: 0xb75, To: 0x265a}, + 39: {From: 0xb7e, To: 0xbc3}, + 40: {From: 0xb9b, To: 0x44e}, + 41: {From: 0xbbc, To: 0x4229}, + 42: {From: 0xbbf, To: 0x529}, + 43: {From: 0xbfe, To: 0x2da7}, + 44: {From: 0xc2e, To: 0x3181}, + 45: {From: 0xcb9, To: 0xf3}, + 46: {From: 0xd08, To: 0xfa}, + 47: {From: 0xdc8, To: 0x11a}, + 48: {From: 0xdd7, To: 0x32d}, + 49: {From: 0xdf8, To: 0xdfb}, + 50: {From: 0xdfe, To: 0x531}, + 51: {From: 0xe01, To: 0xdf3}, + 52: {From: 0xedf, To: 0x205a}, + 53: {From: 0xee9, To: 0x222e}, + 54: {From: 0xeee, To: 0x2e9a}, + 55: {From: 0xf39, To: 0x367}, + 56: {From: 0x10d0, To: 0x140}, + 57: {From: 0x1104, To: 0x2d0}, + 58: {From: 0x11a0, To: 0x1ec}, + 59: {From: 0x1279, To: 0x21}, + 60: {From: 0x1424, To: 0x15e}, + 61: {From: 0x1470, To: 0x14e}, + 62: {From: 0x151f, To: 0xd9b}, + 63: {From: 0x1523, To: 0x390}, + 64: {From: 0x1532, To: 0x19f}, + 65: {From: 0x1580, To: 0x210}, + 66: {From: 0x1583, To: 0x10d}, + 67: {From: 0x15a3, To: 0x3caf}, + 68: {From: 0x1630, To: 0x222e}, + 69: {From: 0x166a, To: 0x19b}, + 70: {From: 0x16c8, To: 0x136}, + 71: {From: 0x1700, To: 0x29f8}, + 72: {From: 0x1718, To: 0x194}, + 73: {From: 0x1727, To: 0xf3f}, + 74: {From: 0x177a, To: 0x178}, + 75: {From: 0x1809, To: 0x17b6}, + 76: {From: 0x1816, To: 0x18f3}, + 77: {From: 0x188a, To: 0x436}, + 78: {From: 0x1979, To: 0x1d01}, + 79: {From: 0x1a74, To: 0x2bb0}, + 80: {From: 0x1a8a, To: 0x1f8}, + 81: {From: 0x1b5a, To: 0x1fa}, + 82: {From: 0x1b86, To: 0x1515}, + 83: {From: 0x1d64, To: 0x2c9b}, + 84: {From: 0x2038, To: 0x37b1}, + 85: {From: 0x203d, To: 0x20dd}, + 86: {From: 0x2042, To: 0x2e00}, + 87: {From: 0x205a, To: 0x30b}, + 88: {From: 0x20e3, To: 0x274}, + 89: {From: 0x20ee, To: 0x263}, + 90: {From: 0x20f2, To: 0x22d}, + 91: {From: 0x20f9, To: 0x256}, + 92: {From: 0x210f, To: 0x21eb}, + 93: {From: 0x2135, To: 0x27d}, + 94: {From: 0x2160, To: 0x913}, + 95: {From: 0x2199, To: 0x121}, + 96: {From: 0x21ce, To: 0x1561}, + 97: {From: 0x21e6, To: 0x504}, + 98: {From: 0x21f4, To: 0x49f}, + 99: {From: 0x21fb, To: 0x269}, + 100: {From: 0x222d, To: 0x121}, + 101: {From: 0x2237, To: 0x121}, + 102: {From: 0x2248, To: 0x217d}, + 103: {From: 0x2262, To: 0x92a}, + 104: {From: 0x2316, To: 0x3226}, + 105: {From: 0x236a, To: 0x2835}, + 106: {From: 0x2382, To: 0x3365}, + 107: {From: 0x2472, To: 0x2c7}, + 108: {From: 0x24e4, To: 0x2ff}, + 109: {From: 0x24f0, To: 0x2fa}, + 110: {From: 0x24fa, To: 0x31f}, + 111: {From: 0x2550, To: 0xb5b}, + 112: {From: 0x25a9, To: 0xe2}, + 113: {From: 0x263e, To: 0x2d0}, + 114: {From: 0x26c9, To: 0x26b4}, + 115: {From: 0x26f9, To: 0x3c8}, + 116: {From: 0x2727, To: 0x3caf}, + 117: {From: 0x2755, To: 0x6a4}, + 118: {From: 0x2765, To: 0x26b4}, + 119: {From: 0x2789, To: 0x4358}, + 120: {From: 0x27c9, To: 0x2001}, + 121: {From: 0x28ea, To: 0x27b1}, + 122: {From: 0x28ef, To: 0x2837}, + 123: {From: 0x28fe, To: 0xaa5}, + 124: {From: 0x2914, To: 0x351}, + 125: {From: 0x2986, To: 0x2da7}, + 126: {From: 0x29f0, To: 0x96b}, + 127: {From: 0x2b1a, To: 0x38d}, + 128: {From: 0x2bfc, To: 0x395}, + 129: {From: 0x2c3f, To: 0x3caf}, + 130: {From: 0x2ce1, To: 0x2201}, + 131: {From: 0x2cfc, To: 0x3be}, + 132: {From: 0x2d13, To: 0x597}, + 133: {From: 0x2d47, To: 0x148}, + 134: {From: 0x2d48, To: 0x148}, + 135: {From: 0x2dff, To: 0x2f1}, + 136: {From: 0x2e08, To: 0x19cc}, + 137: {From: 0x2e10, To: 0xc45}, + 138: {From: 0x2e1a, To: 0x2d95}, + 139: {From: 0x2e21, To: 0x292}, + 140: {From: 0x2e54, To: 0x7d}, + 141: {From: 0x2e65, To: 0x2282}, + 142: {From: 0x2e97, To: 0x1a4}, + 143: {From: 0x2ea0, To: 0x2e9b}, + 144: {From: 0x2eef, To: 0x2ed7}, + 145: {From: 0x3193, To: 0x3c4}, + 146: {From: 0x3366, To: 0x338e}, + 147: {From: 0x342a, To: 0x3dc}, + 148: {From: 0x34ee, To: 0x18d0}, + 149: {From: 0x35c8, To: 0x2c9b}, + 150: {From: 0x35e6, To: 0x412}, + 151: {From: 0x35f5, To: 0x24b}, + 152: {From: 0x360d, To: 0x1dc}, + 153: {From: 0x3658, To: 0x246}, + 154: {From: 0x3676, To: 0x3f4}, + 155: {From: 0x36fd, To: 0x445}, + 156: {From: 0x3747, To: 0x3b42}, + 157: {From: 0x37c0, To: 0x121}, + 158: {From: 0x3816, To: 0x38f2}, + 159: {From: 0x382a, To: 0x2b48}, + 160: {From: 0x382b, To: 0x2c9b}, + 161: {From: 0x382f, To: 0xa9}, + 162: {From: 0x3832, To: 0x3228}, + 163: {From: 0x386c, To: 0x39a6}, + 164: {From: 0x3892, To: 0x3fc0}, + 165: {From: 0x38a0, To: 0x45f}, + 166: {From: 0x38a5, To: 0x39d7}, + 167: {From: 0x38b4, To: 0x1fa4}, + 168: {From: 0x38b5, To: 0x2e9a}, + 169: {From: 0x38fa, To: 0x38f1}, + 170: {From: 0x395c, To: 0x47e}, + 171: {From: 0x3b4e, To: 0xd91}, + 172: {From: 0x3b78, To: 0x137}, + 173: {From: 0x3c99, To: 0x4bc}, + 174: {From: 0x3fbd, To: 0x100}, + 175: {From: 0x4208, To: 0xa91}, + 176: {From: 0x42be, To: 0x573}, + 177: {From: 0x42f9, To: 0x3f60}, + 178: {From: 0x4378, To: 0x25a}, + 179: {From: 0x43b8, To: 0xe6c}, + 180: {From: 0x43cd, To: 0x10f}, + 181: {From: 0x43d4, To: 0x4848}, + 182: {From: 0x44af, To: 0x3322}, + 183: {From: 0x44e3, To: 0x512}, + 184: {From: 0x45ca, To: 0x2409}, + 185: {From: 0x45dd, To: 0x26dc}, + 186: {From: 0x4610, To: 0x48ae}, + 187: {From: 0x46ae, To: 0x46a0}, + 188: {From: 0x473e, To: 0x4745}, + 189: {From: 0x4817, To: 0x3503}, + 190: {From: 0x483b, To: 0x208b}, + 191: {From: 0x4916, To: 0x31f}, + 192: {From: 0x49a7, To: 0x523}, +} + +// Size: 193 bytes, 193 elements +var AliasTypes = [193]AliasType{ + // Entry 0 - 3F + 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 0, 0, + 1, 2, 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 0, + 0, 2, 1, 1, 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, + 1, 1, 1, 0, 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1, + // Entry 40 - 7F + 1, 2, 2, 0, 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0, + 2, 1, 0, 0, 0, 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 1, 2, 2, 2, 0, + 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, + // Entry 80 - BF + 1, 0, 0, 1, 0, 2, 1, 1, 0, 0, 0, 1, 0, 0, 0, 0, + 0, 1, 1, 2, 0, 0, 2, 0, 0, 1, 1, 1, 0, 0, 0, 0, + 0, 2, 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 0, 1, 2, 0, + 0, 0, 1, 0, 1, 0, 0, 1, 0, 0, 0, 0, 1, 0, 0, 1, + // Entry C0 - FF + 1, +} + +const ( + _Latn = 91 + _Hani = 57 + _Hans = 59 + _Hant = 60 + _Qaaa = 149 + _Qaai = 157 + _Qabx = 198 + _Zinh = 255 + _Zyyy = 260 + _Zzzz = 261 +) + +// script is an alphabetically sorted list of ISO 15924 codes. The index +// of the script in the string, divided by 4, is the internal scriptID. +const script tag.Index = "" + // Size: 1052 bytes + "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" + + "BrahBraiBugiBuhdCakmCansCariChamCherChrsCirtCoptCpmnCprtCyrlCyrsDevaDiak" + + "DogrDsrtDuplEgydEgyhEgypElbaElymEthiGeokGeorGlagGongGonmGothGranGrekGujr" + + "GuruHanbHangHaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamo" + + "JavaJpanJurcKaliKanaKawiKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatf" + + "LatgLatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedf" + + "MendMercMeroMlymModiMongMoonMrooMteiMultMymrNagmNandNarbNbatNewaNkdbNkgb" + + "NkooNshuOgamOlckOrkhOryaOsgeOsmaOugrPalmPaucPcunPelmPermPhagPhliPhlpPhlv" + + "PhnxPiqdPlrdPrtiPsinQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaam" + + "QaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabe" + + "QabfQabgQabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabw" + + "QabxRanjRjngRohgRoroRunrSamrSaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogd" + + "SogoSoraSoyoSundSunuSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTelu" + + "TengTfngTglgThaaThaiTibtTirhTnsaTotoUgarVaiiVispVithWaraWchoWoleXpeoXsux" + + "YeziYiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" + +// suppressScript is an index from langID to the dominant script for that language, +// if it exists. If a script is given, it should be suppressed from the language tag. +// Size: 1330 bytes, 1330 elements +var suppressScript = [1330]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 40 - 7F + 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, + // Entry 80 - BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry C0 - FF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 100 - 13F + 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xed, 0x00, 0x00, 0x00, 0x00, 0xef, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x34, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x5b, 0x00, + // Entry 140 - 17F + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 180 - 1BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x35, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x22, 0x00, + // Entry 1C0 - 1FF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x5b, 0x00, 0x5b, 0x5b, 0x00, 0x08, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x5b, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, + // Entry 200 - 23F + 0x49, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x2e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 240 - 27F + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x00, 0x00, 0x4f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x53, 0x00, 0x00, 0x54, 0x00, 0x22, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 280 - 2BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x58, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 2C0 - 2FF + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x22, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, + // Entry 300 - 33F + 0x00, 0x00, 0x00, 0x00, 0x6f, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5b, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x76, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + // Entry 340 - 37F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x5b, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x7e, 0x5b, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 380 - 3BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x83, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x36, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, + // Entry 3C0 - 3FF + 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 400 - 43F + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xd6, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + // Entry 440 - 47F + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xe6, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xe9, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xee, 0x00, 0x00, 0x00, 0x2c, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + // Entry 480 - 4BF + 0x5b, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 4C0 - 4FF + 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 500 - 53F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, +} + +const ( + _001 = 1 + _419 = 31 + _BR = 65 + _CA = 73 + _ES = 111 + _GB = 124 + _MD = 189 + _PT = 239 + _UK = 307 + _US = 310 + _ZZ = 358 + _XA = 324 + _XC = 326 + _XK = 334 +) + +// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID +// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for +// the UN.M49 codes used for groups.) +const isoRegionOffset = 32 + +// regionTypes defines the status of a region for various standards. +// Size: 359 bytes, 359 elements +var regionTypes = [359]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x05, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry 40 - 7F + 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x04, 0x06, + 0x04, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x04, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry 80 - BF + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry C0 - FF + 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + // Entry 100 - 13F + 0x05, 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + // Entry 140 - 17F + 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, + 0x06, 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, +} + +// regionISO holds a list of alphabetically sorted 2-letter ISO region codes. +// Each 2-letter codes is followed by two bytes with the following meaning: +// - [A-Z}{2}: the first letter of the 2-letter code plus these two +// letters form the 3-letter ISO code. +// - 0, n: index into altRegionISO3. +const regionISO tag.Index = "" + // Size: 1312 bytes + "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" + + "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" + + "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" + + "CQ CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADO" + + "OMDYHYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSM" + + "FOROFQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQ" + + "NQGRRCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERL" + + "ILSRIMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM" + + "\x00\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSO" + + "LTTULUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNP" + + "MQTQMRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLD" + + "NOORNPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM" + + "\x00\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSS" + + "QTTTQU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLB" + + "SCYCSDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXM" + + "SYYRSZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTT" + + "TOTVUVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVN" + + "NMVUUTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXN" + + "NNXOOOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUG" + + "ZAAFZMMBZRARZWWEZZZZ\xff\xff\xff\xff" + +// altRegionISO3 holds a list of 3-letter region codes that cannot be +// mapped to 2-letter codes using the default algorithm. This is a short list. +const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN" + +// altRegionIDs holds a list of regionIDs the positions of which match those +// of the 3-letter ISO codes in altRegionISO3. +// Size: 22 bytes, 11 elements +var altRegionIDs = [11]uint16{ + 0x0058, 0x0071, 0x0089, 0x00a9, 0x00ab, 0x00ae, 0x00eb, 0x0106, + 0x0122, 0x0160, 0x00dd, +} + +// Size: 80 bytes, 20 elements +var regionOldMap = [20]FromTo{ + 0: {From: 0x44, To: 0xc5}, + 1: {From: 0x59, To: 0xa8}, + 2: {From: 0x60, To: 0x61}, + 3: {From: 0x67, To: 0x3b}, + 4: {From: 0x7a, To: 0x79}, + 5: {From: 0x94, To: 0x37}, + 6: {From: 0xa4, To: 0x134}, + 7: {From: 0xc2, To: 0x134}, + 8: {From: 0xd8, To: 0x140}, + 9: {From: 0xdd, To: 0x2b}, + 10: {From: 0xf0, To: 0x134}, + 11: {From: 0xf3, To: 0xe3}, + 12: {From: 0xfd, To: 0x71}, + 13: {From: 0x104, To: 0x165}, + 14: {From: 0x12b, To: 0x127}, + 15: {From: 0x133, To: 0x7c}, + 16: {From: 0x13b, To: 0x13f}, + 17: {From: 0x142, To: 0x134}, + 18: {From: 0x15e, To: 0x15f}, + 19: {From: 0x164, To: 0x4b}, +} + +// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are +// codes indicating collections of regions. +// Size: 718 bytes, 359 elements +var m49 = [359]int16{ + // Entry 0 - 3F + 0, 1, 2, 3, 5, 9, 11, 13, + 14, 15, 17, 18, 19, 21, 29, 30, + 34, 35, 39, 53, 54, 57, 61, 142, + 143, 145, 150, 151, 154, 155, 202, 419, + 958, 0, 20, 784, 4, 28, 660, 8, + 51, 530, 24, 10, 32, 16, 40, 36, + 533, 248, 31, 70, 52, 50, 56, 854, + 100, 48, 108, 204, 652, 60, 96, 68, + // Entry 40 - 7F + 535, 76, 44, 64, 104, 74, 72, 112, + 84, 124, 166, 180, 140, 178, 756, 384, + 184, 152, 120, 156, 170, 0, 0, 188, + 891, 296, 192, 132, 531, 162, 196, 203, + 278, 276, 0, 262, 208, 212, 214, 204, + 12, 0, 218, 233, 818, 732, 232, 724, + 231, 967, 0, 246, 242, 238, 583, 234, + 0, 250, 249, 266, 826, 308, 268, 254, + // Entry 80 - BF + 831, 288, 292, 304, 270, 324, 312, 226, + 300, 239, 320, 316, 624, 328, 344, 334, + 340, 191, 332, 348, 854, 0, 360, 372, + 376, 833, 356, 86, 368, 364, 352, 380, + 832, 388, 400, 392, 581, 404, 417, 116, + 296, 174, 659, 408, 410, 414, 136, 398, + 418, 422, 662, 438, 144, 430, 426, 440, + 442, 428, 434, 504, 492, 498, 499, 663, + // Entry C0 - FF + 450, 584, 581, 807, 466, 104, 496, 446, + 580, 474, 478, 500, 470, 480, 462, 454, + 484, 458, 508, 516, 540, 562, 574, 566, + 548, 558, 528, 578, 524, 10, 520, 536, + 570, 554, 512, 591, 0, 604, 258, 598, + 608, 586, 616, 666, 612, 630, 275, 620, + 581, 585, 600, 591, 634, 959, 960, 961, + 962, 963, 964, 965, 966, 967, 968, 969, + // Entry 100 - 13F + 970, 971, 972, 638, 716, 642, 688, 643, + 646, 682, 90, 690, 729, 752, 702, 654, + 705, 744, 703, 694, 674, 686, 706, 740, + 728, 678, 810, 222, 534, 760, 748, 0, + 796, 148, 260, 768, 764, 762, 772, 626, + 795, 788, 776, 626, 792, 780, 798, 158, + 834, 804, 800, 826, 581, 0, 840, 858, + 860, 336, 670, 704, 862, 92, 850, 704, + // Entry 140 - 17F + 548, 876, 581, 882, 973, 974, 975, 976, + 977, 978, 979, 980, 981, 982, 983, 984, + 985, 986, 987, 988, 989, 990, 991, 992, + 993, 994, 995, 996, 997, 998, 720, 887, + 175, 891, 710, 894, 180, 716, 999, +} + +// m49Index gives indexes into fromM49 based on the three most significant bits +// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in +// +// fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]] +// +// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code. +// The region code is stored in the 9 lsb of the indexed value. +// Size: 18 bytes, 9 elements +var m49Index = [9]int16{ + 0, 59, 108, 143, 181, 220, 259, 291, + 333, +} + +// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details. +// Size: 666 bytes, 333 elements +var fromM49 = [333]uint16{ + // Entry 0 - 3F + 0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b, + 0x1606, 0x1868, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, + 0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32, + 0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039, + 0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d, + 0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848, + 0xac9b, 0xb50a, 0xb93d, 0xc03e, 0xc838, 0xd0c5, 0xd83a, 0xe047, + 0xe8a7, 0xf052, 0xf849, 0x085b, 0x10ae, 0x184c, 0x1c17, 0x1e18, + // Entry 40 - 7F + 0x20b4, 0x2219, 0x2921, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, + 0x3853, 0x3d2f, 0x445d, 0x4c4a, 0x5454, 0x5ca9, 0x5f60, 0x644d, + 0x684b, 0x7050, 0x7857, 0x7e91, 0x805a, 0x885e, 0x941e, 0x965f, + 0x983b, 0xa064, 0xa865, 0xac66, 0xb46a, 0xbd1b, 0xc487, 0xcc70, + 0xce70, 0xd06e, 0xd26b, 0xd477, 0xdc75, 0xde89, 0xe474, 0xec73, + 0xf031, 0xf27a, 0xf479, 0xfc7f, 0x04e6, 0x0922, 0x0c63, 0x147b, + 0x187e, 0x1c84, 0x26ee, 0x2861, 0x2c60, 0x3061, 0x4081, 0x4882, + 0x50a8, 0x5888, 0x6083, 0x687d, 0x7086, 0x788b, 0x808a, 0x8885, + // Entry 80 - BF + 0x908d, 0x9892, 0x9c8f, 0xa139, 0xa890, 0xb08e, 0xb893, 0xc09e, + 0xc89a, 0xd096, 0xd89d, 0xe09c, 0xe897, 0xf098, 0xf89f, 0x004f, + 0x08a1, 0x10a3, 0x1caf, 0x20a2, 0x28a5, 0x30ab, 0x34ac, 0x3cad, + 0x42a6, 0x44b0, 0x461f, 0x4cb1, 0x54b6, 0x58b9, 0x5cb5, 0x64ba, + 0x6cb3, 0x70b7, 0x74b8, 0x7cc7, 0x84c0, 0x8ccf, 0x94d1, 0x9cce, + 0xa4c4, 0xaccc, 0xb4c9, 0xbcca, 0xc0cd, 0xc8d0, 0xd8bc, 0xe0c6, + 0xe4bd, 0xe6be, 0xe8cb, 0xf0bb, 0xf8d2, 0x00e2, 0x08d3, 0x10de, + 0x18dc, 0x20da, 0x2429, 0x265c, 0x2a30, 0x2d1c, 0x2e40, 0x30df, + // Entry C0 - FF + 0x38d4, 0x4940, 0x54e1, 0x5cd9, 0x64d5, 0x6cd7, 0x74e0, 0x7cd6, + 0x84db, 0x88c8, 0x8b34, 0x8e76, 0x90c1, 0x92f1, 0x94e9, 0x9ee3, + 0xace7, 0xb0f2, 0xb8e5, 0xc0e8, 0xc8ec, 0xd0ea, 0xd8ef, 0xe08c, + 0xe527, 0xeced, 0xf4f4, 0xfd03, 0x0505, 0x0707, 0x0d08, 0x183c, + 0x1d0f, 0x26aa, 0x2826, 0x2cb2, 0x2ebf, 0x34eb, 0x3d3a, 0x4514, + 0x4d19, 0x5509, 0x5d15, 0x6106, 0x650b, 0x6d13, 0x7d0e, 0x7f12, + 0x813f, 0x8310, 0x8516, 0x8d62, 0x9965, 0xa15e, 0xa86f, 0xb118, + 0xb30c, 0xb86d, 0xc10c, 0xc917, 0xd111, 0xd91e, 0xe10d, 0xe84e, + // Entry 100 - 13F + 0xf11d, 0xf525, 0xf924, 0x0123, 0x0926, 0x112a, 0x192d, 0x2023, + 0x2929, 0x312c, 0x3728, 0x3920, 0x3d2e, 0x4132, 0x4931, 0x4ec3, + 0x551a, 0x646c, 0x747c, 0x7e80, 0x80a0, 0x8299, 0x8530, 0x9136, + 0xa53e, 0xac37, 0xb537, 0xb938, 0xbd3c, 0xd941, 0xe543, 0xed5f, + 0xef5f, 0xf658, 0xfd63, 0x7c20, 0x7ef5, 0x80f6, 0x82f7, 0x84f8, + 0x86f9, 0x88fa, 0x8afb, 0x8cfc, 0x8e71, 0x90fe, 0x92ff, 0x9500, + 0x9701, 0x9902, 0x9b44, 0x9d45, 0x9f46, 0xa147, 0xa348, 0xa549, + 0xa74a, 0xa94b, 0xab4c, 0xad4d, 0xaf4e, 0xb14f, 0xb350, 0xb551, + // Entry 140 - 17F + 0xb752, 0xb953, 0xbb54, 0xbd55, 0xbf56, 0xc157, 0xc358, 0xc559, + 0xc75a, 0xc95b, 0xcb5c, 0xcd5d, 0xcf66, +} + +// Size: 2128 bytes +var variantIndex = map[string]uint8{ + "1606nict": 0x0, + "1694acad": 0x1, + "1901": 0x2, + "1959acad": 0x3, + "1994": 0x67, + "1996": 0x4, + "abl1943": 0x5, + "akuapem": 0x6, + "alalc97": 0x69, + "aluku": 0x7, + "ao1990": 0x8, + "aranes": 0x9, + "arevela": 0xa, + "arevmda": 0xb, + "arkaika": 0xc, + "asante": 0xd, + "auvern": 0xe, + "baku1926": 0xf, + "balanka": 0x10, + "barla": 0x11, + "basiceng": 0x12, + "bauddha": 0x13, + "bciav": 0x14, + "bcizbl": 0x15, + "biscayan": 0x16, + "biske": 0x62, + "bohoric": 0x17, + "boont": 0x18, + "bornholm": 0x19, + "cisaup": 0x1a, + "colb1945": 0x1b, + "cornu": 0x1c, + "creiss": 0x1d, + "dajnko": 0x1e, + "ekavsk": 0x1f, + "emodeng": 0x20, + "fonipa": 0x6a, + "fonkirsh": 0x6b, + "fonnapa": 0x6c, + "fonupa": 0x6d, + "fonxsamp": 0x6e, + "gallo": 0x21, + "gascon": 0x22, + "grclass": 0x23, + "grital": 0x24, + "grmistr": 0x25, + "hepburn": 0x26, + "heploc": 0x68, + "hognorsk": 0x27, + "hsistemo": 0x28, + "ijekavsk": 0x29, + "itihasa": 0x2a, + "ivanchov": 0x2b, + "jauer": 0x2c, + "jyutping": 0x2d, + "kkcor": 0x2e, + "kociewie": 0x2f, + "kscor": 0x30, + "laukika": 0x31, + "lemosin": 0x32, + "lengadoc": 0x33, + "lipaw": 0x63, + "ltg1929": 0x34, + "ltg2007": 0x35, + "luna1918": 0x36, + "metelko": 0x37, + "monoton": 0x38, + "ndyuka": 0x39, + "nedis": 0x3a, + "newfound": 0x3b, + "nicard": 0x3c, + "njiva": 0x64, + "nulik": 0x3d, + "osojs": 0x65, + "oxendict": 0x3e, + "pahawh2": 0x3f, + "pahawh3": 0x40, + "pahawh4": 0x41, + "pamaka": 0x42, + "peano": 0x43, + "petr1708": 0x44, + "pinyin": 0x45, + "polyton": 0x46, + "provenc": 0x47, + "puter": 0x48, + "rigik": 0x49, + "rozaj": 0x4a, + "rumgr": 0x4b, + "scotland": 0x4c, + "scouse": 0x4d, + "simple": 0x6f, + "solba": 0x66, + "sotav": 0x4e, + "spanglis": 0x4f, + "surmiran": 0x50, + "sursilv": 0x51, + "sutsilv": 0x52, + "synnejyl": 0x53, + "tarask": 0x54, + "tongyong": 0x55, + "tunumiit": 0x56, + "uccor": 0x57, + "ucrcor": 0x58, + "ulster": 0x59, + "unifon": 0x5a, + "vaidika": 0x5b, + "valencia": 0x5c, + "vallader": 0x5d, + "vecdruka": 0x5e, + "vivaraup": 0x5f, + "wadegile": 0x60, + "xsistemo": 0x61, +} + +// variantNumSpecialized is the number of specialized variants in variants. +const variantNumSpecialized = 105 + +// nRegionGroups is the number of region groups. +const nRegionGroups = 33 + +type likelyLangRegion struct { + lang uint16 + region uint16 +} + +// likelyScript is a lookup table, indexed by scriptID, for the most likely +// languages and regions given a script. +// Size: 1052 bytes, 263 elements +var likelyScript = [263]likelyLangRegion{ + 1: {lang: 0x14e, region: 0x85}, + 3: {lang: 0x2a2, region: 0x107}, + 4: {lang: 0x1f, region: 0x9a}, + 5: {lang: 0x3a, region: 0x6c}, + 7: {lang: 0x3b, region: 0x9d}, + 8: {lang: 0x1d7, region: 0x28}, + 9: {lang: 0x13, region: 0x9d}, + 10: {lang: 0x5b, region: 0x96}, + 11: {lang: 0x60, region: 0x52}, + 12: {lang: 0xb9, region: 0xb5}, + 13: {lang: 0x63, region: 0x96}, + 14: {lang: 0xa5, region: 0x35}, + 15: {lang: 0x3e9, region: 0x9a}, + 17: {lang: 0x529, region: 0x12f}, + 18: {lang: 0x3b1, region: 0x9a}, + 19: {lang: 0x15e, region: 0x79}, + 20: {lang: 0xc2, region: 0x96}, + 21: {lang: 0x9d, region: 0xe8}, + 22: {lang: 0xdb, region: 0x35}, + 23: {lang: 0xf3, region: 0x49}, + 24: {lang: 0x4f0, region: 0x12c}, + 25: {lang: 0xe7, region: 0x13f}, + 26: {lang: 0xe5, region: 0x136}, + 29: {lang: 0xf1, region: 0x6c}, + 31: {lang: 0x1a0, region: 0x5e}, + 32: {lang: 0x3e2, region: 0x107}, + 34: {lang: 0x1be, region: 0x9a}, + 38: {lang: 0x15e, region: 0x79}, + 41: {lang: 0x133, region: 0x6c}, + 42: {lang: 0x431, region: 0x27}, + 44: {lang: 0x27, region: 0x70}, + 46: {lang: 0x210, region: 0x7e}, + 47: {lang: 0xfe, region: 0x38}, + 49: {lang: 0x19b, region: 0x9a}, + 50: {lang: 0x19e, region: 0x131}, + 51: {lang: 0x3e9, region: 0x9a}, + 52: {lang: 0x136, region: 0x88}, + 53: {lang: 0x1a4, region: 0x9a}, + 54: {lang: 0x39d, region: 0x9a}, + 55: {lang: 0x529, region: 0x12f}, + 56: {lang: 0x254, region: 0xac}, + 57: {lang: 0x529, region: 0x53}, + 58: {lang: 0x1cb, region: 0xe8}, + 59: {lang: 0x529, region: 0x53}, + 60: {lang: 0x529, region: 0x12f}, + 61: {lang: 0x2fd, region: 0x9c}, + 62: {lang: 0x1bc, region: 0x98}, + 63: {lang: 0x200, region: 0xa3}, + 64: {lang: 0x1c5, region: 0x12c}, + 65: {lang: 0x1ca, region: 0xb0}, + 68: {lang: 0x1d5, region: 0x93}, + 70: {lang: 0x142, region: 0x9f}, + 71: {lang: 0x254, region: 0xac}, + 72: {lang: 0x20e, region: 0x96}, + 73: {lang: 0x200, region: 0xa3}, + 75: {lang: 0x135, region: 0xc5}, + 76: {lang: 0x200, region: 0xa3}, + 78: {lang: 0x3bb, region: 0xe9}, + 79: {lang: 0x24a, region: 0xa7}, + 80: {lang: 0x3fa, region: 0x9a}, + 83: {lang: 0x251, region: 0x9a}, + 84: {lang: 0x254, region: 0xac}, + 86: {lang: 0x88, region: 0x9a}, + 87: {lang: 0x370, region: 0x124}, + 88: {lang: 0x2b8, region: 0xb0}, + 93: {lang: 0x29f, region: 0x9a}, + 94: {lang: 0x2a8, region: 0x9a}, + 95: {lang: 0x28f, region: 0x88}, + 96: {lang: 0x1a0, region: 0x88}, + 97: {lang: 0x2ac, region: 0x53}, + 99: {lang: 0x4f4, region: 0x12c}, + 100: {lang: 0x4f5, region: 0x12c}, + 101: {lang: 0x1be, region: 0x9a}, + 103: {lang: 0x337, region: 0x9d}, + 104: {lang: 0x4f7, region: 0x53}, + 105: {lang: 0xa9, region: 0x53}, + 108: {lang: 0x2e8, region: 0x113}, + 109: {lang: 0x4f8, region: 0x10c}, + 110: {lang: 0x4f8, region: 0x10c}, + 111: {lang: 0x304, region: 0x9a}, + 112: {lang: 0x31b, region: 0x9a}, + 113: {lang: 0x30b, region: 0x53}, + 115: {lang: 0x31e, region: 0x35}, + 116: {lang: 0x30e, region: 0x9a}, + 117: {lang: 0x414, region: 0xe9}, + 118: {lang: 0x331, region: 0xc5}, + 121: {lang: 0x4f9, region: 0x109}, + 122: {lang: 0x3b, region: 0xa2}, + 123: {lang: 0x353, region: 0xdc}, + 126: {lang: 0x2d0, region: 0x85}, + 127: {lang: 0x52a, region: 0x53}, + 128: {lang: 0x403, region: 0x97}, + 129: {lang: 0x3ee, region: 0x9a}, + 130: {lang: 0x39b, region: 0xc6}, + 131: {lang: 0x395, region: 0x9a}, + 132: {lang: 0x399, region: 0x136}, + 133: {lang: 0x429, region: 0x116}, + 135: {lang: 0x3b, region: 0x11d}, + 136: {lang: 0xfd, region: 0xc5}, + 139: {lang: 0x27d, region: 0x107}, + 140: {lang: 0x2c9, region: 0x53}, + 141: {lang: 0x39f, region: 0x9d}, + 142: {lang: 0x39f, region: 0x53}, + 144: {lang: 0x3ad, region: 0xb1}, + 146: {lang: 0x1c6, region: 0x53}, + 147: {lang: 0x4fd, region: 0x9d}, + 200: {lang: 0x3cb, region: 0x96}, + 203: {lang: 0x372, region: 0x10d}, + 204: {lang: 0x420, region: 0x98}, + 206: {lang: 0x4ff, region: 0x15f}, + 207: {lang: 0x3f0, region: 0x9a}, + 208: {lang: 0x45, region: 0x136}, + 209: {lang: 0x139, region: 0x7c}, + 210: {lang: 0x3e9, region: 0x9a}, + 212: {lang: 0x3e9, region: 0x9a}, + 213: {lang: 0x3fa, region: 0x9a}, + 214: {lang: 0x40c, region: 0xb4}, + 217: {lang: 0x433, region: 0x9a}, + 218: {lang: 0xef, region: 0xc6}, + 219: {lang: 0x43e, region: 0x96}, + 221: {lang: 0x44d, region: 0x35}, + 222: {lang: 0x44e, region: 0x9c}, + 226: {lang: 0x45a, region: 0xe8}, + 227: {lang: 0x11a, region: 0x9a}, + 228: {lang: 0x45e, region: 0x53}, + 229: {lang: 0x232, region: 0x53}, + 230: {lang: 0x450, region: 0x9a}, + 231: {lang: 0x4a5, region: 0x53}, + 232: {lang: 0x9f, region: 0x13f}, + 233: {lang: 0x461, region: 0x9a}, + 235: {lang: 0x528, region: 0xbb}, + 236: {lang: 0x153, region: 0xe8}, + 237: {lang: 0x128, region: 0xce}, + 238: {lang: 0x46b, region: 0x124}, + 239: {lang: 0xa9, region: 0x53}, + 240: {lang: 0x2ce, region: 0x9a}, + 243: {lang: 0x4ad, region: 0x11d}, + 244: {lang: 0x4be, region: 0xb5}, + 247: {lang: 0x1ce, region: 0x9a}, + 250: {lang: 0x3a9, region: 0x9d}, + 251: {lang: 0x22, region: 0x9c}, + 253: {lang: 0x1ea, region: 0x53}, + 254: {lang: 0xef, region: 0xc6}, +} + +type likelyScriptRegion struct { + region uint16 + script uint16 + flags uint8 +} + +// likelyLang is a lookup table, indexed by langID, for the most likely +// scripts and regions given incomplete information. If more entries exist for a +// given language, region and script are the index and size respectively +// of the list in likelyLangList. +// Size: 7980 bytes, 1330 elements +var likelyLang = [1330]likelyScriptRegion{ + 0: {region: 0x136, script: 0x5b, flags: 0x0}, + 1: {region: 0x70, script: 0x5b, flags: 0x0}, + 2: {region: 0x166, script: 0x5b, flags: 0x0}, + 3: {region: 0x166, script: 0x5b, flags: 0x0}, + 4: {region: 0x166, script: 0x5b, flags: 0x0}, + 5: {region: 0x7e, script: 0x20, flags: 0x0}, + 6: {region: 0x166, script: 0x5b, flags: 0x0}, + 7: {region: 0x166, script: 0x20, flags: 0x0}, + 8: {region: 0x81, script: 0x5b, flags: 0x0}, + 9: {region: 0x166, script: 0x5b, flags: 0x0}, + 10: {region: 0x166, script: 0x5b, flags: 0x0}, + 11: {region: 0x166, script: 0x5b, flags: 0x0}, + 12: {region: 0x96, script: 0x5b, flags: 0x0}, + 13: {region: 0x132, script: 0x5b, flags: 0x0}, + 14: {region: 0x81, script: 0x5b, flags: 0x0}, + 15: {region: 0x166, script: 0x5b, flags: 0x0}, + 16: {region: 0x166, script: 0x5b, flags: 0x0}, + 17: {region: 0x107, script: 0x20, flags: 0x0}, + 18: {region: 0x166, script: 0x5b, flags: 0x0}, + 19: {region: 0x9d, script: 0x9, flags: 0x0}, + 20: {region: 0x129, script: 0x5, flags: 0x0}, + 21: {region: 0x166, script: 0x5b, flags: 0x0}, + 22: {region: 0x162, script: 0x5b, flags: 0x0}, + 23: {region: 0x166, script: 0x5b, flags: 0x0}, + 24: {region: 0x166, script: 0x5b, flags: 0x0}, + 25: {region: 0x166, script: 0x5b, flags: 0x0}, + 26: {region: 0x166, script: 0x5b, flags: 0x0}, + 27: {region: 0x166, script: 0x5b, flags: 0x0}, + 28: {region: 0x52, script: 0x5b, flags: 0x0}, + 29: {region: 0x166, script: 0x5b, flags: 0x0}, + 30: {region: 0x166, script: 0x5b, flags: 0x0}, + 31: {region: 0x9a, script: 0x4, flags: 0x0}, + 32: {region: 0x166, script: 0x5b, flags: 0x0}, + 33: {region: 0x81, script: 0x5b, flags: 0x0}, + 34: {region: 0x9c, script: 0xfb, flags: 0x0}, + 35: {region: 0x166, script: 0x5b, flags: 0x0}, + 36: {region: 0x166, script: 0x5b, flags: 0x0}, + 37: {region: 0x14e, script: 0x5b, flags: 0x0}, + 38: {region: 0x107, script: 0x20, flags: 0x0}, + 39: {region: 0x70, script: 0x2c, flags: 0x0}, + 40: {region: 0x166, script: 0x5b, flags: 0x0}, + 41: {region: 0x166, script: 0x5b, flags: 0x0}, + 42: {region: 0xd7, script: 0x5b, flags: 0x0}, + 43: {region: 0x166, script: 0x5b, flags: 0x0}, + 45: {region: 0x166, script: 0x5b, flags: 0x0}, + 46: {region: 0x166, script: 0x5b, flags: 0x0}, + 47: {region: 0x166, script: 0x5b, flags: 0x0}, + 48: {region: 0x166, script: 0x5b, flags: 0x0}, + 49: {region: 0x166, script: 0x5b, flags: 0x0}, + 50: {region: 0x166, script: 0x5b, flags: 0x0}, + 51: {region: 0x96, script: 0x5b, flags: 0x0}, + 52: {region: 0x166, script: 0x5, flags: 0x0}, + 53: {region: 0x123, script: 0x5, flags: 0x0}, + 54: {region: 0x166, script: 0x5b, flags: 0x0}, + 55: {region: 0x166, script: 0x5b, flags: 0x0}, + 56: {region: 0x166, script: 0x5b, flags: 0x0}, + 57: {region: 0x166, script: 0x5b, flags: 0x0}, + 58: {region: 0x6c, script: 0x5, flags: 0x0}, + 59: {region: 0x0, script: 0x3, flags: 0x1}, + 60: {region: 0x166, script: 0x5b, flags: 0x0}, + 61: {region: 0x51, script: 0x5b, flags: 0x0}, + 62: {region: 0x3f, script: 0x5b, flags: 0x0}, + 63: {region: 0x68, script: 0x5, flags: 0x0}, + 65: {region: 0xbb, script: 0x5, flags: 0x0}, + 66: {region: 0x6c, script: 0x5, flags: 0x0}, + 67: {region: 0x9a, script: 0xe, flags: 0x0}, + 68: {region: 0x130, script: 0x5b, flags: 0x0}, + 69: {region: 0x136, script: 0xd0, flags: 0x0}, + 70: {region: 0x166, script: 0x5b, flags: 0x0}, + 71: {region: 0x166, script: 0x5b, flags: 0x0}, + 72: {region: 0x6f, script: 0x5b, flags: 0x0}, + 73: {region: 0x166, script: 0x5b, flags: 0x0}, + 74: {region: 0x166, script: 0x5b, flags: 0x0}, + 75: {region: 0x49, script: 0x5b, flags: 0x0}, + 76: {region: 0x166, script: 0x5b, flags: 0x0}, + 77: {region: 0x107, script: 0x20, flags: 0x0}, + 78: {region: 0x166, script: 0x5, flags: 0x0}, + 79: {region: 0x166, script: 0x5b, flags: 0x0}, + 80: {region: 0x166, script: 0x5b, flags: 0x0}, + 81: {region: 0x166, script: 0x5b, flags: 0x0}, + 82: {region: 0x9a, script: 0x22, flags: 0x0}, + 83: {region: 0x166, script: 0x5b, flags: 0x0}, + 84: {region: 0x166, script: 0x5b, flags: 0x0}, + 85: {region: 0x166, script: 0x5b, flags: 0x0}, + 86: {region: 0x3f, script: 0x5b, flags: 0x0}, + 87: {region: 0x166, script: 0x5b, flags: 0x0}, + 88: {region: 0x3, script: 0x5, flags: 0x1}, + 89: {region: 0x107, script: 0x20, flags: 0x0}, + 90: {region: 0xe9, script: 0x5, flags: 0x0}, + 91: {region: 0x96, script: 0x5b, flags: 0x0}, + 92: {region: 0xdc, script: 0x22, flags: 0x0}, + 93: {region: 0x2e, script: 0x5b, flags: 0x0}, + 94: {region: 0x52, script: 0x5b, flags: 0x0}, + 95: {region: 0x166, script: 0x5b, flags: 0x0}, + 96: {region: 0x52, script: 0xb, flags: 0x0}, + 97: {region: 0x166, script: 0x5b, flags: 0x0}, + 98: {region: 0x166, script: 0x5b, flags: 0x0}, + 99: {region: 0x96, script: 0x5b, flags: 0x0}, + 100: {region: 0x166, script: 0x5b, flags: 0x0}, + 101: {region: 0x52, script: 0x5b, flags: 0x0}, + 102: {region: 0x166, script: 0x5b, flags: 0x0}, + 103: {region: 0x166, script: 0x5b, flags: 0x0}, + 104: {region: 0x166, script: 0x5b, flags: 0x0}, + 105: {region: 0x166, script: 0x5b, flags: 0x0}, + 106: {region: 0x4f, script: 0x5b, flags: 0x0}, + 107: {region: 0x166, script: 0x5b, flags: 0x0}, + 108: {region: 0x166, script: 0x5b, flags: 0x0}, + 109: {region: 0x166, script: 0x5b, flags: 0x0}, + 110: {region: 0x166, script: 0x2c, flags: 0x0}, + 111: {region: 0x166, script: 0x5b, flags: 0x0}, + 112: {region: 0x166, script: 0x5b, flags: 0x0}, + 113: {region: 0x47, script: 0x20, flags: 0x0}, + 114: {region: 0x166, script: 0x5b, flags: 0x0}, + 115: {region: 0x166, script: 0x5b, flags: 0x0}, + 116: {region: 0x10c, script: 0x5, flags: 0x0}, + 117: {region: 0x163, script: 0x5b, flags: 0x0}, + 118: {region: 0x166, script: 0x5b, flags: 0x0}, + 119: {region: 0x96, script: 0x5b, flags: 0x0}, + 120: {region: 0x166, script: 0x5b, flags: 0x0}, + 121: {region: 0x130, script: 0x5b, flags: 0x0}, + 122: {region: 0x52, script: 0x5b, flags: 0x0}, + 123: {region: 0x9a, script: 0xe6, flags: 0x0}, + 124: {region: 0xe9, script: 0x5, flags: 0x0}, + 125: {region: 0x9a, script: 0x22, flags: 0x0}, + 126: {region: 0x38, script: 0x20, flags: 0x0}, + 127: {region: 0x9a, script: 0x22, flags: 0x0}, + 128: {region: 0xe9, script: 0x5, flags: 0x0}, + 129: {region: 0x12c, script: 0x34, flags: 0x0}, + 131: {region: 0x9a, script: 0x22, flags: 0x0}, + 132: {region: 0x166, script: 0x5b, flags: 0x0}, + 133: {region: 0x9a, script: 0x22, flags: 0x0}, + 134: {region: 0xe8, script: 0x5b, flags: 0x0}, + 135: {region: 0x166, script: 0x5b, flags: 0x0}, + 136: {region: 0x9a, script: 0x22, flags: 0x0}, + 137: {region: 0x166, script: 0x5b, flags: 0x0}, + 138: {region: 0x140, script: 0x5b, flags: 0x0}, + 139: {region: 0x166, script: 0x5b, flags: 0x0}, + 140: {region: 0x166, script: 0x5b, flags: 0x0}, + 141: {region: 0xe8, script: 0x5b, flags: 0x0}, + 142: {region: 0x166, script: 0x5b, flags: 0x0}, + 143: {region: 0xd7, script: 0x5b, flags: 0x0}, + 144: {region: 0x166, script: 0x5b, flags: 0x0}, + 145: {region: 0x166, script: 0x5b, flags: 0x0}, + 146: {region: 0x166, script: 0x5b, flags: 0x0}, + 147: {region: 0x166, script: 0x2c, flags: 0x0}, + 148: {region: 0x9a, script: 0x22, flags: 0x0}, + 149: {region: 0x96, script: 0x5b, flags: 0x0}, + 150: {region: 0x166, script: 0x5b, flags: 0x0}, + 151: {region: 0x166, script: 0x5b, flags: 0x0}, + 152: {region: 0x115, script: 0x5b, flags: 0x0}, + 153: {region: 0x166, script: 0x5b, flags: 0x0}, + 154: {region: 0x166, script: 0x5b, flags: 0x0}, + 155: {region: 0x52, script: 0x5b, flags: 0x0}, + 156: {region: 0x166, script: 0x5b, flags: 0x0}, + 157: {region: 0xe8, script: 0x5b, flags: 0x0}, + 158: {region: 0x166, script: 0x5b, flags: 0x0}, + 159: {region: 0x13f, script: 0xe8, flags: 0x0}, + 160: {region: 0xc4, script: 0x5b, flags: 0x0}, + 161: {region: 0x166, script: 0x5b, flags: 0x0}, + 162: {region: 0x166, script: 0x5b, flags: 0x0}, + 163: {region: 0xc4, script: 0x5b, flags: 0x0}, + 164: {region: 0x166, script: 0x5b, flags: 0x0}, + 165: {region: 0x35, script: 0xe, flags: 0x0}, + 166: {region: 0x166, script: 0x5b, flags: 0x0}, + 167: {region: 0x166, script: 0x5b, flags: 0x0}, + 168: {region: 0x166, script: 0x5b, flags: 0x0}, + 169: {region: 0x53, script: 0xef, flags: 0x0}, + 170: {region: 0x166, script: 0x5b, flags: 0x0}, + 171: {region: 0x166, script: 0x5b, flags: 0x0}, + 172: {region: 0x166, script: 0x5b, flags: 0x0}, + 173: {region: 0x9a, script: 0xe, flags: 0x0}, + 174: {region: 0x166, script: 0x5b, flags: 0x0}, + 175: {region: 0x9d, script: 0x5, flags: 0x0}, + 176: {region: 0x166, script: 0x5b, flags: 0x0}, + 177: {region: 0x4f, script: 0x5b, flags: 0x0}, + 178: {region: 0x79, script: 0x5b, flags: 0x0}, + 179: {region: 0x9a, script: 0x22, flags: 0x0}, + 180: {region: 0xe9, script: 0x5, flags: 0x0}, + 181: {region: 0x9a, script: 0x22, flags: 0x0}, + 182: {region: 0x166, script: 0x5b, flags: 0x0}, + 183: {region: 0x33, script: 0x5b, flags: 0x0}, + 184: {region: 0x166, script: 0x5b, flags: 0x0}, + 185: {region: 0xb5, script: 0xc, flags: 0x0}, + 186: {region: 0x52, script: 0x5b, flags: 0x0}, + 187: {region: 0x166, script: 0x2c, flags: 0x0}, + 188: {region: 0xe8, script: 0x5b, flags: 0x0}, + 189: {region: 0x166, script: 0x5b, flags: 0x0}, + 190: {region: 0xe9, script: 0x22, flags: 0x0}, + 191: {region: 0x107, script: 0x20, flags: 0x0}, + 192: {region: 0x160, script: 0x5b, flags: 0x0}, + 193: {region: 0x166, script: 0x5b, flags: 0x0}, + 194: {region: 0x96, script: 0x5b, flags: 0x0}, + 195: {region: 0x166, script: 0x5b, flags: 0x0}, + 196: {region: 0x52, script: 0x5b, flags: 0x0}, + 197: {region: 0x166, script: 0x5b, flags: 0x0}, + 198: {region: 0x166, script: 0x5b, flags: 0x0}, + 199: {region: 0x166, script: 0x5b, flags: 0x0}, + 200: {region: 0x87, script: 0x5b, flags: 0x0}, + 201: {region: 0x166, script: 0x5b, flags: 0x0}, + 202: {region: 0x166, script: 0x5b, flags: 0x0}, + 203: {region: 0x166, script: 0x5b, flags: 0x0}, + 204: {region: 0x166, script: 0x5b, flags: 0x0}, + 205: {region: 0x6e, script: 0x2c, flags: 0x0}, + 206: {region: 0x166, script: 0x5b, flags: 0x0}, + 207: {region: 0x166, script: 0x5b, flags: 0x0}, + 208: {region: 0x52, script: 0x5b, flags: 0x0}, + 209: {region: 0x166, script: 0x5b, flags: 0x0}, + 210: {region: 0x166, script: 0x5b, flags: 0x0}, + 211: {region: 0xc4, script: 0x5b, flags: 0x0}, + 212: {region: 0x166, script: 0x5b, flags: 0x0}, + 213: {region: 0x166, script: 0x5b, flags: 0x0}, + 214: {region: 0x166, script: 0x5b, flags: 0x0}, + 215: {region: 0x6f, script: 0x5b, flags: 0x0}, + 216: {region: 0x166, script: 0x5b, flags: 0x0}, + 217: {region: 0x166, script: 0x5b, flags: 0x0}, + 218: {region: 0xd7, script: 0x5b, flags: 0x0}, + 219: {region: 0x35, script: 0x16, flags: 0x0}, + 220: {region: 0x107, script: 0x20, flags: 0x0}, + 221: {region: 0xe8, script: 0x5b, flags: 0x0}, + 222: {region: 0x166, script: 0x5b, flags: 0x0}, + 223: {region: 0x132, script: 0x5b, flags: 0x0}, + 224: {region: 0x8b, script: 0x5b, flags: 0x0}, + 225: {region: 0x76, script: 0x5b, flags: 0x0}, + 226: {region: 0x107, script: 0x20, flags: 0x0}, + 227: {region: 0x136, script: 0x5b, flags: 0x0}, + 228: {region: 0x49, script: 0x5b, flags: 0x0}, + 229: {region: 0x136, script: 0x1a, flags: 0x0}, + 230: {region: 0xa7, script: 0x5, flags: 0x0}, + 231: {region: 0x13f, script: 0x19, flags: 0x0}, + 232: {region: 0x166, script: 0x5b, flags: 0x0}, + 233: {region: 0x9c, script: 0x5, flags: 0x0}, + 234: {region: 0x166, script: 0x5b, flags: 0x0}, + 235: {region: 0x166, script: 0x5b, flags: 0x0}, + 236: {region: 0x166, script: 0x5b, flags: 0x0}, + 237: {region: 0x166, script: 0x5b, flags: 0x0}, + 238: {region: 0x166, script: 0x5b, flags: 0x0}, + 239: {region: 0xc6, script: 0xda, flags: 0x0}, + 240: {region: 0x79, script: 0x5b, flags: 0x0}, + 241: {region: 0x6c, script: 0x1d, flags: 0x0}, + 242: {region: 0xe8, script: 0x5b, flags: 0x0}, + 243: {region: 0x49, script: 0x17, flags: 0x0}, + 244: {region: 0x131, script: 0x20, flags: 0x0}, + 245: {region: 0x49, script: 0x17, flags: 0x0}, + 246: {region: 0x49, script: 0x17, flags: 0x0}, + 247: {region: 0x49, script: 0x17, flags: 0x0}, + 248: {region: 0x49, script: 0x17, flags: 0x0}, + 249: {region: 0x10b, script: 0x5b, flags: 0x0}, + 250: {region: 0x5f, script: 0x5b, flags: 0x0}, + 251: {region: 0xea, script: 0x5b, flags: 0x0}, + 252: {region: 0x49, script: 0x17, flags: 0x0}, + 253: {region: 0xc5, script: 0x88, flags: 0x0}, + 254: {region: 0x8, script: 0x2, flags: 0x1}, + 255: {region: 0x107, script: 0x20, flags: 0x0}, + 256: {region: 0x7c, script: 0x5b, flags: 0x0}, + 257: {region: 0x64, script: 0x5b, flags: 0x0}, + 258: {region: 0x166, script: 0x5b, flags: 0x0}, + 259: {region: 0x166, script: 0x5b, flags: 0x0}, + 260: {region: 0x166, script: 0x5b, flags: 0x0}, + 261: {region: 0x166, script: 0x5b, flags: 0x0}, + 262: {region: 0x136, script: 0x5b, flags: 0x0}, + 263: {region: 0x107, script: 0x20, flags: 0x0}, + 264: {region: 0xa5, script: 0x5b, flags: 0x0}, + 265: {region: 0x166, script: 0x5b, flags: 0x0}, + 266: {region: 0x166, script: 0x5b, flags: 0x0}, + 267: {region: 0x9a, script: 0x5, flags: 0x0}, + 268: {region: 0x166, script: 0x5b, flags: 0x0}, + 269: {region: 0x61, script: 0x5b, flags: 0x0}, + 270: {region: 0x166, script: 0x5b, flags: 0x0}, + 271: {region: 0x49, script: 0x5b, flags: 0x0}, + 272: {region: 0x166, script: 0x5b, flags: 0x0}, + 273: {region: 0x166, script: 0x5b, flags: 0x0}, + 274: {region: 0x166, script: 0x5b, flags: 0x0}, + 275: {region: 0x166, script: 0x5, flags: 0x0}, + 276: {region: 0x49, script: 0x5b, flags: 0x0}, + 277: {region: 0x166, script: 0x5b, flags: 0x0}, + 278: {region: 0x166, script: 0x5b, flags: 0x0}, + 279: {region: 0xd5, script: 0x5b, flags: 0x0}, + 280: {region: 0x4f, script: 0x5b, flags: 0x0}, + 281: {region: 0x166, script: 0x5b, flags: 0x0}, + 282: {region: 0x9a, script: 0x5, flags: 0x0}, + 283: {region: 0x166, script: 0x5b, flags: 0x0}, + 284: {region: 0x166, script: 0x5b, flags: 0x0}, + 285: {region: 0x166, script: 0x5b, flags: 0x0}, + 286: {region: 0x166, script: 0x2c, flags: 0x0}, + 287: {region: 0x61, script: 0x5b, flags: 0x0}, + 288: {region: 0xc4, script: 0x5b, flags: 0x0}, + 289: {region: 0xd1, script: 0x5b, flags: 0x0}, + 290: {region: 0x166, script: 0x5b, flags: 0x0}, + 291: {region: 0xdc, script: 0x22, flags: 0x0}, + 292: {region: 0x52, script: 0x5b, flags: 0x0}, + 293: {region: 0x166, script: 0x5b, flags: 0x0}, + 294: {region: 0x166, script: 0x5b, flags: 0x0}, + 295: {region: 0x166, script: 0x5b, flags: 0x0}, + 296: {region: 0xce, script: 0xed, flags: 0x0}, + 297: {region: 0x166, script: 0x5b, flags: 0x0}, + 298: {region: 0x166, script: 0x5b, flags: 0x0}, + 299: {region: 0x115, script: 0x5b, flags: 0x0}, + 300: {region: 0x37, script: 0x5b, flags: 0x0}, + 301: {region: 0x43, script: 0xef, flags: 0x0}, + 302: {region: 0x166, script: 0x5b, flags: 0x0}, + 303: {region: 0xa5, script: 0x5b, flags: 0x0}, + 304: {region: 0x81, script: 0x5b, flags: 0x0}, + 305: {region: 0xd7, script: 0x5b, flags: 0x0}, + 306: {region: 0x9f, script: 0x5b, flags: 0x0}, + 307: {region: 0x6c, script: 0x29, flags: 0x0}, + 308: {region: 0x166, script: 0x5b, flags: 0x0}, + 309: {region: 0xc5, script: 0x4b, flags: 0x0}, + 310: {region: 0x88, script: 0x34, flags: 0x0}, + 311: {region: 0x166, script: 0x5b, flags: 0x0}, + 312: {region: 0x166, script: 0x5b, flags: 0x0}, + 313: {region: 0xa, script: 0x2, flags: 0x1}, + 314: {region: 0x166, script: 0x5b, flags: 0x0}, + 315: {region: 0x166, script: 0x5b, flags: 0x0}, + 316: {region: 0x1, script: 0x5b, flags: 0x0}, + 317: {region: 0x166, script: 0x5b, flags: 0x0}, + 318: {region: 0x6f, script: 0x5b, flags: 0x0}, + 319: {region: 0x136, script: 0x5b, flags: 0x0}, + 320: {region: 0x6b, script: 0x5b, flags: 0x0}, + 321: {region: 0x166, script: 0x5b, flags: 0x0}, + 322: {region: 0x9f, script: 0x46, flags: 0x0}, + 323: {region: 0x166, script: 0x5b, flags: 0x0}, + 324: {region: 0x166, script: 0x5b, flags: 0x0}, + 325: {region: 0x6f, script: 0x5b, flags: 0x0}, + 326: {region: 0x52, script: 0x5b, flags: 0x0}, + 327: {region: 0x6f, script: 0x5b, flags: 0x0}, + 328: {region: 0x9d, script: 0x5, flags: 0x0}, + 329: {region: 0x166, script: 0x5b, flags: 0x0}, + 330: {region: 0x166, script: 0x5b, flags: 0x0}, + 331: {region: 0x166, script: 0x5b, flags: 0x0}, + 332: {region: 0x166, script: 0x5b, flags: 0x0}, + 333: {region: 0x87, script: 0x5b, flags: 0x0}, + 334: {region: 0xc, script: 0x2, flags: 0x1}, + 335: {region: 0x166, script: 0x5b, flags: 0x0}, + 336: {region: 0xc4, script: 0x5b, flags: 0x0}, + 337: {region: 0x73, script: 0x5b, flags: 0x0}, + 338: {region: 0x10c, script: 0x5, flags: 0x0}, + 339: {region: 0xe8, script: 0x5b, flags: 0x0}, + 340: {region: 0x10d, script: 0x5b, flags: 0x0}, + 341: {region: 0x74, script: 0x5b, flags: 0x0}, + 342: {region: 0x166, script: 0x5b, flags: 0x0}, + 343: {region: 0x166, script: 0x5b, flags: 0x0}, + 344: {region: 0x77, script: 0x5b, flags: 0x0}, + 345: {region: 0x166, script: 0x5b, flags: 0x0}, + 346: {region: 0x3b, script: 0x5b, flags: 0x0}, + 347: {region: 0x166, script: 0x5b, flags: 0x0}, + 348: {region: 0x166, script: 0x5b, flags: 0x0}, + 349: {region: 0x166, script: 0x5b, flags: 0x0}, + 350: {region: 0x79, script: 0x5b, flags: 0x0}, + 351: {region: 0x136, script: 0x5b, flags: 0x0}, + 352: {region: 0x79, script: 0x5b, flags: 0x0}, + 353: {region: 0x61, script: 0x5b, flags: 0x0}, + 354: {region: 0x61, script: 0x5b, flags: 0x0}, + 355: {region: 0x52, script: 0x5, flags: 0x0}, + 356: {region: 0x141, script: 0x5b, flags: 0x0}, + 357: {region: 0x166, script: 0x5b, flags: 0x0}, + 358: {region: 0x85, script: 0x5b, flags: 0x0}, + 359: {region: 0x166, script: 0x5b, flags: 0x0}, + 360: {region: 0xd5, script: 0x5b, flags: 0x0}, + 361: {region: 0x9f, script: 0x5b, flags: 0x0}, + 362: {region: 0xd7, script: 0x5b, flags: 0x0}, + 363: {region: 0x166, script: 0x5b, flags: 0x0}, + 364: {region: 0x10c, script: 0x5b, flags: 0x0}, + 365: {region: 0xda, script: 0x5b, flags: 0x0}, + 366: {region: 0x97, script: 0x5b, flags: 0x0}, + 367: {region: 0x81, script: 0x5b, flags: 0x0}, + 368: {region: 0x166, script: 0x5b, flags: 0x0}, + 369: {region: 0xbd, script: 0x5b, flags: 0x0}, + 370: {region: 0x166, script: 0x5b, flags: 0x0}, + 371: {region: 0x166, script: 0x5b, flags: 0x0}, + 372: {region: 0x166, script: 0x5b, flags: 0x0}, + 373: {region: 0x53, script: 0x3b, flags: 0x0}, + 374: {region: 0x166, script: 0x5b, flags: 0x0}, + 375: {region: 0x96, script: 0x5b, flags: 0x0}, + 376: {region: 0x166, script: 0x5b, flags: 0x0}, + 377: {region: 0x166, script: 0x5b, flags: 0x0}, + 378: {region: 0x9a, script: 0x22, flags: 0x0}, + 379: {region: 0x166, script: 0x5b, flags: 0x0}, + 380: {region: 0x9d, script: 0x5, flags: 0x0}, + 381: {region: 0x7f, script: 0x5b, flags: 0x0}, + 382: {region: 0x7c, script: 0x5b, flags: 0x0}, + 383: {region: 0x166, script: 0x5b, flags: 0x0}, + 384: {region: 0x166, script: 0x5b, flags: 0x0}, + 385: {region: 0x166, script: 0x5b, flags: 0x0}, + 386: {region: 0x166, script: 0x5b, flags: 0x0}, + 387: {region: 0x166, script: 0x5b, flags: 0x0}, + 388: {region: 0x166, script: 0x5b, flags: 0x0}, + 389: {region: 0x70, script: 0x2c, flags: 0x0}, + 390: {region: 0x166, script: 0x5b, flags: 0x0}, + 391: {region: 0xdc, script: 0x22, flags: 0x0}, + 392: {region: 0x166, script: 0x5b, flags: 0x0}, + 393: {region: 0xa8, script: 0x5b, flags: 0x0}, + 394: {region: 0x166, script: 0x5b, flags: 0x0}, + 395: {region: 0xe9, script: 0x5, flags: 0x0}, + 396: {region: 0x166, script: 0x5b, flags: 0x0}, + 397: {region: 0xe9, script: 0x5, flags: 0x0}, + 398: {region: 0x166, script: 0x5b, flags: 0x0}, + 399: {region: 0x166, script: 0x5b, flags: 0x0}, + 400: {region: 0x6f, script: 0x5b, flags: 0x0}, + 401: {region: 0x9d, script: 0x5, flags: 0x0}, + 402: {region: 0x166, script: 0x5b, flags: 0x0}, + 403: {region: 0x166, script: 0x2c, flags: 0x0}, + 404: {region: 0xf2, script: 0x5b, flags: 0x0}, + 405: {region: 0x166, script: 0x5b, flags: 0x0}, + 406: {region: 0x166, script: 0x5b, flags: 0x0}, + 407: {region: 0x166, script: 0x5b, flags: 0x0}, + 408: {region: 0x166, script: 0x2c, flags: 0x0}, + 409: {region: 0x166, script: 0x5b, flags: 0x0}, + 410: {region: 0x9a, script: 0x22, flags: 0x0}, + 411: {region: 0x9a, script: 0xe9, flags: 0x0}, + 412: {region: 0x96, script: 0x5b, flags: 0x0}, + 413: {region: 0xda, script: 0x5b, flags: 0x0}, + 414: {region: 0x131, script: 0x32, flags: 0x0}, + 415: {region: 0x166, script: 0x5b, flags: 0x0}, + 416: {region: 0xe, script: 0x2, flags: 0x1}, + 417: {region: 0x9a, script: 0xe, flags: 0x0}, + 418: {region: 0x166, script: 0x5b, flags: 0x0}, + 419: {region: 0x4e, script: 0x5b, flags: 0x0}, + 420: {region: 0x9a, script: 0x35, flags: 0x0}, + 421: {region: 0x41, script: 0x5b, flags: 0x0}, + 422: {region: 0x54, script: 0x5b, flags: 0x0}, + 423: {region: 0x166, script: 0x5b, flags: 0x0}, + 424: {region: 0x81, script: 0x5b, flags: 0x0}, + 425: {region: 0x166, script: 0x5b, flags: 0x0}, + 426: {region: 0x166, script: 0x5b, flags: 0x0}, + 427: {region: 0xa5, script: 0x5b, flags: 0x0}, + 428: {region: 0x99, script: 0x5b, flags: 0x0}, + 429: {region: 0x166, script: 0x5b, flags: 0x0}, + 430: {region: 0xdc, script: 0x22, flags: 0x0}, + 431: {region: 0x166, script: 0x5b, flags: 0x0}, + 432: {region: 0x166, script: 0x5, flags: 0x0}, + 433: {region: 0x49, script: 0x5b, flags: 0x0}, + 434: {region: 0x166, script: 0x5, flags: 0x0}, + 435: {region: 0x166, script: 0x5b, flags: 0x0}, + 436: {region: 0x10, script: 0x3, flags: 0x1}, + 437: {region: 0x166, script: 0x5b, flags: 0x0}, + 438: {region: 0x53, script: 0x3b, flags: 0x0}, + 439: {region: 0x166, script: 0x5b, flags: 0x0}, + 440: {region: 0x136, script: 0x5b, flags: 0x0}, + 441: {region: 0x24, script: 0x5, flags: 0x0}, + 442: {region: 0x166, script: 0x5b, flags: 0x0}, + 443: {region: 0x166, script: 0x2c, flags: 0x0}, + 444: {region: 0x98, script: 0x3e, flags: 0x0}, + 445: {region: 0x166, script: 0x5b, flags: 0x0}, + 446: {region: 0x9a, script: 0x22, flags: 0x0}, + 447: {region: 0x166, script: 0x5b, flags: 0x0}, + 448: {region: 0x74, script: 0x5b, flags: 0x0}, + 449: {region: 0x166, script: 0x5b, flags: 0x0}, + 450: {region: 0x166, script: 0x5b, flags: 0x0}, + 451: {region: 0xe8, script: 0x5b, flags: 0x0}, + 452: {region: 0x166, script: 0x5b, flags: 0x0}, + 453: {region: 0x12c, script: 0x40, flags: 0x0}, + 454: {region: 0x53, script: 0x92, flags: 0x0}, + 455: {region: 0x166, script: 0x5b, flags: 0x0}, + 456: {region: 0xe9, script: 0x5, flags: 0x0}, + 457: {region: 0x9a, script: 0x22, flags: 0x0}, + 458: {region: 0xb0, script: 0x41, flags: 0x0}, + 459: {region: 0xe8, script: 0x5b, flags: 0x0}, + 460: {region: 0xe9, script: 0x5, flags: 0x0}, + 461: {region: 0xe7, script: 0x5b, flags: 0x0}, + 462: {region: 0x9a, script: 0x22, flags: 0x0}, + 463: {region: 0x9a, script: 0x22, flags: 0x0}, + 464: {region: 0x166, script: 0x5b, flags: 0x0}, + 465: {region: 0x91, script: 0x5b, flags: 0x0}, + 466: {region: 0x61, script: 0x5b, flags: 0x0}, + 467: {region: 0x53, script: 0x3b, flags: 0x0}, + 468: {region: 0x92, script: 0x5b, flags: 0x0}, + 469: {region: 0x93, script: 0x5b, flags: 0x0}, + 470: {region: 0x166, script: 0x5b, flags: 0x0}, + 471: {region: 0x28, script: 0x8, flags: 0x0}, + 472: {region: 0xd3, script: 0x5b, flags: 0x0}, + 473: {region: 0x79, script: 0x5b, flags: 0x0}, + 474: {region: 0x166, script: 0x5b, flags: 0x0}, + 475: {region: 0x166, script: 0x5b, flags: 0x0}, + 476: {region: 0xd1, script: 0x5b, flags: 0x0}, + 477: {region: 0xd7, script: 0x5b, flags: 0x0}, + 478: {region: 0x166, script: 0x5b, flags: 0x0}, + 479: {region: 0x166, script: 0x5b, flags: 0x0}, + 480: {region: 0x166, script: 0x5b, flags: 0x0}, + 481: {region: 0x96, script: 0x5b, flags: 0x0}, + 482: {region: 0x166, script: 0x5b, flags: 0x0}, + 483: {region: 0x166, script: 0x5b, flags: 0x0}, + 484: {region: 0x166, script: 0x5b, flags: 0x0}, + 486: {region: 0x123, script: 0x5b, flags: 0x0}, + 487: {region: 0xd7, script: 0x5b, flags: 0x0}, + 488: {region: 0x166, script: 0x5b, flags: 0x0}, + 489: {region: 0x166, script: 0x5b, flags: 0x0}, + 490: {region: 0x53, script: 0xfd, flags: 0x0}, + 491: {region: 0x166, script: 0x5b, flags: 0x0}, + 492: {region: 0x136, script: 0x5b, flags: 0x0}, + 493: {region: 0x166, script: 0x5b, flags: 0x0}, + 494: {region: 0x49, script: 0x5b, flags: 0x0}, + 495: {region: 0x166, script: 0x5b, flags: 0x0}, + 496: {region: 0x166, script: 0x5b, flags: 0x0}, + 497: {region: 0xe8, script: 0x5b, flags: 0x0}, + 498: {region: 0x166, script: 0x5b, flags: 0x0}, + 499: {region: 0x96, script: 0x5b, flags: 0x0}, + 500: {region: 0x107, script: 0x20, flags: 0x0}, + 501: {region: 0x1, script: 0x5b, flags: 0x0}, + 502: {region: 0x166, script: 0x5b, flags: 0x0}, + 503: {region: 0x166, script: 0x5b, flags: 0x0}, + 504: {region: 0x9e, script: 0x5b, flags: 0x0}, + 505: {region: 0x9f, script: 0x5b, flags: 0x0}, + 506: {region: 0x49, script: 0x17, flags: 0x0}, + 507: {region: 0x98, script: 0x3e, flags: 0x0}, + 508: {region: 0x166, script: 0x5b, flags: 0x0}, + 509: {region: 0x166, script: 0x5b, flags: 0x0}, + 510: {region: 0x107, script: 0x5b, flags: 0x0}, + 511: {region: 0x166, script: 0x5b, flags: 0x0}, + 512: {region: 0xa3, script: 0x49, flags: 0x0}, + 513: {region: 0x166, script: 0x5b, flags: 0x0}, + 514: {region: 0xa1, script: 0x5b, flags: 0x0}, + 515: {region: 0x1, script: 0x5b, flags: 0x0}, + 516: {region: 0x166, script: 0x5b, flags: 0x0}, + 517: {region: 0x166, script: 0x5b, flags: 0x0}, + 518: {region: 0x166, script: 0x5b, flags: 0x0}, + 519: {region: 0x52, script: 0x5b, flags: 0x0}, + 520: {region: 0x131, script: 0x3e, flags: 0x0}, + 521: {region: 0x166, script: 0x5b, flags: 0x0}, + 522: {region: 0x130, script: 0x5b, flags: 0x0}, + 523: {region: 0xdc, script: 0x22, flags: 0x0}, + 524: {region: 0x166, script: 0x5b, flags: 0x0}, + 525: {region: 0x64, script: 0x5b, flags: 0x0}, + 526: {region: 0x96, script: 0x5b, flags: 0x0}, + 527: {region: 0x96, script: 0x5b, flags: 0x0}, + 528: {region: 0x7e, script: 0x2e, flags: 0x0}, + 529: {region: 0x138, script: 0x20, flags: 0x0}, + 530: {region: 0x68, script: 0x5b, flags: 0x0}, + 531: {region: 0xc5, script: 0x5b, flags: 0x0}, + 532: {region: 0x166, script: 0x5b, flags: 0x0}, + 533: {region: 0x166, script: 0x5b, flags: 0x0}, + 534: {region: 0xd7, script: 0x5b, flags: 0x0}, + 535: {region: 0xa5, script: 0x5b, flags: 0x0}, + 536: {region: 0xc4, script: 0x5b, flags: 0x0}, + 537: {region: 0x107, script: 0x20, flags: 0x0}, + 538: {region: 0x166, script: 0x5b, flags: 0x0}, + 539: {region: 0x166, script: 0x5b, flags: 0x0}, + 540: {region: 0x166, script: 0x5b, flags: 0x0}, + 541: {region: 0x166, script: 0x5b, flags: 0x0}, + 542: {region: 0xd5, script: 0x5, flags: 0x0}, + 543: {region: 0xd7, script: 0x5b, flags: 0x0}, + 544: {region: 0x165, script: 0x5b, flags: 0x0}, + 545: {region: 0x166, script: 0x5b, flags: 0x0}, + 546: {region: 0x166, script: 0x5b, flags: 0x0}, + 547: {region: 0x130, script: 0x5b, flags: 0x0}, + 548: {region: 0x123, script: 0x5, flags: 0x0}, + 549: {region: 0x166, script: 0x5b, flags: 0x0}, + 550: {region: 0x124, script: 0xee, flags: 0x0}, + 551: {region: 0x5b, script: 0x5b, flags: 0x0}, + 552: {region: 0x52, script: 0x5b, flags: 0x0}, + 553: {region: 0x166, script: 0x5b, flags: 0x0}, + 554: {region: 0x4f, script: 0x5b, flags: 0x0}, + 555: {region: 0x9a, script: 0x22, flags: 0x0}, + 556: {region: 0x9a, script: 0x22, flags: 0x0}, + 557: {region: 0x4b, script: 0x5b, flags: 0x0}, + 558: {region: 0x96, script: 0x5b, flags: 0x0}, + 559: {region: 0x166, script: 0x5b, flags: 0x0}, + 560: {region: 0x41, script: 0x5b, flags: 0x0}, + 561: {region: 0x9a, script: 0x5b, flags: 0x0}, + 562: {region: 0x53, script: 0xe5, flags: 0x0}, + 563: {region: 0x9a, script: 0x22, flags: 0x0}, + 564: {region: 0xc4, script: 0x5b, flags: 0x0}, + 565: {region: 0x166, script: 0x5b, flags: 0x0}, + 566: {region: 0x9a, script: 0x76, flags: 0x0}, + 567: {region: 0xe9, script: 0x5, flags: 0x0}, + 568: {region: 0x166, script: 0x5b, flags: 0x0}, + 569: {region: 0xa5, script: 0x5b, flags: 0x0}, + 570: {region: 0x166, script: 0x5b, flags: 0x0}, + 571: {region: 0x12c, script: 0x5b, flags: 0x0}, + 572: {region: 0x166, script: 0x5b, flags: 0x0}, + 573: {region: 0xd3, script: 0x5b, flags: 0x0}, + 574: {region: 0x166, script: 0x5b, flags: 0x0}, + 575: {region: 0xb0, script: 0x58, flags: 0x0}, + 576: {region: 0x166, script: 0x5b, flags: 0x0}, + 577: {region: 0x166, script: 0x5b, flags: 0x0}, + 578: {region: 0x13, script: 0x6, flags: 0x1}, + 579: {region: 0x166, script: 0x5b, flags: 0x0}, + 580: {region: 0x52, script: 0x5b, flags: 0x0}, + 581: {region: 0x83, script: 0x5b, flags: 0x0}, + 582: {region: 0xa5, script: 0x5b, flags: 0x0}, + 583: {region: 0x166, script: 0x5b, flags: 0x0}, + 584: {region: 0x166, script: 0x5b, flags: 0x0}, + 585: {region: 0x166, script: 0x5b, flags: 0x0}, + 586: {region: 0xa7, script: 0x4f, flags: 0x0}, + 587: {region: 0x2a, script: 0x5b, flags: 0x0}, + 588: {region: 0x166, script: 0x5b, flags: 0x0}, + 589: {region: 0x166, script: 0x5b, flags: 0x0}, + 590: {region: 0x166, script: 0x5b, flags: 0x0}, + 591: {region: 0x166, script: 0x5b, flags: 0x0}, + 592: {region: 0x166, script: 0x5b, flags: 0x0}, + 593: {region: 0x9a, script: 0x53, flags: 0x0}, + 594: {region: 0x8c, script: 0x5b, flags: 0x0}, + 595: {region: 0x166, script: 0x5b, flags: 0x0}, + 596: {region: 0xac, script: 0x54, flags: 0x0}, + 597: {region: 0x107, script: 0x20, flags: 0x0}, + 598: {region: 0x9a, script: 0x22, flags: 0x0}, + 599: {region: 0x166, script: 0x5b, flags: 0x0}, + 600: {region: 0x76, script: 0x5b, flags: 0x0}, + 601: {region: 0x166, script: 0x5b, flags: 0x0}, + 602: {region: 0xb5, script: 0x5b, flags: 0x0}, + 603: {region: 0x166, script: 0x5b, flags: 0x0}, + 604: {region: 0x166, script: 0x5b, flags: 0x0}, + 605: {region: 0x166, script: 0x5b, flags: 0x0}, + 606: {region: 0x166, script: 0x5b, flags: 0x0}, + 607: {region: 0x166, script: 0x5b, flags: 0x0}, + 608: {region: 0x166, script: 0x5b, flags: 0x0}, + 609: {region: 0x166, script: 0x5b, flags: 0x0}, + 610: {region: 0x166, script: 0x2c, flags: 0x0}, + 611: {region: 0x166, script: 0x5b, flags: 0x0}, + 612: {region: 0x107, script: 0x20, flags: 0x0}, + 613: {region: 0x113, script: 0x5b, flags: 0x0}, + 614: {region: 0xe8, script: 0x5b, flags: 0x0}, + 615: {region: 0x107, script: 0x5b, flags: 0x0}, + 616: {region: 0x166, script: 0x5b, flags: 0x0}, + 617: {region: 0x9a, script: 0x22, flags: 0x0}, + 618: {region: 0x9a, script: 0x5, flags: 0x0}, + 619: {region: 0x130, script: 0x5b, flags: 0x0}, + 620: {region: 0x166, script: 0x5b, flags: 0x0}, + 621: {region: 0x52, script: 0x5b, flags: 0x0}, + 622: {region: 0x61, script: 0x5b, flags: 0x0}, + 623: {region: 0x166, script: 0x5b, flags: 0x0}, + 624: {region: 0x166, script: 0x5b, flags: 0x0}, + 625: {region: 0x166, script: 0x2c, flags: 0x0}, + 626: {region: 0x166, script: 0x5b, flags: 0x0}, + 627: {region: 0x166, script: 0x5b, flags: 0x0}, + 628: {region: 0x19, script: 0x3, flags: 0x1}, + 629: {region: 0x166, script: 0x5b, flags: 0x0}, + 630: {region: 0x166, script: 0x5b, flags: 0x0}, + 631: {region: 0x166, script: 0x5b, flags: 0x0}, + 632: {region: 0x166, script: 0x5b, flags: 0x0}, + 633: {region: 0x107, script: 0x20, flags: 0x0}, + 634: {region: 0x166, script: 0x5b, flags: 0x0}, + 635: {region: 0x166, script: 0x5b, flags: 0x0}, + 636: {region: 0x166, script: 0x5b, flags: 0x0}, + 637: {region: 0x107, script: 0x20, flags: 0x0}, + 638: {region: 0x166, script: 0x5b, flags: 0x0}, + 639: {region: 0x96, script: 0x5b, flags: 0x0}, + 640: {region: 0xe9, script: 0x5, flags: 0x0}, + 641: {region: 0x7c, script: 0x5b, flags: 0x0}, + 642: {region: 0x166, script: 0x5b, flags: 0x0}, + 643: {region: 0x166, script: 0x5b, flags: 0x0}, + 644: {region: 0x166, script: 0x5b, flags: 0x0}, + 645: {region: 0x166, script: 0x2c, flags: 0x0}, + 646: {region: 0x124, script: 0xee, flags: 0x0}, + 647: {region: 0xe9, script: 0x5, flags: 0x0}, + 648: {region: 0x166, script: 0x5b, flags: 0x0}, + 649: {region: 0x166, script: 0x5b, flags: 0x0}, + 650: {region: 0x1c, script: 0x5, flags: 0x1}, + 651: {region: 0x166, script: 0x5b, flags: 0x0}, + 652: {region: 0x166, script: 0x5b, flags: 0x0}, + 653: {region: 0x166, script: 0x5b, flags: 0x0}, + 654: {region: 0x139, script: 0x5b, flags: 0x0}, + 655: {region: 0x88, script: 0x5f, flags: 0x0}, + 656: {region: 0x98, script: 0x3e, flags: 0x0}, + 657: {region: 0x130, script: 0x5b, flags: 0x0}, + 658: {region: 0xe9, script: 0x5, flags: 0x0}, + 659: {region: 0x132, script: 0x5b, flags: 0x0}, + 660: {region: 0x166, script: 0x5b, flags: 0x0}, + 661: {region: 0xb8, script: 0x5b, flags: 0x0}, + 662: {region: 0x107, script: 0x20, flags: 0x0}, + 663: {region: 0x166, script: 0x5b, flags: 0x0}, + 664: {region: 0x96, script: 0x5b, flags: 0x0}, + 665: {region: 0x166, script: 0x5b, flags: 0x0}, + 666: {region: 0x53, script: 0xee, flags: 0x0}, + 667: {region: 0x166, script: 0x5b, flags: 0x0}, + 668: {region: 0x166, script: 0x5b, flags: 0x0}, + 669: {region: 0x166, script: 0x5b, flags: 0x0}, + 670: {region: 0x166, script: 0x5b, flags: 0x0}, + 671: {region: 0x9a, script: 0x5d, flags: 0x0}, + 672: {region: 0x166, script: 0x5b, flags: 0x0}, + 673: {region: 0x166, script: 0x5b, flags: 0x0}, + 674: {region: 0x107, script: 0x20, flags: 0x0}, + 675: {region: 0x132, script: 0x5b, flags: 0x0}, + 676: {region: 0x166, script: 0x5b, flags: 0x0}, + 677: {region: 0xda, script: 0x5b, flags: 0x0}, + 678: {region: 0x166, script: 0x5b, flags: 0x0}, + 679: {region: 0x166, script: 0x5b, flags: 0x0}, + 680: {region: 0x21, script: 0x2, flags: 0x1}, + 681: {region: 0x166, script: 0x5b, flags: 0x0}, + 682: {region: 0x166, script: 0x5b, flags: 0x0}, + 683: {region: 0x9f, script: 0x5b, flags: 0x0}, + 684: {region: 0x53, script: 0x61, flags: 0x0}, + 685: {region: 0x96, script: 0x5b, flags: 0x0}, + 686: {region: 0x9d, script: 0x5, flags: 0x0}, + 687: {region: 0x136, script: 0x5b, flags: 0x0}, + 688: {region: 0x166, script: 0x5b, flags: 0x0}, + 689: {region: 0x166, script: 0x5b, flags: 0x0}, + 690: {region: 0x9a, script: 0xe9, flags: 0x0}, + 691: {region: 0x9f, script: 0x5b, flags: 0x0}, + 692: {region: 0x166, script: 0x5b, flags: 0x0}, + 693: {region: 0x4b, script: 0x5b, flags: 0x0}, + 694: {region: 0x166, script: 0x5b, flags: 0x0}, + 695: {region: 0x166, script: 0x5b, flags: 0x0}, + 696: {region: 0xb0, script: 0x58, flags: 0x0}, + 697: {region: 0x166, script: 0x5b, flags: 0x0}, + 698: {region: 0x166, script: 0x5b, flags: 0x0}, + 699: {region: 0x4b, script: 0x5b, flags: 0x0}, + 700: {region: 0x166, script: 0x5b, flags: 0x0}, + 701: {region: 0x166, script: 0x5b, flags: 0x0}, + 702: {region: 0x163, script: 0x5b, flags: 0x0}, + 703: {region: 0x9d, script: 0x5, flags: 0x0}, + 704: {region: 0xb7, script: 0x5b, flags: 0x0}, + 705: {region: 0xb9, script: 0x5b, flags: 0x0}, + 706: {region: 0x4b, script: 0x5b, flags: 0x0}, + 707: {region: 0x4b, script: 0x5b, flags: 0x0}, + 708: {region: 0xa5, script: 0x5b, flags: 0x0}, + 709: {region: 0xa5, script: 0x5b, flags: 0x0}, + 710: {region: 0x9d, script: 0x5, flags: 0x0}, + 711: {region: 0xb9, script: 0x5b, flags: 0x0}, + 712: {region: 0x124, script: 0xee, flags: 0x0}, + 713: {region: 0x53, script: 0x3b, flags: 0x0}, + 714: {region: 0x12c, script: 0x5b, flags: 0x0}, + 715: {region: 0x96, script: 0x5b, flags: 0x0}, + 716: {region: 0x52, script: 0x5b, flags: 0x0}, + 717: {region: 0x9a, script: 0x22, flags: 0x0}, + 718: {region: 0x9a, script: 0x22, flags: 0x0}, + 719: {region: 0x96, script: 0x5b, flags: 0x0}, + 720: {region: 0x23, script: 0x3, flags: 0x1}, + 721: {region: 0xa5, script: 0x5b, flags: 0x0}, + 722: {region: 0x166, script: 0x5b, flags: 0x0}, + 723: {region: 0xd0, script: 0x5b, flags: 0x0}, + 724: {region: 0x166, script: 0x5b, flags: 0x0}, + 725: {region: 0x166, script: 0x5b, flags: 0x0}, + 726: {region: 0x166, script: 0x5b, flags: 0x0}, + 727: {region: 0x166, script: 0x5b, flags: 0x0}, + 728: {region: 0x166, script: 0x5b, flags: 0x0}, + 729: {region: 0x166, script: 0x5b, flags: 0x0}, + 730: {region: 0x166, script: 0x5b, flags: 0x0}, + 731: {region: 0x166, script: 0x5b, flags: 0x0}, + 732: {region: 0x166, script: 0x5b, flags: 0x0}, + 733: {region: 0x166, script: 0x5b, flags: 0x0}, + 734: {region: 0x166, script: 0x5b, flags: 0x0}, + 735: {region: 0x166, script: 0x5, flags: 0x0}, + 736: {region: 0x107, script: 0x20, flags: 0x0}, + 737: {region: 0xe8, script: 0x5b, flags: 0x0}, + 738: {region: 0x166, script: 0x5b, flags: 0x0}, + 739: {region: 0x96, script: 0x5b, flags: 0x0}, + 740: {region: 0x166, script: 0x2c, flags: 0x0}, + 741: {region: 0x166, script: 0x5b, flags: 0x0}, + 742: {region: 0x166, script: 0x5b, flags: 0x0}, + 743: {region: 0x166, script: 0x5b, flags: 0x0}, + 744: {region: 0x113, script: 0x5b, flags: 0x0}, + 745: {region: 0xa5, script: 0x5b, flags: 0x0}, + 746: {region: 0x166, script: 0x5b, flags: 0x0}, + 747: {region: 0x166, script: 0x5b, flags: 0x0}, + 748: {region: 0x124, script: 0x5, flags: 0x0}, + 749: {region: 0xcd, script: 0x5b, flags: 0x0}, + 750: {region: 0x166, script: 0x5b, flags: 0x0}, + 751: {region: 0x166, script: 0x5b, flags: 0x0}, + 752: {region: 0x166, script: 0x5b, flags: 0x0}, + 753: {region: 0xc0, script: 0x5b, flags: 0x0}, + 754: {region: 0xd2, script: 0x5b, flags: 0x0}, + 755: {region: 0x166, script: 0x5b, flags: 0x0}, + 756: {region: 0x52, script: 0x5b, flags: 0x0}, + 757: {region: 0xdc, script: 0x22, flags: 0x0}, + 758: {region: 0x130, script: 0x5b, flags: 0x0}, + 759: {region: 0xc1, script: 0x5b, flags: 0x0}, + 760: {region: 0x166, script: 0x5b, flags: 0x0}, + 761: {region: 0x166, script: 0x5b, flags: 0x0}, + 762: {region: 0xe1, script: 0x5b, flags: 0x0}, + 763: {region: 0x166, script: 0x5b, flags: 0x0}, + 764: {region: 0x96, script: 0x5b, flags: 0x0}, + 765: {region: 0x9c, script: 0x3d, flags: 0x0}, + 766: {region: 0x166, script: 0x5b, flags: 0x0}, + 767: {region: 0xc3, script: 0x20, flags: 0x0}, + 768: {region: 0x166, script: 0x5, flags: 0x0}, + 769: {region: 0x166, script: 0x5b, flags: 0x0}, + 770: {region: 0x166, script: 0x5b, flags: 0x0}, + 771: {region: 0x166, script: 0x5b, flags: 0x0}, + 772: {region: 0x9a, script: 0x6f, flags: 0x0}, + 773: {region: 0x166, script: 0x5b, flags: 0x0}, + 774: {region: 0x166, script: 0x5b, flags: 0x0}, + 775: {region: 0x10c, script: 0x5b, flags: 0x0}, + 776: {region: 0x166, script: 0x5b, flags: 0x0}, + 777: {region: 0x166, script: 0x5b, flags: 0x0}, + 778: {region: 0x166, script: 0x5b, flags: 0x0}, + 779: {region: 0x26, script: 0x3, flags: 0x1}, + 780: {region: 0x166, script: 0x5b, flags: 0x0}, + 781: {region: 0x166, script: 0x5b, flags: 0x0}, + 782: {region: 0x9a, script: 0xe, flags: 0x0}, + 783: {region: 0xc5, script: 0x76, flags: 0x0}, + 785: {region: 0x166, script: 0x5b, flags: 0x0}, + 786: {region: 0x49, script: 0x5b, flags: 0x0}, + 787: {region: 0x49, script: 0x5b, flags: 0x0}, + 788: {region: 0x37, script: 0x5b, flags: 0x0}, + 789: {region: 0x166, script: 0x5b, flags: 0x0}, + 790: {region: 0x166, script: 0x5b, flags: 0x0}, + 791: {region: 0x166, script: 0x5b, flags: 0x0}, + 792: {region: 0x166, script: 0x5b, flags: 0x0}, + 793: {region: 0x166, script: 0x5b, flags: 0x0}, + 794: {region: 0x166, script: 0x5b, flags: 0x0}, + 795: {region: 0x9a, script: 0x22, flags: 0x0}, + 796: {region: 0xdc, script: 0x22, flags: 0x0}, + 797: {region: 0x107, script: 0x20, flags: 0x0}, + 798: {region: 0x35, script: 0x73, flags: 0x0}, + 799: {region: 0x29, script: 0x3, flags: 0x1}, + 800: {region: 0xcc, script: 0x5b, flags: 0x0}, + 801: {region: 0x166, script: 0x5b, flags: 0x0}, + 802: {region: 0x166, script: 0x5b, flags: 0x0}, + 803: {region: 0x166, script: 0x5b, flags: 0x0}, + 804: {region: 0x9a, script: 0x22, flags: 0x0}, + 805: {region: 0x52, script: 0x5b, flags: 0x0}, + 807: {region: 0x166, script: 0x5b, flags: 0x0}, + 808: {region: 0x136, script: 0x5b, flags: 0x0}, + 809: {region: 0x166, script: 0x5b, flags: 0x0}, + 810: {region: 0x166, script: 0x5b, flags: 0x0}, + 811: {region: 0xe9, script: 0x5, flags: 0x0}, + 812: {region: 0xc4, script: 0x5b, flags: 0x0}, + 813: {region: 0x9a, script: 0x22, flags: 0x0}, + 814: {region: 0x96, script: 0x5b, flags: 0x0}, + 815: {region: 0x165, script: 0x5b, flags: 0x0}, + 816: {region: 0x166, script: 0x5b, flags: 0x0}, + 817: {region: 0xc5, script: 0x76, flags: 0x0}, + 818: {region: 0x166, script: 0x5b, flags: 0x0}, + 819: {region: 0x166, script: 0x2c, flags: 0x0}, + 820: {region: 0x107, script: 0x20, flags: 0x0}, + 821: {region: 0x166, script: 0x5b, flags: 0x0}, + 822: {region: 0x132, script: 0x5b, flags: 0x0}, + 823: {region: 0x9d, script: 0x67, flags: 0x0}, + 824: {region: 0x166, script: 0x5b, flags: 0x0}, + 825: {region: 0x166, script: 0x5b, flags: 0x0}, + 826: {region: 0x9d, script: 0x5, flags: 0x0}, + 827: {region: 0x166, script: 0x5b, flags: 0x0}, + 828: {region: 0x166, script: 0x5b, flags: 0x0}, + 829: {region: 0x166, script: 0x5b, flags: 0x0}, + 830: {region: 0xde, script: 0x5b, flags: 0x0}, + 831: {region: 0x166, script: 0x5b, flags: 0x0}, + 832: {region: 0x166, script: 0x5b, flags: 0x0}, + 834: {region: 0x166, script: 0x5b, flags: 0x0}, + 835: {region: 0x53, script: 0x3b, flags: 0x0}, + 836: {region: 0x9f, script: 0x5b, flags: 0x0}, + 837: {region: 0xd3, script: 0x5b, flags: 0x0}, + 838: {region: 0x166, script: 0x5b, flags: 0x0}, + 839: {region: 0xdb, script: 0x5b, flags: 0x0}, + 840: {region: 0x166, script: 0x5b, flags: 0x0}, + 841: {region: 0x166, script: 0x5b, flags: 0x0}, + 842: {region: 0x166, script: 0x5b, flags: 0x0}, + 843: {region: 0xd0, script: 0x5b, flags: 0x0}, + 844: {region: 0x166, script: 0x5b, flags: 0x0}, + 845: {region: 0x166, script: 0x5b, flags: 0x0}, + 846: {region: 0x165, script: 0x5b, flags: 0x0}, + 847: {region: 0xd2, script: 0x5b, flags: 0x0}, + 848: {region: 0x61, script: 0x5b, flags: 0x0}, + 849: {region: 0xdc, script: 0x22, flags: 0x0}, + 850: {region: 0x166, script: 0x5b, flags: 0x0}, + 851: {region: 0xdc, script: 0x22, flags: 0x0}, + 852: {region: 0x166, script: 0x5b, flags: 0x0}, + 853: {region: 0x166, script: 0x5b, flags: 0x0}, + 854: {region: 0xd3, script: 0x5b, flags: 0x0}, + 855: {region: 0x166, script: 0x5b, flags: 0x0}, + 856: {region: 0x166, script: 0x5b, flags: 0x0}, + 857: {region: 0xd2, script: 0x5b, flags: 0x0}, + 858: {region: 0x166, script: 0x5b, flags: 0x0}, + 859: {region: 0xd0, script: 0x5b, flags: 0x0}, + 860: {region: 0xd0, script: 0x5b, flags: 0x0}, + 861: {region: 0x166, script: 0x5b, flags: 0x0}, + 862: {region: 0x166, script: 0x5b, flags: 0x0}, + 863: {region: 0x96, script: 0x5b, flags: 0x0}, + 864: {region: 0x166, script: 0x5b, flags: 0x0}, + 865: {region: 0xe0, script: 0x5b, flags: 0x0}, + 866: {region: 0x166, script: 0x5b, flags: 0x0}, + 867: {region: 0x166, script: 0x5b, flags: 0x0}, + 868: {region: 0x9a, script: 0x5b, flags: 0x0}, + 869: {region: 0x166, script: 0x5b, flags: 0x0}, + 870: {region: 0x166, script: 0x5b, flags: 0x0}, + 871: {region: 0xda, script: 0x5b, flags: 0x0}, + 872: {region: 0x52, script: 0x5b, flags: 0x0}, + 873: {region: 0x166, script: 0x5b, flags: 0x0}, + 874: {region: 0xdb, script: 0x5b, flags: 0x0}, + 875: {region: 0x166, script: 0x5b, flags: 0x0}, + 876: {region: 0x52, script: 0x5b, flags: 0x0}, + 877: {region: 0x166, script: 0x5b, flags: 0x0}, + 878: {region: 0x166, script: 0x5b, flags: 0x0}, + 879: {region: 0xdb, script: 0x5b, flags: 0x0}, + 880: {region: 0x124, script: 0x57, flags: 0x0}, + 881: {region: 0x9a, script: 0x22, flags: 0x0}, + 882: {region: 0x10d, script: 0xcb, flags: 0x0}, + 883: {region: 0x166, script: 0x5b, flags: 0x0}, + 884: {region: 0x166, script: 0x5b, flags: 0x0}, + 885: {region: 0x85, script: 0x7e, flags: 0x0}, + 886: {region: 0x162, script: 0x5b, flags: 0x0}, + 887: {region: 0x166, script: 0x5b, flags: 0x0}, + 888: {region: 0x49, script: 0x17, flags: 0x0}, + 889: {region: 0x166, script: 0x5b, flags: 0x0}, + 890: {region: 0x162, script: 0x5b, flags: 0x0}, + 891: {region: 0x166, script: 0x5b, flags: 0x0}, + 892: {region: 0x166, script: 0x5b, flags: 0x0}, + 893: {region: 0x166, script: 0x5b, flags: 0x0}, + 894: {region: 0x166, script: 0x5b, flags: 0x0}, + 895: {region: 0x166, script: 0x5b, flags: 0x0}, + 896: {region: 0x118, script: 0x5b, flags: 0x0}, + 897: {region: 0x166, script: 0x5b, flags: 0x0}, + 898: {region: 0x166, script: 0x5b, flags: 0x0}, + 899: {region: 0x136, script: 0x5b, flags: 0x0}, + 900: {region: 0x166, script: 0x5b, flags: 0x0}, + 901: {region: 0x53, script: 0x5b, flags: 0x0}, + 902: {region: 0x166, script: 0x5b, flags: 0x0}, + 903: {region: 0xcf, script: 0x5b, flags: 0x0}, + 904: {region: 0x130, script: 0x5b, flags: 0x0}, + 905: {region: 0x132, script: 0x5b, flags: 0x0}, + 906: {region: 0x81, script: 0x5b, flags: 0x0}, + 907: {region: 0x79, script: 0x5b, flags: 0x0}, + 908: {region: 0x166, script: 0x5b, flags: 0x0}, + 910: {region: 0x166, script: 0x5b, flags: 0x0}, + 911: {region: 0x166, script: 0x5b, flags: 0x0}, + 912: {region: 0x70, script: 0x5b, flags: 0x0}, + 913: {region: 0x166, script: 0x5b, flags: 0x0}, + 914: {region: 0x166, script: 0x5b, flags: 0x0}, + 915: {region: 0x166, script: 0x5b, flags: 0x0}, + 916: {region: 0x166, script: 0x5b, flags: 0x0}, + 917: {region: 0x9a, script: 0x83, flags: 0x0}, + 918: {region: 0x166, script: 0x5b, flags: 0x0}, + 919: {region: 0x166, script: 0x5, flags: 0x0}, + 920: {region: 0x7e, script: 0x20, flags: 0x0}, + 921: {region: 0x136, script: 0x84, flags: 0x0}, + 922: {region: 0x166, script: 0x5, flags: 0x0}, + 923: {region: 0xc6, script: 0x82, flags: 0x0}, + 924: {region: 0x166, script: 0x5b, flags: 0x0}, + 925: {region: 0x2c, script: 0x3, flags: 0x1}, + 926: {region: 0xe8, script: 0x5b, flags: 0x0}, + 927: {region: 0x2f, script: 0x2, flags: 0x1}, + 928: {region: 0xe8, script: 0x5b, flags: 0x0}, + 929: {region: 0x30, script: 0x5b, flags: 0x0}, + 930: {region: 0xf1, script: 0x5b, flags: 0x0}, + 931: {region: 0x166, script: 0x5b, flags: 0x0}, + 932: {region: 0x79, script: 0x5b, flags: 0x0}, + 933: {region: 0xd7, script: 0x5b, flags: 0x0}, + 934: {region: 0x136, script: 0x5b, flags: 0x0}, + 935: {region: 0x49, script: 0x5b, flags: 0x0}, + 936: {region: 0x166, script: 0x5b, flags: 0x0}, + 937: {region: 0x9d, script: 0xfa, flags: 0x0}, + 938: {region: 0x166, script: 0x5b, flags: 0x0}, + 939: {region: 0x61, script: 0x5b, flags: 0x0}, + 940: {region: 0x166, script: 0x5, flags: 0x0}, + 941: {region: 0xb1, script: 0x90, flags: 0x0}, + 943: {region: 0x166, script: 0x5b, flags: 0x0}, + 944: {region: 0x166, script: 0x5b, flags: 0x0}, + 945: {region: 0x9a, script: 0x12, flags: 0x0}, + 946: {region: 0xa5, script: 0x5b, flags: 0x0}, + 947: {region: 0xea, script: 0x5b, flags: 0x0}, + 948: {region: 0x166, script: 0x5b, flags: 0x0}, + 949: {region: 0x9f, script: 0x5b, flags: 0x0}, + 950: {region: 0x166, script: 0x5b, flags: 0x0}, + 951: {region: 0x166, script: 0x5b, flags: 0x0}, + 952: {region: 0x88, script: 0x34, flags: 0x0}, + 953: {region: 0x76, script: 0x5b, flags: 0x0}, + 954: {region: 0x166, script: 0x5b, flags: 0x0}, + 955: {region: 0xe9, script: 0x4e, flags: 0x0}, + 956: {region: 0x9d, script: 0x5, flags: 0x0}, + 957: {region: 0x1, script: 0x5b, flags: 0x0}, + 958: {region: 0x24, script: 0x5, flags: 0x0}, + 959: {region: 0x166, script: 0x5b, flags: 0x0}, + 960: {region: 0x41, script: 0x5b, flags: 0x0}, + 961: {region: 0x166, script: 0x5b, flags: 0x0}, + 962: {region: 0x7b, script: 0x5b, flags: 0x0}, + 963: {region: 0x166, script: 0x5b, flags: 0x0}, + 964: {region: 0xe5, script: 0x5b, flags: 0x0}, + 965: {region: 0x8a, script: 0x5b, flags: 0x0}, + 966: {region: 0x6a, script: 0x5b, flags: 0x0}, + 967: {region: 0x166, script: 0x5b, flags: 0x0}, + 968: {region: 0x9a, script: 0x22, flags: 0x0}, + 969: {region: 0x166, script: 0x5b, flags: 0x0}, + 970: {region: 0x103, script: 0x5b, flags: 0x0}, + 971: {region: 0x96, script: 0x5b, flags: 0x0}, + 972: {region: 0x166, script: 0x5b, flags: 0x0}, + 973: {region: 0x166, script: 0x5b, flags: 0x0}, + 974: {region: 0x9f, script: 0x5b, flags: 0x0}, + 975: {region: 0x166, script: 0x5, flags: 0x0}, + 976: {region: 0x9a, script: 0x5b, flags: 0x0}, + 977: {region: 0x31, script: 0x2, flags: 0x1}, + 978: {region: 0xdc, script: 0x22, flags: 0x0}, + 979: {region: 0x35, script: 0xe, flags: 0x0}, + 980: {region: 0x4e, script: 0x5b, flags: 0x0}, + 981: {region: 0x73, script: 0x5b, flags: 0x0}, + 982: {region: 0x4e, script: 0x5b, flags: 0x0}, + 983: {region: 0x9d, script: 0x5, flags: 0x0}, + 984: {region: 0x10d, script: 0x5b, flags: 0x0}, + 985: {region: 0x3a, script: 0x5b, flags: 0x0}, + 986: {region: 0x166, script: 0x5b, flags: 0x0}, + 987: {region: 0xd2, script: 0x5b, flags: 0x0}, + 988: {region: 0x105, script: 0x5b, flags: 0x0}, + 989: {region: 0x96, script: 0x5b, flags: 0x0}, + 990: {region: 0x130, script: 0x5b, flags: 0x0}, + 991: {region: 0x166, script: 0x5b, flags: 0x0}, + 992: {region: 0x166, script: 0x5b, flags: 0x0}, + 993: {region: 0x74, script: 0x5b, flags: 0x0}, + 994: {region: 0x107, script: 0x20, flags: 0x0}, + 995: {region: 0x131, script: 0x20, flags: 0x0}, + 996: {region: 0x10a, script: 0x5b, flags: 0x0}, + 997: {region: 0x108, script: 0x5b, flags: 0x0}, + 998: {region: 0x130, script: 0x5b, flags: 0x0}, + 999: {region: 0x166, script: 0x5b, flags: 0x0}, + 1000: {region: 0xa3, script: 0x4c, flags: 0x0}, + 1001: {region: 0x9a, script: 0x22, flags: 0x0}, + 1002: {region: 0x81, script: 0x5b, flags: 0x0}, + 1003: {region: 0x107, script: 0x20, flags: 0x0}, + 1004: {region: 0xa5, script: 0x5b, flags: 0x0}, + 1005: {region: 0x96, script: 0x5b, flags: 0x0}, + 1006: {region: 0x9a, script: 0x5b, flags: 0x0}, + 1007: {region: 0x115, script: 0x5b, flags: 0x0}, + 1008: {region: 0x9a, script: 0xcf, flags: 0x0}, + 1009: {region: 0x166, script: 0x5b, flags: 0x0}, + 1010: {region: 0x166, script: 0x5b, flags: 0x0}, + 1011: {region: 0x130, script: 0x5b, flags: 0x0}, + 1012: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1013: {region: 0x9a, script: 0x22, flags: 0x0}, + 1014: {region: 0x166, script: 0x5, flags: 0x0}, + 1015: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1016: {region: 0x7c, script: 0x5b, flags: 0x0}, + 1017: {region: 0x49, script: 0x5b, flags: 0x0}, + 1018: {region: 0x33, script: 0x4, flags: 0x1}, + 1019: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1020: {region: 0x9d, script: 0x5, flags: 0x0}, + 1021: {region: 0xdb, script: 0x5b, flags: 0x0}, + 1022: {region: 0x4f, script: 0x5b, flags: 0x0}, + 1023: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1024: {region: 0xd0, script: 0x5b, flags: 0x0}, + 1025: {region: 0xc4, script: 0x5b, flags: 0x0}, + 1026: {region: 0x4c, script: 0x5b, flags: 0x0}, + 1027: {region: 0x97, script: 0x80, flags: 0x0}, + 1028: {region: 0xb7, script: 0x5b, flags: 0x0}, + 1029: {region: 0x166, script: 0x2c, flags: 0x0}, + 1030: {region: 0x166, script: 0x5b, flags: 0x0}, + 1032: {region: 0xbb, script: 0xeb, flags: 0x0}, + 1033: {region: 0x166, script: 0x5b, flags: 0x0}, + 1034: {region: 0xc5, script: 0x76, flags: 0x0}, + 1035: {region: 0x166, script: 0x5, flags: 0x0}, + 1036: {region: 0xb4, script: 0xd6, flags: 0x0}, + 1037: {region: 0x70, script: 0x5b, flags: 0x0}, + 1038: {region: 0x166, script: 0x5b, flags: 0x0}, + 1039: {region: 0x166, script: 0x5b, flags: 0x0}, + 1040: {region: 0x166, script: 0x5b, flags: 0x0}, + 1041: {region: 0x166, script: 0x5b, flags: 0x0}, + 1042: {region: 0x112, script: 0x5b, flags: 0x0}, + 1043: {region: 0x166, script: 0x5b, flags: 0x0}, + 1044: {region: 0xe9, script: 0x5, flags: 0x0}, + 1045: {region: 0x166, script: 0x5b, flags: 0x0}, + 1046: {region: 0x110, script: 0x5b, flags: 0x0}, + 1047: {region: 0x166, script: 0x5b, flags: 0x0}, + 1048: {region: 0xea, script: 0x5b, flags: 0x0}, + 1049: {region: 0x166, script: 0x5b, flags: 0x0}, + 1050: {region: 0x96, script: 0x5b, flags: 0x0}, + 1051: {region: 0x143, script: 0x5b, flags: 0x0}, + 1052: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1054: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1055: {region: 0x73, script: 0x5b, flags: 0x0}, + 1056: {region: 0x98, script: 0xcc, flags: 0x0}, + 1057: {region: 0x166, script: 0x5b, flags: 0x0}, + 1058: {region: 0x73, script: 0x5b, flags: 0x0}, + 1059: {region: 0x165, script: 0x5b, flags: 0x0}, + 1060: {region: 0x166, script: 0x5b, flags: 0x0}, + 1061: {region: 0xc4, script: 0x5b, flags: 0x0}, + 1062: {region: 0x166, script: 0x5b, flags: 0x0}, + 1063: {region: 0x166, script: 0x5b, flags: 0x0}, + 1064: {region: 0x166, script: 0x5b, flags: 0x0}, + 1065: {region: 0x116, script: 0x5b, flags: 0x0}, + 1066: {region: 0x166, script: 0x5b, flags: 0x0}, + 1067: {region: 0x166, script: 0x5b, flags: 0x0}, + 1068: {region: 0x124, script: 0xee, flags: 0x0}, + 1069: {region: 0x166, script: 0x5b, flags: 0x0}, + 1070: {region: 0x166, script: 0x5b, flags: 0x0}, + 1071: {region: 0x166, script: 0x5b, flags: 0x0}, + 1072: {region: 0x166, script: 0x5b, flags: 0x0}, + 1073: {region: 0x27, script: 0x5b, flags: 0x0}, + 1074: {region: 0x37, script: 0x5, flags: 0x1}, + 1075: {region: 0x9a, script: 0xd9, flags: 0x0}, + 1076: {region: 0x117, script: 0x5b, flags: 0x0}, + 1077: {region: 0x115, script: 0x5b, flags: 0x0}, + 1078: {region: 0x9a, script: 0x22, flags: 0x0}, + 1079: {region: 0x162, script: 0x5b, flags: 0x0}, + 1080: {region: 0x166, script: 0x5b, flags: 0x0}, + 1081: {region: 0x166, script: 0x5b, flags: 0x0}, + 1082: {region: 0x6e, script: 0x5b, flags: 0x0}, + 1083: {region: 0x162, script: 0x5b, flags: 0x0}, + 1084: {region: 0x166, script: 0x5b, flags: 0x0}, + 1085: {region: 0x61, script: 0x5b, flags: 0x0}, + 1086: {region: 0x96, script: 0x5b, flags: 0x0}, + 1087: {region: 0x166, script: 0x5b, flags: 0x0}, + 1088: {region: 0x166, script: 0x5b, flags: 0x0}, + 1089: {region: 0x130, script: 0x5b, flags: 0x0}, + 1090: {region: 0x166, script: 0x5b, flags: 0x0}, + 1091: {region: 0x85, script: 0x5b, flags: 0x0}, + 1092: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1093: {region: 0x130, script: 0x5b, flags: 0x0}, + 1094: {region: 0x160, script: 0x5, flags: 0x0}, + 1095: {region: 0x4b, script: 0x5b, flags: 0x0}, + 1096: {region: 0x61, script: 0x5b, flags: 0x0}, + 1097: {region: 0x166, script: 0x5b, flags: 0x0}, + 1098: {region: 0x9a, script: 0x22, flags: 0x0}, + 1099: {region: 0x96, script: 0x5b, flags: 0x0}, + 1100: {region: 0x166, script: 0x5b, flags: 0x0}, + 1101: {region: 0x35, script: 0xe, flags: 0x0}, + 1102: {region: 0x9c, script: 0xde, flags: 0x0}, + 1103: {region: 0xea, script: 0x5b, flags: 0x0}, + 1104: {region: 0x9a, script: 0xe6, flags: 0x0}, + 1105: {region: 0xdc, script: 0x22, flags: 0x0}, + 1106: {region: 0x166, script: 0x5b, flags: 0x0}, + 1107: {region: 0x166, script: 0x5b, flags: 0x0}, + 1108: {region: 0x166, script: 0x5b, flags: 0x0}, + 1109: {region: 0x166, script: 0x5b, flags: 0x0}, + 1110: {region: 0x166, script: 0x5b, flags: 0x0}, + 1111: {region: 0x166, script: 0x5b, flags: 0x0}, + 1112: {region: 0x166, script: 0x5b, flags: 0x0}, + 1113: {region: 0x166, script: 0x5b, flags: 0x0}, + 1114: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1115: {region: 0x166, script: 0x5b, flags: 0x0}, + 1116: {region: 0x166, script: 0x5b, flags: 0x0}, + 1117: {region: 0x9a, script: 0x53, flags: 0x0}, + 1118: {region: 0x53, script: 0xe4, flags: 0x0}, + 1119: {region: 0xdc, script: 0x22, flags: 0x0}, + 1120: {region: 0xdc, script: 0x22, flags: 0x0}, + 1121: {region: 0x9a, script: 0xe9, flags: 0x0}, + 1122: {region: 0x166, script: 0x5b, flags: 0x0}, + 1123: {region: 0x113, script: 0x5b, flags: 0x0}, + 1124: {region: 0x132, script: 0x5b, flags: 0x0}, + 1125: {region: 0x127, script: 0x5b, flags: 0x0}, + 1126: {region: 0x166, script: 0x5b, flags: 0x0}, + 1127: {region: 0x3c, script: 0x3, flags: 0x1}, + 1128: {region: 0x166, script: 0x5b, flags: 0x0}, + 1129: {region: 0x166, script: 0x5b, flags: 0x0}, + 1130: {region: 0x166, script: 0x5b, flags: 0x0}, + 1131: {region: 0x124, script: 0xee, flags: 0x0}, + 1132: {region: 0xdc, script: 0x22, flags: 0x0}, + 1133: {region: 0xdc, script: 0x22, flags: 0x0}, + 1134: {region: 0xdc, script: 0x22, flags: 0x0}, + 1135: {region: 0x70, script: 0x2c, flags: 0x0}, + 1136: {region: 0x166, script: 0x5b, flags: 0x0}, + 1137: {region: 0x6e, script: 0x2c, flags: 0x0}, + 1138: {region: 0x166, script: 0x5b, flags: 0x0}, + 1139: {region: 0x166, script: 0x5b, flags: 0x0}, + 1140: {region: 0x166, script: 0x5b, flags: 0x0}, + 1141: {region: 0xd7, script: 0x5b, flags: 0x0}, + 1142: {region: 0x128, script: 0x5b, flags: 0x0}, + 1143: {region: 0x126, script: 0x5b, flags: 0x0}, + 1144: {region: 0x32, script: 0x5b, flags: 0x0}, + 1145: {region: 0xdc, script: 0x22, flags: 0x0}, + 1146: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1147: {region: 0x166, script: 0x5b, flags: 0x0}, + 1148: {region: 0x166, script: 0x5b, flags: 0x0}, + 1149: {region: 0x32, script: 0x5b, flags: 0x0}, + 1150: {region: 0xd5, script: 0x5b, flags: 0x0}, + 1151: {region: 0x166, script: 0x5b, flags: 0x0}, + 1152: {region: 0x162, script: 0x5b, flags: 0x0}, + 1153: {region: 0x166, script: 0x5b, flags: 0x0}, + 1154: {region: 0x12a, script: 0x5b, flags: 0x0}, + 1155: {region: 0x166, script: 0x5b, flags: 0x0}, + 1156: {region: 0xcf, script: 0x5b, flags: 0x0}, + 1157: {region: 0x166, script: 0x5b, flags: 0x0}, + 1158: {region: 0xe7, script: 0x5b, flags: 0x0}, + 1159: {region: 0x166, script: 0x5b, flags: 0x0}, + 1160: {region: 0x166, script: 0x5b, flags: 0x0}, + 1161: {region: 0x166, script: 0x5b, flags: 0x0}, + 1162: {region: 0x12c, script: 0x5b, flags: 0x0}, + 1163: {region: 0x12c, script: 0x5b, flags: 0x0}, + 1164: {region: 0x12f, script: 0x5b, flags: 0x0}, + 1165: {region: 0x166, script: 0x5, flags: 0x0}, + 1166: {region: 0x162, script: 0x5b, flags: 0x0}, + 1167: {region: 0x88, script: 0x34, flags: 0x0}, + 1168: {region: 0xdc, script: 0x22, flags: 0x0}, + 1169: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1170: {region: 0x43, script: 0xef, flags: 0x0}, + 1171: {region: 0x166, script: 0x5b, flags: 0x0}, + 1172: {region: 0x107, script: 0x20, flags: 0x0}, + 1173: {region: 0x166, script: 0x5b, flags: 0x0}, + 1174: {region: 0x166, script: 0x5b, flags: 0x0}, + 1175: {region: 0x132, script: 0x5b, flags: 0x0}, + 1176: {region: 0x166, script: 0x5b, flags: 0x0}, + 1177: {region: 0x124, script: 0xee, flags: 0x0}, + 1178: {region: 0x32, script: 0x5b, flags: 0x0}, + 1179: {region: 0x166, script: 0x5b, flags: 0x0}, + 1180: {region: 0x166, script: 0x5b, flags: 0x0}, + 1181: {region: 0xcf, script: 0x5b, flags: 0x0}, + 1182: {region: 0x166, script: 0x5b, flags: 0x0}, + 1183: {region: 0x166, script: 0x5b, flags: 0x0}, + 1184: {region: 0x12e, script: 0x5b, flags: 0x0}, + 1185: {region: 0x166, script: 0x5b, flags: 0x0}, + 1187: {region: 0x166, script: 0x5b, flags: 0x0}, + 1188: {region: 0xd5, script: 0x5b, flags: 0x0}, + 1189: {region: 0x53, script: 0xe7, flags: 0x0}, + 1190: {region: 0xe6, script: 0x5b, flags: 0x0}, + 1191: {region: 0x166, script: 0x5b, flags: 0x0}, + 1192: {region: 0x107, script: 0x20, flags: 0x0}, + 1193: {region: 0xbb, script: 0x5b, flags: 0x0}, + 1194: {region: 0x166, script: 0x5b, flags: 0x0}, + 1195: {region: 0x107, script: 0x20, flags: 0x0}, + 1196: {region: 0x3f, script: 0x4, flags: 0x1}, + 1197: {region: 0x11d, script: 0xf3, flags: 0x0}, + 1198: {region: 0x131, script: 0x20, flags: 0x0}, + 1199: {region: 0x76, script: 0x5b, flags: 0x0}, + 1200: {region: 0x2a, script: 0x5b, flags: 0x0}, + 1202: {region: 0x43, script: 0x3, flags: 0x1}, + 1203: {region: 0x9a, script: 0xe, flags: 0x0}, + 1204: {region: 0xe9, script: 0x5, flags: 0x0}, + 1205: {region: 0x166, script: 0x5b, flags: 0x0}, + 1206: {region: 0x166, script: 0x5b, flags: 0x0}, + 1207: {region: 0x166, script: 0x5b, flags: 0x0}, + 1208: {region: 0x166, script: 0x5b, flags: 0x0}, + 1209: {region: 0x166, script: 0x5b, flags: 0x0}, + 1210: {region: 0x166, script: 0x5b, flags: 0x0}, + 1211: {region: 0x166, script: 0x5b, flags: 0x0}, + 1212: {region: 0x46, script: 0x4, flags: 0x1}, + 1213: {region: 0x166, script: 0x5b, flags: 0x0}, + 1214: {region: 0xb5, script: 0xf4, flags: 0x0}, + 1215: {region: 0x166, script: 0x5b, flags: 0x0}, + 1216: {region: 0x162, script: 0x5b, flags: 0x0}, + 1217: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1218: {region: 0x107, script: 0x5b, flags: 0x0}, + 1219: {region: 0x13f, script: 0x5b, flags: 0x0}, + 1220: {region: 0x11c, script: 0x5b, flags: 0x0}, + 1221: {region: 0x166, script: 0x5b, flags: 0x0}, + 1222: {region: 0x36, script: 0x5b, flags: 0x0}, + 1223: {region: 0x61, script: 0x5b, flags: 0x0}, + 1224: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1225: {region: 0x1, script: 0x5b, flags: 0x0}, + 1226: {region: 0x107, script: 0x5b, flags: 0x0}, + 1227: {region: 0x6b, script: 0x5b, flags: 0x0}, + 1228: {region: 0x130, script: 0x5b, flags: 0x0}, + 1229: {region: 0x166, script: 0x5b, flags: 0x0}, + 1230: {region: 0x36, script: 0x5b, flags: 0x0}, + 1231: {region: 0x4e, script: 0x5b, flags: 0x0}, + 1232: {region: 0x166, script: 0x5b, flags: 0x0}, + 1233: {region: 0x70, script: 0x2c, flags: 0x0}, + 1234: {region: 0x166, script: 0x5b, flags: 0x0}, + 1235: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1236: {region: 0x2f, script: 0x5b, flags: 0x0}, + 1237: {region: 0x9a, script: 0xe9, flags: 0x0}, + 1238: {region: 0x9a, script: 0x22, flags: 0x0}, + 1239: {region: 0x166, script: 0x5b, flags: 0x0}, + 1240: {region: 0x166, script: 0x5b, flags: 0x0}, + 1241: {region: 0x166, script: 0x5b, flags: 0x0}, + 1242: {region: 0x166, script: 0x5b, flags: 0x0}, + 1243: {region: 0x166, script: 0x5b, flags: 0x0}, + 1244: {region: 0x166, script: 0x5b, flags: 0x0}, + 1245: {region: 0x166, script: 0x5b, flags: 0x0}, + 1246: {region: 0x166, script: 0x5b, flags: 0x0}, + 1247: {region: 0x166, script: 0x5b, flags: 0x0}, + 1248: {region: 0x141, script: 0x5b, flags: 0x0}, + 1249: {region: 0x166, script: 0x5b, flags: 0x0}, + 1250: {region: 0x166, script: 0x5b, flags: 0x0}, + 1251: {region: 0xa9, script: 0x5, flags: 0x0}, + 1252: {region: 0x166, script: 0x5b, flags: 0x0}, + 1253: {region: 0x115, script: 0x5b, flags: 0x0}, + 1254: {region: 0x166, script: 0x5b, flags: 0x0}, + 1255: {region: 0x166, script: 0x5b, flags: 0x0}, + 1256: {region: 0x166, script: 0x5b, flags: 0x0}, + 1257: {region: 0x166, script: 0x5b, flags: 0x0}, + 1258: {region: 0x9a, script: 0x22, flags: 0x0}, + 1259: {region: 0x53, script: 0x3b, flags: 0x0}, + 1260: {region: 0x166, script: 0x5b, flags: 0x0}, + 1261: {region: 0x166, script: 0x5b, flags: 0x0}, + 1262: {region: 0x41, script: 0x5b, flags: 0x0}, + 1263: {region: 0x166, script: 0x5b, flags: 0x0}, + 1264: {region: 0x12c, script: 0x18, flags: 0x0}, + 1265: {region: 0x166, script: 0x5b, flags: 0x0}, + 1266: {region: 0x162, script: 0x5b, flags: 0x0}, + 1267: {region: 0x166, script: 0x5b, flags: 0x0}, + 1268: {region: 0x12c, script: 0x63, flags: 0x0}, + 1269: {region: 0x12c, script: 0x64, flags: 0x0}, + 1270: {region: 0x7e, script: 0x2e, flags: 0x0}, + 1271: {region: 0x53, script: 0x68, flags: 0x0}, + 1272: {region: 0x10c, script: 0x6d, flags: 0x0}, + 1273: {region: 0x109, script: 0x79, flags: 0x0}, + 1274: {region: 0x9a, script: 0x22, flags: 0x0}, + 1275: {region: 0x132, script: 0x5b, flags: 0x0}, + 1276: {region: 0x166, script: 0x5b, flags: 0x0}, + 1277: {region: 0x9d, script: 0x93, flags: 0x0}, + 1278: {region: 0x166, script: 0x5b, flags: 0x0}, + 1279: {region: 0x15f, script: 0xce, flags: 0x0}, + 1280: {region: 0x166, script: 0x5b, flags: 0x0}, + 1281: {region: 0x166, script: 0x5b, flags: 0x0}, + 1282: {region: 0xdc, script: 0x22, flags: 0x0}, + 1283: {region: 0x166, script: 0x5b, flags: 0x0}, + 1284: {region: 0x166, script: 0x5b, flags: 0x0}, + 1285: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1286: {region: 0x76, script: 0x5b, flags: 0x0}, + 1287: {region: 0x166, script: 0x5b, flags: 0x0}, + 1288: {region: 0x166, script: 0x5b, flags: 0x0}, + 1289: {region: 0x52, script: 0x5b, flags: 0x0}, + 1290: {region: 0x166, script: 0x5b, flags: 0x0}, + 1291: {region: 0x166, script: 0x5b, flags: 0x0}, + 1292: {region: 0x166, script: 0x5b, flags: 0x0}, + 1293: {region: 0x52, script: 0x5b, flags: 0x0}, + 1294: {region: 0x166, script: 0x5b, flags: 0x0}, + 1295: {region: 0x166, script: 0x5b, flags: 0x0}, + 1296: {region: 0x166, script: 0x5b, flags: 0x0}, + 1297: {region: 0x166, script: 0x5b, flags: 0x0}, + 1298: {region: 0x1, script: 0x3e, flags: 0x0}, + 1299: {region: 0x166, script: 0x5b, flags: 0x0}, + 1300: {region: 0x166, script: 0x5b, flags: 0x0}, + 1301: {region: 0x166, script: 0x5b, flags: 0x0}, + 1302: {region: 0x166, script: 0x5b, flags: 0x0}, + 1303: {region: 0x166, script: 0x5b, flags: 0x0}, + 1304: {region: 0xd7, script: 0x5b, flags: 0x0}, + 1305: {region: 0x166, script: 0x5b, flags: 0x0}, + 1306: {region: 0x166, script: 0x5b, flags: 0x0}, + 1307: {region: 0x166, script: 0x5b, flags: 0x0}, + 1308: {region: 0x41, script: 0x5b, flags: 0x0}, + 1309: {region: 0x166, script: 0x5b, flags: 0x0}, + 1310: {region: 0xd0, script: 0x5b, flags: 0x0}, + 1311: {region: 0x4a, script: 0x3, flags: 0x1}, + 1312: {region: 0x166, script: 0x5b, flags: 0x0}, + 1313: {region: 0x166, script: 0x5b, flags: 0x0}, + 1314: {region: 0x166, script: 0x5b, flags: 0x0}, + 1315: {region: 0x53, script: 0x5b, flags: 0x0}, + 1316: {region: 0x10c, script: 0x5b, flags: 0x0}, + 1318: {region: 0xa9, script: 0x5, flags: 0x0}, + 1319: {region: 0xda, script: 0x5b, flags: 0x0}, + 1320: {region: 0xbb, script: 0xeb, flags: 0x0}, + 1321: {region: 0x4d, script: 0x14, flags: 0x1}, + 1322: {region: 0x53, script: 0x7f, flags: 0x0}, + 1323: {region: 0x166, script: 0x5b, flags: 0x0}, + 1324: {region: 0x123, script: 0x5b, flags: 0x0}, + 1325: {region: 0xd1, script: 0x5b, flags: 0x0}, + 1326: {region: 0x166, script: 0x5b, flags: 0x0}, + 1327: {region: 0x162, script: 0x5b, flags: 0x0}, + 1329: {region: 0x12c, script: 0x5b, flags: 0x0}, +} + +// likelyLangList holds lists info associated with likelyLang. +// Size: 582 bytes, 97 elements +var likelyLangList = [97]likelyScriptRegion{ + 0: {region: 0x9d, script: 0x7, flags: 0x0}, + 1: {region: 0xa2, script: 0x7a, flags: 0x2}, + 2: {region: 0x11d, script: 0x87, flags: 0x2}, + 3: {region: 0x32, script: 0x5b, flags: 0x0}, + 4: {region: 0x9c, script: 0x5, flags: 0x4}, + 5: {region: 0x9d, script: 0x5, flags: 0x4}, + 6: {region: 0x107, script: 0x20, flags: 0x4}, + 7: {region: 0x9d, script: 0x5, flags: 0x2}, + 8: {region: 0x107, script: 0x20, flags: 0x0}, + 9: {region: 0x38, script: 0x2f, flags: 0x2}, + 10: {region: 0x136, script: 0x5b, flags: 0x0}, + 11: {region: 0x7c, script: 0xd1, flags: 0x2}, + 12: {region: 0x115, script: 0x5b, flags: 0x0}, + 13: {region: 0x85, script: 0x1, flags: 0x2}, + 14: {region: 0x5e, script: 0x1f, flags: 0x0}, + 15: {region: 0x88, script: 0x60, flags: 0x2}, + 16: {region: 0xd7, script: 0x5b, flags: 0x0}, + 17: {region: 0x52, script: 0x5, flags: 0x4}, + 18: {region: 0x10c, script: 0x5, flags: 0x4}, + 19: {region: 0xaf, script: 0x20, flags: 0x0}, + 20: {region: 0x24, script: 0x5, flags: 0x4}, + 21: {region: 0x53, script: 0x5, flags: 0x4}, + 22: {region: 0x9d, script: 0x5, flags: 0x4}, + 23: {region: 0xc6, script: 0x5, flags: 0x4}, + 24: {region: 0x53, script: 0x5, flags: 0x2}, + 25: {region: 0x12c, script: 0x5b, flags: 0x0}, + 26: {region: 0xb1, script: 0x5, flags: 0x4}, + 27: {region: 0x9c, script: 0x5, flags: 0x2}, + 28: {region: 0xa6, script: 0x20, flags: 0x0}, + 29: {region: 0x53, script: 0x5, flags: 0x4}, + 30: {region: 0x12c, script: 0x5b, flags: 0x4}, + 31: {region: 0x53, script: 0x5, flags: 0x2}, + 32: {region: 0x12c, script: 0x5b, flags: 0x2}, + 33: {region: 0xdc, script: 0x22, flags: 0x0}, + 34: {region: 0x9a, script: 0x5e, flags: 0x2}, + 35: {region: 0x84, script: 0x5b, flags: 0x0}, + 36: {region: 0x85, script: 0x7e, flags: 0x4}, + 37: {region: 0x85, script: 0x7e, flags: 0x2}, + 38: {region: 0xc6, script: 0x20, flags: 0x0}, + 39: {region: 0x53, script: 0x71, flags: 0x4}, + 40: {region: 0x53, script: 0x71, flags: 0x2}, + 41: {region: 0xd1, script: 0x5b, flags: 0x0}, + 42: {region: 0x4a, script: 0x5, flags: 0x4}, + 43: {region: 0x96, script: 0x5, flags: 0x4}, + 44: {region: 0x9a, script: 0x36, flags: 0x0}, + 45: {region: 0xe9, script: 0x5, flags: 0x4}, + 46: {region: 0xe9, script: 0x5, flags: 0x2}, + 47: {region: 0x9d, script: 0x8d, flags: 0x0}, + 48: {region: 0x53, script: 0x8e, flags: 0x2}, + 49: {region: 0xbb, script: 0xeb, flags: 0x0}, + 50: {region: 0xda, script: 0x5b, flags: 0x4}, + 51: {region: 0xe9, script: 0x5, flags: 0x0}, + 52: {region: 0x9a, script: 0x22, flags: 0x2}, + 53: {region: 0x9a, script: 0x50, flags: 0x2}, + 54: {region: 0x9a, script: 0xd5, flags: 0x2}, + 55: {region: 0x106, script: 0x20, flags: 0x0}, + 56: {region: 0xbe, script: 0x5b, flags: 0x4}, + 57: {region: 0x105, script: 0x5b, flags: 0x4}, + 58: {region: 0x107, script: 0x5b, flags: 0x4}, + 59: {region: 0x12c, script: 0x5b, flags: 0x4}, + 60: {region: 0x125, script: 0x20, flags: 0x0}, + 61: {region: 0xe9, script: 0x5, flags: 0x4}, + 62: {region: 0xe9, script: 0x5, flags: 0x2}, + 63: {region: 0x53, script: 0x5, flags: 0x0}, + 64: {region: 0xaf, script: 0x20, flags: 0x4}, + 65: {region: 0xc6, script: 0x20, flags: 0x4}, + 66: {region: 0xaf, script: 0x20, flags: 0x2}, + 67: {region: 0x9a, script: 0xe, flags: 0x0}, + 68: {region: 0xdc, script: 0x22, flags: 0x4}, + 69: {region: 0xdc, script: 0x22, flags: 0x2}, + 70: {region: 0x138, script: 0x5b, flags: 0x0}, + 71: {region: 0x24, script: 0x5, flags: 0x4}, + 72: {region: 0x53, script: 0x20, flags: 0x4}, + 73: {region: 0x24, script: 0x5, flags: 0x2}, + 74: {region: 0x8e, script: 0x3c, flags: 0x0}, + 75: {region: 0x53, script: 0x3b, flags: 0x4}, + 76: {region: 0x53, script: 0x3b, flags: 0x2}, + 77: {region: 0x53, script: 0x3b, flags: 0x0}, + 78: {region: 0x2f, script: 0x3c, flags: 0x4}, + 79: {region: 0x3e, script: 0x3c, flags: 0x4}, + 80: {region: 0x7c, script: 0x3c, flags: 0x4}, + 81: {region: 0x7f, script: 0x3c, flags: 0x4}, + 82: {region: 0x8e, script: 0x3c, flags: 0x4}, + 83: {region: 0x96, script: 0x3c, flags: 0x4}, + 84: {region: 0xc7, script: 0x3c, flags: 0x4}, + 85: {region: 0xd1, script: 0x3c, flags: 0x4}, + 86: {region: 0xe3, script: 0x3c, flags: 0x4}, + 87: {region: 0xe6, script: 0x3c, flags: 0x4}, + 88: {region: 0xe8, script: 0x3c, flags: 0x4}, + 89: {region: 0x117, script: 0x3c, flags: 0x4}, + 90: {region: 0x124, script: 0x3c, flags: 0x4}, + 91: {region: 0x12f, script: 0x3c, flags: 0x4}, + 92: {region: 0x136, script: 0x3c, flags: 0x4}, + 93: {region: 0x13f, script: 0x3c, flags: 0x4}, + 94: {region: 0x12f, script: 0x11, flags: 0x2}, + 95: {region: 0x12f, script: 0x37, flags: 0x2}, + 96: {region: 0x12f, script: 0x3c, flags: 0x2}, +} + +type likelyLangScript struct { + lang uint16 + script uint16 + flags uint8 +} + +// likelyRegion is a lookup table, indexed by regionID, for the most likely +// languages and scripts given incomplete information. If more entries exist +// for a given regionID, lang and script are the index and size respectively +// of the list in likelyRegionList. +// TODO: exclude containers and user-definable regions from the list. +// Size: 2154 bytes, 359 elements +var likelyRegion = [359]likelyLangScript{ + 34: {lang: 0xd7, script: 0x5b, flags: 0x0}, + 35: {lang: 0x3a, script: 0x5, flags: 0x0}, + 36: {lang: 0x0, script: 0x2, flags: 0x1}, + 39: {lang: 0x2, script: 0x2, flags: 0x1}, + 40: {lang: 0x4, script: 0x2, flags: 0x1}, + 42: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 43: {lang: 0x0, script: 0x5b, flags: 0x0}, + 44: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 45: {lang: 0x41b, script: 0x5b, flags: 0x0}, + 46: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 48: {lang: 0x367, script: 0x5b, flags: 0x0}, + 49: {lang: 0x444, script: 0x5b, flags: 0x0}, + 50: {lang: 0x58, script: 0x5b, flags: 0x0}, + 51: {lang: 0x6, script: 0x2, flags: 0x1}, + 53: {lang: 0xa5, script: 0xe, flags: 0x0}, + 54: {lang: 0x367, script: 0x5b, flags: 0x0}, + 55: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 56: {lang: 0x7e, script: 0x20, flags: 0x0}, + 57: {lang: 0x3a, script: 0x5, flags: 0x0}, + 58: {lang: 0x3d9, script: 0x5b, flags: 0x0}, + 59: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 60: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 62: {lang: 0x31f, script: 0x5b, flags: 0x0}, + 63: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 64: {lang: 0x3a1, script: 0x5b, flags: 0x0}, + 65: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 67: {lang: 0x8, script: 0x2, flags: 0x1}, + 69: {lang: 0x0, script: 0x5b, flags: 0x0}, + 71: {lang: 0x71, script: 0x20, flags: 0x0}, + 73: {lang: 0x512, script: 0x3e, flags: 0x2}, + 74: {lang: 0x31f, script: 0x5, flags: 0x2}, + 75: {lang: 0x445, script: 0x5b, flags: 0x0}, + 76: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 77: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 78: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 81: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 82: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 83: {lang: 0xa, script: 0x4, flags: 0x1}, + 84: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 85: {lang: 0x0, script: 0x5b, flags: 0x0}, + 87: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 90: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 91: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 92: {lang: 0x3a1, script: 0x5b, flags: 0x0}, + 94: {lang: 0xe, script: 0x2, flags: 0x1}, + 95: {lang: 0xfa, script: 0x5b, flags: 0x0}, + 97: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 99: {lang: 0x1, script: 0x5b, flags: 0x0}, + 100: {lang: 0x101, script: 0x5b, flags: 0x0}, + 102: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 104: {lang: 0x10, script: 0x2, flags: 0x1}, + 105: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 106: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 107: {lang: 0x140, script: 0x5b, flags: 0x0}, + 108: {lang: 0x3a, script: 0x5, flags: 0x0}, + 109: {lang: 0x3a, script: 0x5, flags: 0x0}, + 110: {lang: 0x46f, script: 0x2c, flags: 0x0}, + 111: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 112: {lang: 0x12, script: 0x2, flags: 0x1}, + 114: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 115: {lang: 0x151, script: 0x5b, flags: 0x0}, + 116: {lang: 0x1c0, script: 0x22, flags: 0x2}, + 119: {lang: 0x158, script: 0x5b, flags: 0x0}, + 121: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 123: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 124: {lang: 0x14, script: 0x2, flags: 0x1}, + 126: {lang: 0x16, script: 0x3, flags: 0x1}, + 127: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 129: {lang: 0x21, script: 0x5b, flags: 0x0}, + 131: {lang: 0x245, script: 0x5b, flags: 0x0}, + 133: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 134: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 135: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 136: {lang: 0x19, script: 0x2, flags: 0x1}, + 137: {lang: 0x0, script: 0x5b, flags: 0x0}, + 138: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 140: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 142: {lang: 0x529, script: 0x3c, flags: 0x0}, + 143: {lang: 0x0, script: 0x5b, flags: 0x0}, + 144: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 145: {lang: 0x1d1, script: 0x5b, flags: 0x0}, + 146: {lang: 0x1d4, script: 0x5b, flags: 0x0}, + 147: {lang: 0x1d5, script: 0x5b, flags: 0x0}, + 149: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 150: {lang: 0x1b, script: 0x2, flags: 0x1}, + 152: {lang: 0x1bc, script: 0x3e, flags: 0x0}, + 154: {lang: 0x1d, script: 0x3, flags: 0x1}, + 156: {lang: 0x3a, script: 0x5, flags: 0x0}, + 157: {lang: 0x20, script: 0x2, flags: 0x1}, + 158: {lang: 0x1f8, script: 0x5b, flags: 0x0}, + 159: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 162: {lang: 0x3a, script: 0x5, flags: 0x0}, + 163: {lang: 0x200, script: 0x49, flags: 0x0}, + 165: {lang: 0x445, script: 0x5b, flags: 0x0}, + 166: {lang: 0x28a, script: 0x20, flags: 0x0}, + 167: {lang: 0x22, script: 0x3, flags: 0x1}, + 169: {lang: 0x25, script: 0x2, flags: 0x1}, + 171: {lang: 0x254, script: 0x54, flags: 0x0}, + 172: {lang: 0x254, script: 0x54, flags: 0x0}, + 173: {lang: 0x3a, script: 0x5, flags: 0x0}, + 175: {lang: 0x3e2, script: 0x20, flags: 0x0}, + 176: {lang: 0x27, script: 0x2, flags: 0x1}, + 177: {lang: 0x3a, script: 0x5, flags: 0x0}, + 179: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 180: {lang: 0x40c, script: 0xd6, flags: 0x0}, + 182: {lang: 0x43b, script: 0x5b, flags: 0x0}, + 183: {lang: 0x2c0, script: 0x5b, flags: 0x0}, + 184: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 185: {lang: 0x2c7, script: 0x5b, flags: 0x0}, + 186: {lang: 0x3a, script: 0x5, flags: 0x0}, + 187: {lang: 0x29, script: 0x2, flags: 0x1}, + 188: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 189: {lang: 0x2b, script: 0x2, flags: 0x1}, + 190: {lang: 0x432, script: 0x5b, flags: 0x0}, + 191: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 192: {lang: 0x2f1, script: 0x5b, flags: 0x0}, + 195: {lang: 0x2d, script: 0x2, flags: 0x1}, + 196: {lang: 0xa0, script: 0x5b, flags: 0x0}, + 197: {lang: 0x2f, script: 0x2, flags: 0x1}, + 198: {lang: 0x31, script: 0x2, flags: 0x1}, + 199: {lang: 0x33, script: 0x2, flags: 0x1}, + 201: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 202: {lang: 0x35, script: 0x2, flags: 0x1}, + 204: {lang: 0x320, script: 0x5b, flags: 0x0}, + 205: {lang: 0x37, script: 0x3, flags: 0x1}, + 206: {lang: 0x128, script: 0xed, flags: 0x0}, + 208: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 209: {lang: 0x31f, script: 0x5b, flags: 0x0}, + 210: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 211: {lang: 0x16, script: 0x5b, flags: 0x0}, + 212: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 213: {lang: 0x1b4, script: 0x5b, flags: 0x0}, + 215: {lang: 0x1b4, script: 0x5, flags: 0x2}, + 217: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 218: {lang: 0x367, script: 0x5b, flags: 0x0}, + 219: {lang: 0x347, script: 0x5b, flags: 0x0}, + 220: {lang: 0x351, script: 0x22, flags: 0x0}, + 226: {lang: 0x3a, script: 0x5, flags: 0x0}, + 227: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 229: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 230: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 231: {lang: 0x486, script: 0x5b, flags: 0x0}, + 232: {lang: 0x153, script: 0x5b, flags: 0x0}, + 233: {lang: 0x3a, script: 0x3, flags: 0x1}, + 234: {lang: 0x3b3, script: 0x5b, flags: 0x0}, + 235: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 237: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 238: {lang: 0x3a, script: 0x5, flags: 0x0}, + 239: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 241: {lang: 0x3a2, script: 0x5b, flags: 0x0}, + 242: {lang: 0x194, script: 0x5b, flags: 0x0}, + 244: {lang: 0x3a, script: 0x5, flags: 0x0}, + 259: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 261: {lang: 0x3d, script: 0x2, flags: 0x1}, + 262: {lang: 0x432, script: 0x20, flags: 0x0}, + 263: {lang: 0x3f, script: 0x2, flags: 0x1}, + 264: {lang: 0x3e5, script: 0x5b, flags: 0x0}, + 265: {lang: 0x3a, script: 0x5, flags: 0x0}, + 267: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 268: {lang: 0x3a, script: 0x5, flags: 0x0}, + 269: {lang: 0x41, script: 0x2, flags: 0x1}, + 272: {lang: 0x416, script: 0x5b, flags: 0x0}, + 273: {lang: 0x347, script: 0x5b, flags: 0x0}, + 274: {lang: 0x43, script: 0x2, flags: 0x1}, + 276: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 277: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 278: {lang: 0x429, script: 0x5b, flags: 0x0}, + 279: {lang: 0x367, script: 0x5b, flags: 0x0}, + 281: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 283: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 285: {lang: 0x45, script: 0x2, flags: 0x1}, + 289: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 290: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 291: {lang: 0x47, script: 0x2, flags: 0x1}, + 292: {lang: 0x49, script: 0x3, flags: 0x1}, + 293: {lang: 0x4c, script: 0x2, flags: 0x1}, + 294: {lang: 0x477, script: 0x5b, flags: 0x0}, + 295: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 296: {lang: 0x476, script: 0x5b, flags: 0x0}, + 297: {lang: 0x4e, script: 0x2, flags: 0x1}, + 298: {lang: 0x482, script: 0x5b, flags: 0x0}, + 300: {lang: 0x50, script: 0x4, flags: 0x1}, + 302: {lang: 0x4a0, script: 0x5b, flags: 0x0}, + 303: {lang: 0x54, script: 0x2, flags: 0x1}, + 304: {lang: 0x445, script: 0x5b, flags: 0x0}, + 305: {lang: 0x56, script: 0x3, flags: 0x1}, + 306: {lang: 0x445, script: 0x5b, flags: 0x0}, + 310: {lang: 0x512, script: 0x3e, flags: 0x2}, + 311: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 312: {lang: 0x4bc, script: 0x5b, flags: 0x0}, + 313: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 316: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 319: {lang: 0x4c3, script: 0x5b, flags: 0x0}, + 320: {lang: 0x8a, script: 0x5b, flags: 0x0}, + 321: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 323: {lang: 0x41b, script: 0x5b, flags: 0x0}, + 334: {lang: 0x59, script: 0x2, flags: 0x1}, + 351: {lang: 0x3a, script: 0x5, flags: 0x0}, + 352: {lang: 0x5b, script: 0x2, flags: 0x1}, + 357: {lang: 0x423, script: 0x5b, flags: 0x0}, +} + +// likelyRegionList holds lists info associated with likelyRegion. +// Size: 558 bytes, 93 elements +var likelyRegionList = [93]likelyLangScript{ + 0: {lang: 0x148, script: 0x5, flags: 0x0}, + 1: {lang: 0x476, script: 0x5b, flags: 0x0}, + 2: {lang: 0x431, script: 0x5b, flags: 0x0}, + 3: {lang: 0x2ff, script: 0x20, flags: 0x0}, + 4: {lang: 0x1d7, script: 0x8, flags: 0x0}, + 5: {lang: 0x274, script: 0x5b, flags: 0x0}, + 6: {lang: 0xb7, script: 0x5b, flags: 0x0}, + 7: {lang: 0x432, script: 0x20, flags: 0x0}, + 8: {lang: 0x12d, script: 0xef, flags: 0x0}, + 9: {lang: 0x351, script: 0x22, flags: 0x0}, + 10: {lang: 0x529, script: 0x3b, flags: 0x0}, + 11: {lang: 0x4ac, script: 0x5, flags: 0x0}, + 12: {lang: 0x523, script: 0x5b, flags: 0x0}, + 13: {lang: 0x29a, script: 0xee, flags: 0x0}, + 14: {lang: 0x136, script: 0x34, flags: 0x0}, + 15: {lang: 0x48a, script: 0x5b, flags: 0x0}, + 16: {lang: 0x3a, script: 0x5, flags: 0x0}, + 17: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 18: {lang: 0x27, script: 0x2c, flags: 0x0}, + 19: {lang: 0x139, script: 0x5b, flags: 0x0}, + 20: {lang: 0x26a, script: 0x5, flags: 0x2}, + 21: {lang: 0x512, script: 0x3e, flags: 0x2}, + 22: {lang: 0x210, script: 0x2e, flags: 0x0}, + 23: {lang: 0x5, script: 0x20, flags: 0x0}, + 24: {lang: 0x274, script: 0x5b, flags: 0x0}, + 25: {lang: 0x136, script: 0x34, flags: 0x0}, + 26: {lang: 0x2ff, script: 0x20, flags: 0x0}, + 27: {lang: 0x1e1, script: 0x5b, flags: 0x0}, + 28: {lang: 0x31f, script: 0x5, flags: 0x0}, + 29: {lang: 0x1be, script: 0x22, flags: 0x0}, + 30: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 31: {lang: 0x236, script: 0x76, flags: 0x0}, + 32: {lang: 0x148, script: 0x5, flags: 0x0}, + 33: {lang: 0x476, script: 0x5b, flags: 0x0}, + 34: {lang: 0x24a, script: 0x4f, flags: 0x0}, + 35: {lang: 0xe6, script: 0x5, flags: 0x0}, + 36: {lang: 0x226, script: 0xee, flags: 0x0}, + 37: {lang: 0x3a, script: 0x5, flags: 0x0}, + 38: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 39: {lang: 0x2b8, script: 0x58, flags: 0x0}, + 40: {lang: 0x226, script: 0xee, flags: 0x0}, + 41: {lang: 0x3a, script: 0x5, flags: 0x0}, + 42: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 43: {lang: 0x3dc, script: 0x5b, flags: 0x0}, + 44: {lang: 0x4ae, script: 0x20, flags: 0x0}, + 45: {lang: 0x2ff, script: 0x20, flags: 0x0}, + 46: {lang: 0x431, script: 0x5b, flags: 0x0}, + 47: {lang: 0x331, script: 0x76, flags: 0x0}, + 48: {lang: 0x213, script: 0x5b, flags: 0x0}, + 49: {lang: 0x30b, script: 0x20, flags: 0x0}, + 50: {lang: 0x242, script: 0x5, flags: 0x0}, + 51: {lang: 0x529, script: 0x3c, flags: 0x0}, + 52: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 53: {lang: 0x3a, script: 0x5, flags: 0x0}, + 54: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 55: {lang: 0x2ed, script: 0x5b, flags: 0x0}, + 56: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 57: {lang: 0x88, script: 0x22, flags: 0x0}, + 58: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 59: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 60: {lang: 0xbe, script: 0x22, flags: 0x0}, + 61: {lang: 0x3dc, script: 0x5b, flags: 0x0}, + 62: {lang: 0x7e, script: 0x20, flags: 0x0}, + 63: {lang: 0x3e2, script: 0x20, flags: 0x0}, + 64: {lang: 0x267, script: 0x5b, flags: 0x0}, + 65: {lang: 0x444, script: 0x5b, flags: 0x0}, + 66: {lang: 0x512, script: 0x3e, flags: 0x0}, + 67: {lang: 0x412, script: 0x5b, flags: 0x0}, + 68: {lang: 0x4ae, script: 0x20, flags: 0x0}, + 69: {lang: 0x3a, script: 0x5, flags: 0x0}, + 70: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 71: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 72: {lang: 0x35, script: 0x5, flags: 0x0}, + 73: {lang: 0x46b, script: 0xee, flags: 0x0}, + 74: {lang: 0x2ec, script: 0x5, flags: 0x0}, + 75: {lang: 0x30f, script: 0x76, flags: 0x0}, + 76: {lang: 0x467, script: 0x20, flags: 0x0}, + 77: {lang: 0x148, script: 0x5, flags: 0x0}, + 78: {lang: 0x3a, script: 0x5, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 80: {lang: 0x48a, script: 0x5b, flags: 0x0}, + 81: {lang: 0x58, script: 0x5, flags: 0x0}, + 82: {lang: 0x219, script: 0x20, flags: 0x0}, + 83: {lang: 0x81, script: 0x34, flags: 0x0}, + 84: {lang: 0x529, script: 0x3c, flags: 0x0}, + 85: {lang: 0x48c, script: 0x5b, flags: 0x0}, + 86: {lang: 0x4ae, script: 0x20, flags: 0x0}, + 87: {lang: 0x512, script: 0x3e, flags: 0x0}, + 88: {lang: 0x3b3, script: 0x5b, flags: 0x0}, + 89: {lang: 0x431, script: 0x5b, flags: 0x0}, + 90: {lang: 0x432, script: 0x20, flags: 0x0}, + 91: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 92: {lang: 0x446, script: 0x5, flags: 0x0}, +} + +type likelyTag struct { + lang uint16 + region uint16 + script uint16 +} + +// Size: 198 bytes, 33 elements +var likelyRegionGroup = [33]likelyTag{ + 1: {lang: 0x139, region: 0xd7, script: 0x5b}, + 2: {lang: 0x139, region: 0x136, script: 0x5b}, + 3: {lang: 0x3c0, region: 0x41, script: 0x5b}, + 4: {lang: 0x139, region: 0x2f, script: 0x5b}, + 5: {lang: 0x139, region: 0xd7, script: 0x5b}, + 6: {lang: 0x13e, region: 0xd0, script: 0x5b}, + 7: {lang: 0x445, region: 0x130, script: 0x5b}, + 8: {lang: 0x3a, region: 0x6c, script: 0x5}, + 9: {lang: 0x445, region: 0x4b, script: 0x5b}, + 10: {lang: 0x139, region: 0x162, script: 0x5b}, + 11: {lang: 0x139, region: 0x136, script: 0x5b}, + 12: {lang: 0x139, region: 0x136, script: 0x5b}, + 13: {lang: 0x13e, region: 0x5a, script: 0x5b}, + 14: {lang: 0x529, region: 0x53, script: 0x3b}, + 15: {lang: 0x1be, region: 0x9a, script: 0x22}, + 16: {lang: 0x1e1, region: 0x96, script: 0x5b}, + 17: {lang: 0x1f9, region: 0x9f, script: 0x5b}, + 18: {lang: 0x139, region: 0x2f, script: 0x5b}, + 19: {lang: 0x139, region: 0xe7, script: 0x5b}, + 20: {lang: 0x139, region: 0x8b, script: 0x5b}, + 21: {lang: 0x41b, region: 0x143, script: 0x5b}, + 22: {lang: 0x529, region: 0x53, script: 0x3b}, + 23: {lang: 0x4bc, region: 0x138, script: 0x5b}, + 24: {lang: 0x3a, region: 0x109, script: 0x5}, + 25: {lang: 0x3e2, region: 0x107, script: 0x20}, + 26: {lang: 0x3e2, region: 0x107, script: 0x20}, + 27: {lang: 0x139, region: 0x7c, script: 0x5b}, + 28: {lang: 0x10d, region: 0x61, script: 0x5b}, + 29: {lang: 0x139, region: 0xd7, script: 0x5b}, + 30: {lang: 0x13e, region: 0x1f, script: 0x5b}, + 31: {lang: 0x139, region: 0x9b, script: 0x5b}, + 32: {lang: 0x139, region: 0x7c, script: 0x5b}, +} + +// Size: 264 bytes, 33 elements +var regionContainment = [33]uint64{ + // Entry 0 - 1F + 0x00000001ffffffff, 0x00000000200007a2, 0x0000000000003044, 0x0000000000000008, + 0x00000000803c0010, 0x0000000000000020, 0x0000000000000040, 0x0000000000000080, + 0x0000000000000100, 0x0000000000000200, 0x0000000000000400, 0x000000004000384c, + 0x0000000000001000, 0x0000000000002000, 0x0000000000004000, 0x0000000000008000, + 0x0000000000010000, 0x0000000000020000, 0x0000000000040000, 0x0000000000080000, + 0x0000000000100000, 0x0000000000200000, 0x0000000001c1c000, 0x0000000000800000, + 0x0000000001000000, 0x000000001e020000, 0x0000000004000000, 0x0000000008000000, + 0x0000000010000000, 0x00000000200006a0, 0x0000000040002048, 0x0000000080000000, + // Entry 20 - 3F + 0x0000000100000000, +} + +// regionInclusion maps region identifiers to sets of regions in regionInclusionBits, +// where each set holds all groupings that are directly connected in a region +// containment graph. +// Size: 359 bytes, 359 elements +var regionInclusion = [359]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, + 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e, + 0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16, + 0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x1e, + 0x21, 0x22, 0x23, 0x24, 0x25, 0x26, 0x26, 0x23, + 0x24, 0x26, 0x27, 0x22, 0x28, 0x29, 0x2a, 0x2b, + 0x26, 0x2c, 0x24, 0x23, 0x26, 0x25, 0x2a, 0x2d, + 0x2e, 0x24, 0x2f, 0x2d, 0x26, 0x30, 0x31, 0x28, + // Entry 40 - 7F + 0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33, + 0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d, + 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x21, 0x34, + 0x23, 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, + 0x35, 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, + 0x39, 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, + 0x2f, 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, + 0x21, 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, + // Entry 80 - BF + 0x2c, 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, + 0x3a, 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, + 0x34, 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, + 0x24, 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, + 0x2c, 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, + 0x3c, 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, + 0x31, 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, + 0x2a, 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, + // Entry C0 - FF + 0x2f, 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, + 0x3c, 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, + 0x34, 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, + 0x21, 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, + 0x29, 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, + 0x31, 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, + 0x21, 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, + // Entry 100 - 13F + 0x21, 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, + 0x2f, 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, + 0x3a, 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, + 0x2f, 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, + 0x26, 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, + 0x3d, 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, + 0x2f, 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, + 0x3d, 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, + // Entry 140 - 17F + 0x3b, 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, + 0x2f, 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, +} + +// regionInclusionBits is an array of bit vectors where every vector represents +// a set of region groupings. These sets are used to compute the distance +// between two regions for the purpose of language matching. +// Size: 584 bytes, 73 elements +var regionInclusionBits = [73]uint64{ + // Entry 0 - 1F + 0x0000000102400813, 0x00000000200007a3, 0x0000000000003844, 0x0000000040000808, + 0x00000000803c0011, 0x0000000020000022, 0x0000000040000844, 0x0000000020000082, + 0x0000000000000102, 0x0000000020000202, 0x0000000020000402, 0x000000004000384d, + 0x0000000000001804, 0x0000000040002804, 0x0000000000404000, 0x0000000000408000, + 0x0000000000410000, 0x0000000002020000, 0x0000000000040010, 0x0000000000080010, + 0x0000000000100010, 0x0000000000200010, 0x0000000001c1c001, 0x0000000000c00000, + 0x0000000001400000, 0x000000001e020001, 0x0000000006000000, 0x000000000a000000, + 0x0000000012000000, 0x00000000200006a2, 0x0000000040002848, 0x0000000080000010, + // Entry 20 - 3F + 0x0000000100000001, 0x0000000000000001, 0x0000000080000000, 0x0000000000020000, + 0x0000000001000000, 0x0000000000008000, 0x0000000000002000, 0x0000000000000200, + 0x0000000000000008, 0x0000000000200000, 0x0000000110000000, 0x0000000000040000, + 0x0000000008000000, 0x0000000000000020, 0x0000000104000000, 0x0000000000000080, + 0x0000000000001000, 0x0000000000010000, 0x0000000000000400, 0x0000000004000000, + 0x0000000000000040, 0x0000000010000000, 0x0000000000004000, 0x0000000101000000, + 0x0000000108000000, 0x0000000000000100, 0x0000000100020000, 0x0000000000080000, + 0x0000000000100000, 0x0000000000800000, 0x00000001ffffffff, 0x0000000122400fb3, + // Entry 40 - 5F + 0x00000001827c0813, 0x000000014240385f, 0x0000000103c1c813, 0x000000011e420813, + 0x0000000112000001, 0x0000000106000001, 0x0000000101400001, 0x000000010a000001, + 0x0000000102020001, +} + +// regionInclusionNext marks, for each entry in regionInclusionBits, the set of +// all groups that are reachable from the groups set in the respective entry. +// Size: 73 bytes, 73 elements +var regionInclusionNext = [73]uint8{ + // Entry 0 - 3F + 0x3e, 0x3f, 0x0b, 0x0b, 0x40, 0x01, 0x0b, 0x01, + 0x01, 0x01, 0x01, 0x41, 0x0b, 0x0b, 0x16, 0x16, + 0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x42, 0x16, + 0x16, 0x43, 0x19, 0x19, 0x19, 0x01, 0x0b, 0x04, + 0x00, 0x00, 0x1f, 0x11, 0x18, 0x0f, 0x0d, 0x09, + 0x03, 0x15, 0x44, 0x12, 0x1b, 0x05, 0x45, 0x07, + 0x0c, 0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x46, + 0x47, 0x08, 0x48, 0x13, 0x14, 0x17, 0x3e, 0x3e, + // Entry 40 - 7F + 0x3e, 0x3e, 0x3e, 0x3e, 0x43, 0x43, 0x42, 0x43, + 0x43, +} + +type parentRel struct { + lang uint16 + script uint16 + maxScript uint16 + toRegion uint16 + fromRegion []uint16 +} + +// Size: 414 bytes, 5 elements +var parents = [5]parentRel{ + 0: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5d, 0x5e, 0x62, 0x65, 0x6e, 0x74, 0x75, 0x76, 0x7c, 0x7d, 0x80, 0x81, 0x82, 0x84, 0x8d, 0x8e, 0x97, 0x98, 0x99, 0x9a, 0x9b, 0xa0, 0xa1, 0xa5, 0xa8, 0xaa, 0xae, 0xb2, 0xb5, 0xb6, 0xc0, 0xc7, 0xcb, 0xcc, 0xcd, 0xcf, 0xd1, 0xd3, 0xd6, 0xd7, 0xde, 0xe0, 0xe1, 0xe7, 0xe8, 0xe9, 0xec, 0xf1, 0x108, 0x10a, 0x10b, 0x10c, 0x10e, 0x10f, 0x113, 0x118, 0x11c, 0x11e, 0x120, 0x126, 0x12a, 0x12d, 0x12e, 0x130, 0x132, 0x13a, 0x13d, 0x140, 0x143, 0x162, 0x163, 0x165}}, + 1: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x61, 0x64, 0x73, 0xda, 0x10d, 0x110}}, + 2: {lang: 0x13e, script: 0x0, maxScript: 0x5b, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x57, 0x5a, 0x66, 0x6a, 0x8a, 0x90, 0xd0, 0xd9, 0xe3, 0xe5, 0xed, 0xf2, 0x11b, 0x136, 0x137, 0x13c}}, + 3: {lang: 0x3c0, script: 0x0, maxScript: 0x5b, toRegion: 0xef, fromRegion: []uint16{0x2a, 0x4e, 0x5b, 0x87, 0x8c, 0xb8, 0xc7, 0xd2, 0x119, 0x127}}, + 4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8e, fromRegion: []uint16{0xc7}}, +} + +// Total table size 30466 bytes (29KiB); checksum: 7544152B diff --git a/vendor/golang.org/x/text/internal/language/tags.go b/vendor/golang.org/x/text/internal/language/tags.go new file mode 100644 index 00000000..e7afd318 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/tags.go @@ -0,0 +1,48 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. +// It simplifies safe initialization of Tag values. +func MustParse(s string) Tag { + t, err := Parse(s) + if err != nil { + panic(err) + } + return t +} + +// MustParseBase is like ParseBase, but panics if the given base cannot be parsed. +// It simplifies safe initialization of Base values. +func MustParseBase(s string) Language { + b, err := ParseBase(s) + if err != nil { + panic(err) + } + return b +} + +// MustParseScript is like ParseScript, but panics if the given script cannot be +// parsed. It simplifies safe initialization of Script values. +func MustParseScript(s string) Script { + scr, err := ParseScript(s) + if err != nil { + panic(err) + } + return scr +} + +// MustParseRegion is like ParseRegion, but panics if the given region cannot be +// parsed. It simplifies safe initialization of Region values. +func MustParseRegion(s string) Region { + r, err := ParseRegion(s) + if err != nil { + panic(err) + } + return r +} + +// Und is the root language. +var Und Tag diff --git a/vendor/golang.org/x/text/internal/tag/tag.go b/vendor/golang.org/x/text/internal/tag/tag.go new file mode 100644 index 00000000..b5d34889 --- /dev/null +++ b/vendor/golang.org/x/text/internal/tag/tag.go @@ -0,0 +1,100 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package tag contains functionality handling tags and related data. +package tag // import "golang.org/x/text/internal/tag" + +import "sort" + +// An Index converts tags to a compact numeric value. +// +// All elements are of size 4. Tags may be up to 4 bytes long. Excess bytes can +// be used to store additional information about the tag. +type Index string + +// Elem returns the element data at the given index. +func (s Index) Elem(x int) string { + return string(s[x*4 : x*4+4]) +} + +// Index reports the index of the given key or -1 if it could not be found. +// Only the first len(key) bytes from the start of the 4-byte entries will be +// considered for the search and the first match in Index will be returned. +func (s Index) Index(key []byte) int { + n := len(key) + // search the index of the first entry with an equal or higher value than + // key in s. + index := sort.Search(len(s)/4, func(i int) bool { + return cmp(s[i*4:i*4+n], key) != -1 + }) + i := index * 4 + if cmp(s[i:i+len(key)], key) != 0 { + return -1 + } + return index +} + +// Next finds the next occurrence of key after index x, which must have been +// obtained from a call to Index using the same key. It returns x+1 or -1. +func (s Index) Next(key []byte, x int) int { + if x++; x*4 < len(s) && cmp(s[x*4:x*4+len(key)], key) == 0 { + return x + } + return -1 +} + +// cmp returns an integer comparing a and b lexicographically. +func cmp(a Index, b []byte) int { + n := len(a) + if len(b) < n { + n = len(b) + } + for i, c := range b[:n] { + switch { + case a[i] > c: + return 1 + case a[i] < c: + return -1 + } + } + switch { + case len(a) < len(b): + return -1 + case len(a) > len(b): + return 1 + } + return 0 +} + +// Compare returns an integer comparing a and b lexicographically. +func Compare(a string, b []byte) int { + return cmp(Index(a), b) +} + +// FixCase reformats b to the same pattern of cases as form. +// If returns false if string b is malformed. +func FixCase(form string, b []byte) bool { + if len(form) != len(b) { + return false + } + for i, c := range b { + if form[i] <= 'Z' { + if c >= 'a' { + c -= 'z' - 'Z' + } + if c < 'A' || 'Z' < c { + return false + } + } else { + if c <= 'Z' { + c += 'z' - 'Z' + } + if c < 'a' || 'z' < c { + return false + } + } + b[i] = c + } + return true +} diff --git a/vendor/golang.org/x/text/language/coverage.go b/vendor/golang.org/x/text/language/coverage.go new file mode 100644 index 00000000..a24fd1a4 --- /dev/null +++ b/vendor/golang.org/x/text/language/coverage.go @@ -0,0 +1,187 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "fmt" + "sort" + + "golang.org/x/text/internal/language" +) + +// The Coverage interface is used to define the level of coverage of an +// internationalization service. Note that not all types are supported by all +// services. As lists may be generated on the fly, it is recommended that users +// of a Coverage cache the results. +type Coverage interface { + // Tags returns the list of supported tags. + Tags() []Tag + + // BaseLanguages returns the list of supported base languages. + BaseLanguages() []Base + + // Scripts returns the list of supported scripts. + Scripts() []Script + + // Regions returns the list of supported regions. + Regions() []Region +} + +var ( + // Supported defines a Coverage that lists all supported subtags. Tags + // always returns nil. + Supported Coverage = allSubtags{} +) + +// TODO: +// - Support Variants, numbering systems. +// - CLDR coverage levels. +// - Set of common tags defined in this package. + +type allSubtags struct{} + +// Regions returns the list of supported regions. As all regions are in a +// consecutive range, it simply returns a slice of numbers in increasing order. +// The "undefined" region is not returned. +func (s allSubtags) Regions() []Region { + reg := make([]Region, language.NumRegions) + for i := range reg { + reg[i] = Region{language.Region(i + 1)} + } + return reg +} + +// Scripts returns the list of supported scripts. As all scripts are in a +// consecutive range, it simply returns a slice of numbers in increasing order. +// The "undefined" script is not returned. +func (s allSubtags) Scripts() []Script { + scr := make([]Script, language.NumScripts) + for i := range scr { + scr[i] = Script{language.Script(i + 1)} + } + return scr +} + +// BaseLanguages returns the list of all supported base languages. It generates +// the list by traversing the internal structures. +func (s allSubtags) BaseLanguages() []Base { + bs := language.BaseLanguages() + base := make([]Base, len(bs)) + for i, b := range bs { + base[i] = Base{b} + } + return base +} + +// Tags always returns nil. +func (s allSubtags) Tags() []Tag { + return nil +} + +// coverage is used by NewCoverage which is used as a convenient way for +// creating Coverage implementations for partially defined data. Very often a +// package will only need to define a subset of slices. coverage provides a +// convenient way to do this. Moreover, packages using NewCoverage, instead of +// their own implementation, will not break if later new slice types are added. +type coverage struct { + tags func() []Tag + bases func() []Base + scripts func() []Script + regions func() []Region +} + +func (s *coverage) Tags() []Tag { + if s.tags == nil { + return nil + } + return s.tags() +} + +// bases implements sort.Interface and is used to sort base languages. +type bases []Base + +func (b bases) Len() int { + return len(b) +} + +func (b bases) Swap(i, j int) { + b[i], b[j] = b[j], b[i] +} + +func (b bases) Less(i, j int) bool { + return b[i].langID < b[j].langID +} + +// BaseLanguages returns the result from calling s.bases if it is specified or +// otherwise derives the set of supported base languages from tags. +func (s *coverage) BaseLanguages() []Base { + if s.bases == nil { + tags := s.Tags() + if len(tags) == 0 { + return nil + } + a := make([]Base, len(tags)) + for i, t := range tags { + a[i] = Base{language.Language(t.lang())} + } + sort.Sort(bases(a)) + k := 0 + for i := 1; i < len(a); i++ { + if a[k] != a[i] { + k++ + a[k] = a[i] + } + } + return a[:k+1] + } + return s.bases() +} + +func (s *coverage) Scripts() []Script { + if s.scripts == nil { + return nil + } + return s.scripts() +} + +func (s *coverage) Regions() []Region { + if s.regions == nil { + return nil + } + return s.regions() +} + +// NewCoverage returns a Coverage for the given lists. It is typically used by +// packages providing internationalization services to define their level of +// coverage. A list may be of type []T or func() []T, where T is either Tag, +// Base, Script or Region. The returned Coverage derives the value for Bases +// from Tags if no func or slice for []Base is specified. For other unspecified +// types the returned Coverage will return nil for the respective methods. +func NewCoverage(list ...interface{}) Coverage { + s := &coverage{} + for _, x := range list { + switch v := x.(type) { + case func() []Base: + s.bases = v + case func() []Script: + s.scripts = v + case func() []Region: + s.regions = v + case func() []Tag: + s.tags = v + case []Base: + s.bases = func() []Base { return v } + case []Script: + s.scripts = func() []Script { return v } + case []Region: + s.regions = func() []Region { return v } + case []Tag: + s.tags = func() []Tag { return v } + default: + panic(fmt.Sprintf("language: unsupported set type %T", v)) + } + } + return s +} diff --git a/vendor/golang.org/x/text/language/doc.go b/vendor/golang.org/x/text/language/doc.go new file mode 100644 index 00000000..212b77c9 --- /dev/null +++ b/vendor/golang.org/x/text/language/doc.go @@ -0,0 +1,98 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package language implements BCP 47 language tags and related functionality. +// +// The most important function of package language is to match a list of +// user-preferred languages to a list of supported languages. +// It alleviates the developer of dealing with the complexity of this process +// and provides the user with the best experience +// (see https://blog.golang.org/matchlang). +// +// # Matching preferred against supported languages +// +// A Matcher for an application that supports English, Australian English, +// Danish, and standard Mandarin can be created as follows: +// +// var matcher = language.NewMatcher([]language.Tag{ +// language.English, // The first language is used as fallback. +// language.MustParse("en-AU"), +// language.Danish, +// language.Chinese, +// }) +// +// This list of supported languages is typically implied by the languages for +// which there exists translations of the user interface. +// +// User-preferred languages usually come as a comma-separated list of BCP 47 +// language tags. +// The MatchString finds best matches for such strings: +// +// handler(w http.ResponseWriter, r *http.Request) { +// lang, _ := r.Cookie("lang") +// accept := r.Header.Get("Accept-Language") +// tag, _ := language.MatchStrings(matcher, lang.String(), accept) +// +// // tag should now be used for the initialization of any +// // locale-specific service. +// } +// +// The Matcher's Match method can be used to match Tags directly. +// +// Matchers are aware of the intricacies of equivalence between languages, such +// as deprecated subtags, legacy tags, macro languages, mutual +// intelligibility between scripts and languages, and transparently passing +// BCP 47 user configuration. +// For instance, it will know that a reader of Bokmål Danish can read Norwegian +// and will know that Cantonese ("yue") is a good match for "zh-HK". +// +// # Using match results +// +// To guarantee a consistent user experience to the user it is important to +// use the same language tag for the selection of any locale-specific services. +// For example, it is utterly confusing to substitute spelled-out numbers +// or dates in one language in text of another language. +// More subtly confusing is using the wrong sorting order or casing +// algorithm for a certain language. +// +// All the packages in x/text that provide locale-specific services +// (e.g. collate, cases) should be initialized with the tag that was +// obtained at the start of an interaction with the user. +// +// Note that Tag that is returned by Match and MatchString may differ from any +// of the supported languages, as it may contain carried over settings from +// the user tags. +// This may be inconvenient when your application has some additional +// locale-specific data for your supported languages. +// Match and MatchString both return the index of the matched supported tag +// to simplify associating such data with the matched tag. +// +// # Canonicalization +// +// If one uses the Matcher to compare languages one does not need to +// worry about canonicalization. +// +// The meaning of a Tag varies per application. The language package +// therefore delays canonicalization and preserves information as much +// as possible. The Matcher, however, will always take into account that +// two different tags may represent the same language. +// +// By default, only legacy and deprecated tags are converted into their +// canonical equivalent. All other information is preserved. This approach makes +// the confidence scores more accurate and allows matchers to distinguish +// between variants that are otherwise lost. +// +// As a consequence, two tags that should be treated as identical according to +// BCP 47 or CLDR, like "en-Latn" and "en", will be represented differently. The +// Matcher handles such distinctions, though, and is aware of the +// equivalence relations. The CanonType type can be used to alter the +// canonicalization form. +// +// # References +// +// BCP 47 - Tags for Identifying Languages http://tools.ietf.org/html/bcp47 +package language // import "golang.org/x/text/language" + +// TODO: explanation on how to match languages for your own locale-specific +// service. diff --git a/vendor/golang.org/x/text/language/language.go b/vendor/golang.org/x/text/language/language.go new file mode 100644 index 00000000..4d9c6612 --- /dev/null +++ b/vendor/golang.org/x/text/language/language.go @@ -0,0 +1,605 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go -output tables.go + +package language + +// TODO: Remove above NOTE after: +// - verifying that tables are dropped correctly (most notably matcher tables). + +import ( + "strings" + + "golang.org/x/text/internal/language" + "golang.org/x/text/internal/language/compact" +) + +// Tag represents a BCP 47 language tag. It is used to specify an instance of a +// specific language or locale. All language tag values are guaranteed to be +// well-formed. +type Tag compact.Tag + +func makeTag(t language.Tag) (tag Tag) { + return Tag(compact.Make(t)) +} + +func (t *Tag) tag() language.Tag { + return (*compact.Tag)(t).Tag() +} + +func (t *Tag) isCompact() bool { + return (*compact.Tag)(t).IsCompact() +} + +// TODO: improve performance. +func (t *Tag) lang() language.Language { return t.tag().LangID } +func (t *Tag) region() language.Region { return t.tag().RegionID } +func (t *Tag) script() language.Script { return t.tag().ScriptID } + +// Make is a convenience wrapper for Parse that omits the error. +// In case of an error, a sensible default is returned. +func Make(s string) Tag { + return Default.Make(s) +} + +// Make is a convenience wrapper for c.Parse that omits the error. +// In case of an error, a sensible default is returned. +func (c CanonType) Make(s string) Tag { + t, _ := c.Parse(s) + return t +} + +// Raw returns the raw base language, script and region, without making an +// attempt to infer their values. +func (t Tag) Raw() (b Base, s Script, r Region) { + tt := t.tag() + return Base{tt.LangID}, Script{tt.ScriptID}, Region{tt.RegionID} +} + +// IsRoot returns true if t is equal to language "und". +func (t Tag) IsRoot() bool { + return compact.Tag(t).IsRoot() +} + +// CanonType can be used to enable or disable various types of canonicalization. +type CanonType int + +const ( + // Replace deprecated base languages with their preferred replacements. + DeprecatedBase CanonType = 1 << iota + // Replace deprecated scripts with their preferred replacements. + DeprecatedScript + // Replace deprecated regions with their preferred replacements. + DeprecatedRegion + // Remove redundant scripts. + SuppressScript + // Normalize legacy encodings. This includes legacy languages defined in + // CLDR as well as bibliographic codes defined in ISO-639. + Legacy + // Map the dominant language of a macro language group to the macro language + // subtag. For example cmn -> zh. + Macro + // The CLDR flag should be used if full compatibility with CLDR is required. + // There are a few cases where language.Tag may differ from CLDR. To follow all + // of CLDR's suggestions, use All|CLDR. + CLDR + + // Raw can be used to Compose or Parse without Canonicalization. + Raw CanonType = 0 + + // Replace all deprecated tags with their preferred replacements. + Deprecated = DeprecatedBase | DeprecatedScript | DeprecatedRegion + + // All canonicalizations recommended by BCP 47. + BCP47 = Deprecated | SuppressScript + + // All canonicalizations. + All = BCP47 | Legacy | Macro + + // Default is the canonicalization used by Parse, Make and Compose. To + // preserve as much information as possible, canonicalizations that remove + // potentially valuable information are not included. The Matcher is + // designed to recognize similar tags that would be the same if + // they were canonicalized using All. + Default = Deprecated | Legacy + + canonLang = DeprecatedBase | Legacy | Macro + + // TODO: LikelyScript, LikelyRegion: suppress similar to ICU. +) + +// canonicalize returns the canonicalized equivalent of the tag and +// whether there was any change. +func canonicalize(c CanonType, t language.Tag) (language.Tag, bool) { + if c == Raw { + return t, false + } + changed := false + if c&SuppressScript != 0 { + if t.LangID.SuppressScript() == t.ScriptID { + t.ScriptID = 0 + changed = true + } + } + if c&canonLang != 0 { + for { + if l, aliasType := t.LangID.Canonicalize(); l != t.LangID { + switch aliasType { + case language.Legacy: + if c&Legacy != 0 { + if t.LangID == _sh && t.ScriptID == 0 { + t.ScriptID = _Latn + } + t.LangID = l + changed = true + } + case language.Macro: + if c&Macro != 0 { + // We deviate here from CLDR. The mapping "nb" -> "no" + // qualifies as a typical Macro language mapping. However, + // for legacy reasons, CLDR maps "no", the macro language + // code for Norwegian, to the dominant variant "nb". This + // change is currently under consideration for CLDR as well. + // See https://unicode.org/cldr/trac/ticket/2698 and also + // https://unicode.org/cldr/trac/ticket/1790 for some of the + // practical implications. TODO: this check could be removed + // if CLDR adopts this change. + if c&CLDR == 0 || t.LangID != _nb { + changed = true + t.LangID = l + } + } + case language.Deprecated: + if c&DeprecatedBase != 0 { + if t.LangID == _mo && t.RegionID == 0 { + t.RegionID = _MD + } + t.LangID = l + changed = true + // Other canonicalization types may still apply. + continue + } + } + } else if c&Legacy != 0 && t.LangID == _no && c&CLDR != 0 { + t.LangID = _nb + changed = true + } + break + } + } + if c&DeprecatedScript != 0 { + if t.ScriptID == _Qaai { + changed = true + t.ScriptID = _Zinh + } + } + if c&DeprecatedRegion != 0 { + if r := t.RegionID.Canonicalize(); r != t.RegionID { + changed = true + t.RegionID = r + } + } + return t, changed +} + +// Canonicalize returns the canonicalized equivalent of the tag. +func (c CanonType) Canonicalize(t Tag) (Tag, error) { + // First try fast path. + if t.isCompact() { + if _, changed := canonicalize(c, compact.Tag(t).Tag()); !changed { + return t, nil + } + } + // It is unlikely that one will canonicalize a tag after matching. So do + // a slow but simple approach here. + if tag, changed := canonicalize(c, t.tag()); changed { + tag.RemakeString() + return makeTag(tag), nil + } + return t, nil + +} + +// Confidence indicates the level of certainty for a given return value. +// For example, Serbian may be written in Cyrillic or Latin script. +// The confidence level indicates whether a value was explicitly specified, +// whether it is typically the only possible value, or whether there is +// an ambiguity. +type Confidence int + +const ( + No Confidence = iota // full confidence that there was no match + Low // most likely value picked out of a set of alternatives + High // value is generally assumed to be the correct match + Exact // exact match or explicitly specified value +) + +var confName = []string{"No", "Low", "High", "Exact"} + +func (c Confidence) String() string { + return confName[c] +} + +// String returns the canonical string representation of the language tag. +func (t Tag) String() string { + return t.tag().String() +} + +// MarshalText implements encoding.TextMarshaler. +func (t Tag) MarshalText() (text []byte, err error) { + return t.tag().MarshalText() +} + +// UnmarshalText implements encoding.TextUnmarshaler. +func (t *Tag) UnmarshalText(text []byte) error { + var tag language.Tag + err := tag.UnmarshalText(text) + *t = makeTag(tag) + return err +} + +// Base returns the base language of the language tag. If the base language is +// unspecified, an attempt will be made to infer it from the context. +// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. +func (t Tag) Base() (Base, Confidence) { + if b := t.lang(); b != 0 { + return Base{b}, Exact + } + tt := t.tag() + c := High + if tt.ScriptID == 0 && !tt.RegionID.IsCountry() { + c = Low + } + if tag, err := tt.Maximize(); err == nil && tag.LangID != 0 { + return Base{tag.LangID}, c + } + return Base{0}, No +} + +// Script infers the script for the language tag. If it was not explicitly given, it will infer +// a most likely candidate. +// If more than one script is commonly used for a language, the most likely one +// is returned with a low confidence indication. For example, it returns (Cyrl, Low) +// for Serbian. +// If a script cannot be inferred (Zzzz, No) is returned. We do not use Zyyy (undetermined) +// as one would suspect from the IANA registry for BCP 47. In a Unicode context Zyyy marks +// common characters (like 1, 2, 3, '.', etc.) and is therefore more like multiple scripts. +// See https://www.unicode.org/reports/tr24/#Values for more details. Zzzz is also used for +// unknown value in CLDR. (Zzzz, Exact) is returned if Zzzz was explicitly specified. +// Note that an inferred script is never guaranteed to be the correct one. Latin is +// almost exclusively used for Afrikaans, but Arabic has been used for some texts +// in the past. Also, the script that is commonly used may change over time. +// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. +func (t Tag) Script() (Script, Confidence) { + if scr := t.script(); scr != 0 { + return Script{scr}, Exact + } + tt := t.tag() + sc, c := language.Script(_Zzzz), No + if scr := tt.LangID.SuppressScript(); scr != 0 { + // Note: it is not always the case that a language with a suppress + // script value is only written in one script (e.g. kk, ms, pa). + if tt.RegionID == 0 { + return Script{scr}, High + } + sc, c = scr, High + } + if tag, err := tt.Maximize(); err == nil { + if tag.ScriptID != sc { + sc, c = tag.ScriptID, Low + } + } else { + tt, _ = canonicalize(Deprecated|Macro, tt) + if tag, err := tt.Maximize(); err == nil && tag.ScriptID != sc { + sc, c = tag.ScriptID, Low + } + } + return Script{sc}, c +} + +// Region returns the region for the language tag. If it was not explicitly given, it will +// infer a most likely candidate from the context. +// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. +func (t Tag) Region() (Region, Confidence) { + if r := t.region(); r != 0 { + return Region{r}, Exact + } + tt := t.tag() + if tt, err := tt.Maximize(); err == nil { + return Region{tt.RegionID}, Low // TODO: differentiate between high and low. + } + tt, _ = canonicalize(Deprecated|Macro, tt) + if tag, err := tt.Maximize(); err == nil { + return Region{tag.RegionID}, Low + } + return Region{_ZZ}, No // TODO: return world instead of undetermined? +} + +// Variants returns the variants specified explicitly for this language tag. +// or nil if no variant was specified. +func (t Tag) Variants() []Variant { + if !compact.Tag(t).MayHaveVariants() { + return nil + } + v := []Variant{} + x, str := "", t.tag().Variants() + for str != "" { + x, str = nextToken(str) + v = append(v, Variant{x}) + } + return v +} + +// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a +// specific language are substituted with fields from the parent language. +// The parent for a language may change for newer versions of CLDR. +// +// Parent returns a tag for a less specific language that is mutually +// intelligible or Und if there is no such language. This may not be the same as +// simply stripping the last BCP 47 subtag. For instance, the parent of "zh-TW" +// is "zh-Hant", and the parent of "zh-Hant" is "und". +func (t Tag) Parent() Tag { + return Tag(compact.Tag(t).Parent()) +} + +// nextToken returns token t and the rest of the string. +func nextToken(s string) (t, tail string) { + p := strings.Index(s[1:], "-") + if p == -1 { + return s[1:], "" + } + p++ + return s[1:p], s[p:] +} + +// Extension is a single BCP 47 extension. +type Extension struct { + s string +} + +// String returns the string representation of the extension, including the +// type tag. +func (e Extension) String() string { + return e.s +} + +// ParseExtension parses s as an extension and returns it on success. +func ParseExtension(s string) (e Extension, err error) { + ext, err := language.ParseExtension(s) + return Extension{ext}, err +} + +// Type returns the one-byte extension type of e. It returns 0 for the zero +// exception. +func (e Extension) Type() byte { + if e.s == "" { + return 0 + } + return e.s[0] +} + +// Tokens returns the list of tokens of e. +func (e Extension) Tokens() []string { + return strings.Split(e.s, "-") +} + +// Extension returns the extension of type x for tag t. It will return +// false for ok if t does not have the requested extension. The returned +// extension will be invalid in this case. +func (t Tag) Extension(x byte) (ext Extension, ok bool) { + if !compact.Tag(t).MayHaveExtensions() { + return Extension{}, false + } + e, ok := t.tag().Extension(x) + return Extension{e}, ok +} + +// Extensions returns all extensions of t. +func (t Tag) Extensions() []Extension { + if !compact.Tag(t).MayHaveExtensions() { + return nil + } + e := []Extension{} + for _, ext := range t.tag().Extensions() { + e = append(e, Extension{ext}) + } + return e +} + +// TypeForKey returns the type associated with the given key, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// TypeForKey will traverse the inheritance chain to get the correct value. +// +// If there are multiple types associated with a key, only the first will be +// returned. If there is no type associated with a key, it returns the empty +// string. +func (t Tag) TypeForKey(key string) string { + if !compact.Tag(t).MayHaveExtensions() { + if key != "rg" && key != "va" { + return "" + } + } + return t.tag().TypeForKey(key) +} + +// SetTypeForKey returns a new Tag with the key set to type, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// An empty value removes an existing pair with the same key. +func (t Tag) SetTypeForKey(key, value string) (Tag, error) { + tt, err := t.tag().SetTypeForKey(key, value) + return makeTag(tt), err +} + +// NumCompactTags is the number of compact tags. The maximum tag is +// NumCompactTags-1. +const NumCompactTags = compact.NumCompactTags + +// CompactIndex returns an index, where 0 <= index < NumCompactTags, for tags +// for which data exists in the text repository.The index will change over time +// and should not be stored in persistent storage. If t does not match a compact +// index, exact will be false and the compact index will be returned for the +// first match after repeatedly taking the Parent of t. +func CompactIndex(t Tag) (index int, exact bool) { + id, exact := compact.LanguageID(compact.Tag(t)) + return int(id), exact +} + +var root = language.Tag{} + +// Base is an ISO 639 language code, used for encoding the base language +// of a language tag. +type Base struct { + langID language.Language +} + +// ParseBase parses a 2- or 3-letter ISO 639 code. +// It returns a ValueError if s is a well-formed but unknown language identifier +// or another error if another error occurred. +func ParseBase(s string) (Base, error) { + l, err := language.ParseBase(s) + return Base{l}, err +} + +// String returns the BCP 47 representation of the base language. +func (b Base) String() string { + return b.langID.String() +} + +// ISO3 returns the ISO 639-3 language code. +func (b Base) ISO3() string { + return b.langID.ISO3() +} + +// IsPrivateUse reports whether this language code is reserved for private use. +func (b Base) IsPrivateUse() bool { + return b.langID.IsPrivateUse() +} + +// Script is a 4-letter ISO 15924 code for representing scripts. +// It is idiomatically represented in title case. +type Script struct { + scriptID language.Script +} + +// ParseScript parses a 4-letter ISO 15924 code. +// It returns a ValueError if s is a well-formed but unknown script identifier +// or another error if another error occurred. +func ParseScript(s string) (Script, error) { + sc, err := language.ParseScript(s) + return Script{sc}, err +} + +// String returns the script code in title case. +// It returns "Zzzz" for an unspecified script. +func (s Script) String() string { + return s.scriptID.String() +} + +// IsPrivateUse reports whether this script code is reserved for private use. +func (s Script) IsPrivateUse() bool { + return s.scriptID.IsPrivateUse() +} + +// Region is an ISO 3166-1 or UN M.49 code for representing countries and regions. +type Region struct { + regionID language.Region +} + +// EncodeM49 returns the Region for the given UN M.49 code. +// It returns an error if r is not a valid code. +func EncodeM49(r int) (Region, error) { + rid, err := language.EncodeM49(r) + return Region{rid}, err +} + +// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code. +// It returns a ValueError if s is a well-formed but unknown region identifier +// or another error if another error occurred. +func ParseRegion(s string) (Region, error) { + r, err := language.ParseRegion(s) + return Region{r}, err +} + +// String returns the BCP 47 representation for the region. +// It returns "ZZ" for an unspecified region. +func (r Region) String() string { + return r.regionID.String() +} + +// ISO3 returns the 3-letter ISO code of r. +// Note that not all regions have a 3-letter ISO code. +// In such cases this method returns "ZZZ". +func (r Region) ISO3() string { + return r.regionID.ISO3() +} + +// M49 returns the UN M.49 encoding of r, or 0 if this encoding +// is not defined for r. +func (r Region) M49() int { + return r.regionID.M49() +} + +// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This +// may include private-use tags that are assigned by CLDR and used in this +// implementation. So IsPrivateUse and IsCountry can be simultaneously true. +func (r Region) IsPrivateUse() bool { + return r.regionID.IsPrivateUse() +} + +// IsCountry returns whether this region is a country or autonomous area. This +// includes non-standard definitions from CLDR. +func (r Region) IsCountry() bool { + return r.regionID.IsCountry() +} + +// IsGroup returns whether this region defines a collection of regions. This +// includes non-standard definitions from CLDR. +func (r Region) IsGroup() bool { + return r.regionID.IsGroup() +} + +// Contains returns whether Region c is contained by Region r. It returns true +// if c == r. +func (r Region) Contains(c Region) bool { + return r.regionID.Contains(c.regionID) +} + +// TLD returns the country code top-level domain (ccTLD). UK is returned for GB. +// In all other cases it returns either the region itself or an error. +// +// This method may return an error for a region for which there exists a +// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The +// region will already be canonicalized it was obtained from a Tag that was +// obtained using any of the default methods. +func (r Region) TLD() (Region, error) { + tld, err := r.regionID.TLD() + return Region{tld}, err +} + +// Canonicalize returns the region or a possible replacement if the region is +// deprecated. It will not return a replacement for deprecated regions that +// are split into multiple regions. +func (r Region) Canonicalize() Region { + return Region{r.regionID.Canonicalize()} +} + +// Variant represents a registered variant of a language as defined by BCP 47. +type Variant struct { + variant string +} + +// ParseVariant parses and returns a Variant. An error is returned if s is not +// a valid variant. +func ParseVariant(s string) (Variant, error) { + v, err := language.ParseVariant(s) + return Variant{v.String()}, err +} + +// String returns the string representation of the variant. +func (v Variant) String() string { + return v.variant +} diff --git a/vendor/golang.org/x/text/language/match.go b/vendor/golang.org/x/text/language/match.go new file mode 100644 index 00000000..1153baf2 --- /dev/null +++ b/vendor/golang.org/x/text/language/match.go @@ -0,0 +1,735 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "errors" + "strings" + + "golang.org/x/text/internal/language" +) + +// A MatchOption configures a Matcher. +type MatchOption func(*matcher) + +// PreferSameScript will, in the absence of a match, result in the first +// preferred tag with the same script as a supported tag to match this supported +// tag. The default is currently true, but this may change in the future. +func PreferSameScript(preferSame bool) MatchOption { + return func(m *matcher) { m.preferSameScript = preferSame } +} + +// TODO(v1.0.0): consider making Matcher a concrete type, instead of interface. +// There doesn't seem to be too much need for multiple types. +// Making it a concrete type allows MatchStrings to be a method, which will +// improve its discoverability. + +// MatchStrings parses and matches the given strings until one of them matches +// the language in the Matcher. A string may be an Accept-Language header as +// handled by ParseAcceptLanguage. The default language is returned if no +// other language matched. +func MatchStrings(m Matcher, lang ...string) (tag Tag, index int) { + for _, accept := range lang { + desired, _, err := ParseAcceptLanguage(accept) + if err != nil { + continue + } + if tag, index, conf := m.Match(desired...); conf != No { + return tag, index + } + } + tag, index, _ = m.Match() + return +} + +// Matcher is the interface that wraps the Match method. +// +// Match returns the best match for any of the given tags, along with +// a unique index associated with the returned tag and a confidence +// score. +type Matcher interface { + Match(t ...Tag) (tag Tag, index int, c Confidence) +} + +// Comprehends reports the confidence score for a speaker of a given language +// to being able to comprehend the written form of an alternative language. +func Comprehends(speaker, alternative Tag) Confidence { + _, _, c := NewMatcher([]Tag{alternative}).Match(speaker) + return c +} + +// NewMatcher returns a Matcher that matches an ordered list of preferred tags +// against a list of supported tags based on written intelligibility, closeness +// of dialect, equivalence of subtags and various other rules. It is initialized +// with the list of supported tags. The first element is used as the default +// value in case no match is found. +// +// Its Match method matches the first of the given Tags to reach a certain +// confidence threshold. The tags passed to Match should therefore be specified +// in order of preference. Extensions are ignored for matching. +// +// The index returned by the Match method corresponds to the index of the +// matched tag in t, but is augmented with the Unicode extension ('u')of the +// corresponding preferred tag. This allows user locale options to be passed +// transparently. +func NewMatcher(t []Tag, options ...MatchOption) Matcher { + return newMatcher(t, options) +} + +func (m *matcher) Match(want ...Tag) (t Tag, index int, c Confidence) { + var tt language.Tag + match, w, c := m.getBest(want...) + if match != nil { + tt, index = match.tag, match.index + } else { + // TODO: this should be an option + tt = m.default_.tag + if m.preferSameScript { + outer: + for _, w := range want { + script, _ := w.Script() + if script.scriptID == 0 { + // Don't do anything if there is no script, such as with + // private subtags. + continue + } + for i, h := range m.supported { + if script.scriptID == h.maxScript { + tt, index = h.tag, i + break outer + } + } + } + } + // TODO: select first language tag based on script. + } + if w.RegionID != tt.RegionID && w.RegionID != 0 { + if w.RegionID != 0 && tt.RegionID != 0 && tt.RegionID.Contains(w.RegionID) { + tt.RegionID = w.RegionID + tt.RemakeString() + } else if r := w.RegionID.String(); len(r) == 2 { + // TODO: also filter macro and deprecated. + tt, _ = tt.SetTypeForKey("rg", strings.ToLower(r)+"zzzz") + } + } + // Copy options from the user-provided tag into the result tag. This is hard + // to do after the fact, so we do it here. + // TODO: add in alternative variants to -u-va-. + // TODO: add preferred region to -u-rg-. + if e := w.Extensions(); len(e) > 0 { + b := language.Builder{} + b.SetTag(tt) + for _, e := range e { + b.AddExt(e) + } + tt = b.Make() + } + return makeTag(tt), index, c +} + +// ErrMissingLikelyTagsData indicates no information was available +// to compute likely values of missing tags. +var ErrMissingLikelyTagsData = errors.New("missing likely tags data") + +// func (t *Tag) setTagsFrom(id Tag) { +// t.LangID = id.LangID +// t.ScriptID = id.ScriptID +// t.RegionID = id.RegionID +// } + +// Tag Matching +// CLDR defines an algorithm for finding the best match between two sets of language +// tags. The basic algorithm defines how to score a possible match and then find +// the match with the best score +// (see https://www.unicode.org/reports/tr35/#LanguageMatching). +// Using scoring has several disadvantages. The scoring obfuscates the importance of +// the various factors considered, making the algorithm harder to understand. Using +// scoring also requires the full score to be computed for each pair of tags. +// +// We will use a different algorithm which aims to have the following properties: +// - clarity on the precedence of the various selection factors, and +// - improved performance by allowing early termination of a comparison. +// +// Matching algorithm (overview) +// Input: +// - supported: a set of supported tags +// - default: the default tag to return in case there is no match +// - desired: list of desired tags, ordered by preference, starting with +// the most-preferred. +// +// Algorithm: +// 1) Set the best match to the lowest confidence level +// 2) For each tag in "desired": +// a) For each tag in "supported": +// 1) compute the match between the two tags. +// 2) if the match is better than the previous best match, replace it +// with the new match. (see next section) +// b) if the current best match is Exact and pin is true the result will be +// frozen to the language found thusfar, although better matches may +// still be found for the same language. +// 3) If the best match so far is below a certain threshold, return "default". +// +// Ranking: +// We use two phases to determine whether one pair of tags are a better match +// than another pair of tags. First, we determine a rough confidence level. If the +// levels are different, the one with the highest confidence wins. +// Second, if the rough confidence levels are identical, we use a set of tie-breaker +// rules. +// +// The confidence level of matching a pair of tags is determined by finding the +// lowest confidence level of any matches of the corresponding subtags (the +// result is deemed as good as its weakest link). +// We define the following levels: +// Exact - An exact match of a subtag, before adding likely subtags. +// MaxExact - An exact match of a subtag, after adding likely subtags. +// [See Note 2]. +// High - High level of mutual intelligibility between different subtag +// variants. +// Low - Low level of mutual intelligibility between different subtag +// variants. +// No - No mutual intelligibility. +// +// The following levels can occur for each type of subtag: +// Base: Exact, MaxExact, High, Low, No +// Script: Exact, MaxExact [see Note 3], Low, No +// Region: Exact, MaxExact, High +// Variant: Exact, High +// Private: Exact, No +// +// Any result with a confidence level of Low or higher is deemed a possible match. +// Once a desired tag matches any of the supported tags with a level of MaxExact +// or higher, the next desired tag is not considered (see Step 2.b). +// Note that CLDR provides languageMatching data that defines close equivalence +// classes for base languages, scripts and regions. +// +// Tie-breaking +// If we get the same confidence level for two matches, we apply a sequence of +// tie-breaking rules. The first that succeeds defines the result. The rules are +// applied in the following order. +// 1) Original language was defined and was identical. +// 2) Original region was defined and was identical. +// 3) Distance between two maximized regions was the smallest. +// 4) Original script was defined and was identical. +// 5) Distance from want tag to have tag using the parent relation [see Note 5.] +// If there is still no winner after these rules are applied, the first match +// found wins. +// +// Notes: +// [2] In practice, as matching of Exact is done in a separate phase from +// matching the other levels, we reuse the Exact level to mean MaxExact in +// the second phase. As a consequence, we only need the levels defined by +// the Confidence type. The MaxExact confidence level is mapped to High in +// the public API. +// [3] We do not differentiate between maximized script values that were derived +// from suppressScript versus most likely tag data. We determined that in +// ranking the two, one ranks just after the other. Moreover, the two cannot +// occur concurrently. As a consequence, they are identical for practical +// purposes. +// [4] In case of deprecated, macro-equivalents and legacy mappings, we assign +// the MaxExact level to allow iw vs he to still be a closer match than +// en-AU vs en-US, for example. +// [5] In CLDR a locale inherits fields that are unspecified for this locale +// from its parent. Therefore, if a locale is a parent of another locale, +// it is a strong measure for closeness, especially when no other tie +// breaker rule applies. One could also argue it is inconsistent, for +// example, when pt-AO matches pt (which CLDR equates with pt-BR), even +// though its parent is pt-PT according to the inheritance rules. +// +// Implementation Details: +// There are several performance considerations worth pointing out. Most notably, +// we preprocess as much as possible (within reason) at the time of creation of a +// matcher. This includes: +// - creating a per-language map, which includes data for the raw base language +// and its canonicalized variant (if applicable), +// - expanding entries for the equivalence classes defined in CLDR's +// languageMatch data. +// The per-language map ensures that typically only a very small number of tags +// need to be considered. The pre-expansion of canonicalized subtags and +// equivalence classes reduces the amount of map lookups that need to be done at +// runtime. + +// matcher keeps a set of supported language tags, indexed by language. +type matcher struct { + default_ *haveTag + supported []*haveTag + index map[language.Language]*matchHeader + passSettings bool + preferSameScript bool +} + +// matchHeader has the lists of tags for exact matches and matches based on +// maximized and canonicalized tags for a given language. +type matchHeader struct { + haveTags []*haveTag + original bool +} + +// haveTag holds a supported Tag and its maximized script and region. The maximized +// or canonicalized language is not stored as it is not needed during matching. +type haveTag struct { + tag language.Tag + + // index of this tag in the original list of supported tags. + index int + + // conf is the maximum confidence that can result from matching this haveTag. + // When conf < Exact this means it was inserted after applying a CLDR equivalence rule. + conf Confidence + + // Maximized region and script. + maxRegion language.Region + maxScript language.Script + + // altScript may be checked as an alternative match to maxScript. If altScript + // matches, the confidence level for this match is Low. Theoretically there + // could be multiple alternative scripts. This does not occur in practice. + altScript language.Script + + // nextMax is the index of the next haveTag with the same maximized tags. + nextMax uint16 +} + +func makeHaveTag(tag language.Tag, index int) (haveTag, language.Language) { + max := tag + if tag.LangID != 0 || tag.RegionID != 0 || tag.ScriptID != 0 { + max, _ = canonicalize(All, max) + max, _ = max.Maximize() + max.RemakeString() + } + return haveTag{tag, index, Exact, max.RegionID, max.ScriptID, altScript(max.LangID, max.ScriptID), 0}, max.LangID +} + +// altScript returns an alternative script that may match the given script with +// a low confidence. At the moment, the langMatch data allows for at most one +// script to map to another and we rely on this to keep the code simple. +func altScript(l language.Language, s language.Script) language.Script { + for _, alt := range matchScript { + // TODO: also match cases where language is not the same. + if (language.Language(alt.wantLang) == l || language.Language(alt.haveLang) == l) && + language.Script(alt.haveScript) == s { + return language.Script(alt.wantScript) + } + } + return 0 +} + +// addIfNew adds a haveTag to the list of tags only if it is a unique tag. +// Tags that have the same maximized values are linked by index. +func (h *matchHeader) addIfNew(n haveTag, exact bool) { + h.original = h.original || exact + // Don't add new exact matches. + for _, v := range h.haveTags { + if equalsRest(v.tag, n.tag) { + return + } + } + // Allow duplicate maximized tags, but create a linked list to allow quickly + // comparing the equivalents and bail out. + for i, v := range h.haveTags { + if v.maxScript == n.maxScript && + v.maxRegion == n.maxRegion && + v.tag.VariantOrPrivateUseTags() == n.tag.VariantOrPrivateUseTags() { + for h.haveTags[i].nextMax != 0 { + i = int(h.haveTags[i].nextMax) + } + h.haveTags[i].nextMax = uint16(len(h.haveTags)) + break + } + } + h.haveTags = append(h.haveTags, &n) +} + +// header returns the matchHeader for the given language. It creates one if +// it doesn't already exist. +func (m *matcher) header(l language.Language) *matchHeader { + if h := m.index[l]; h != nil { + return h + } + h := &matchHeader{} + m.index[l] = h + return h +} + +func toConf(d uint8) Confidence { + if d <= 10 { + return High + } + if d < 30 { + return Low + } + return No +} + +// newMatcher builds an index for the given supported tags and returns it as +// a matcher. It also expands the index by considering various equivalence classes +// for a given tag. +func newMatcher(supported []Tag, options []MatchOption) *matcher { + m := &matcher{ + index: make(map[language.Language]*matchHeader), + preferSameScript: true, + } + for _, o := range options { + o(m) + } + if len(supported) == 0 { + m.default_ = &haveTag{} + return m + } + // Add supported languages to the index. Add exact matches first to give + // them precedence. + for i, tag := range supported { + tt := tag.tag() + pair, _ := makeHaveTag(tt, i) + m.header(tt.LangID).addIfNew(pair, true) + m.supported = append(m.supported, &pair) + } + m.default_ = m.header(supported[0].lang()).haveTags[0] + // Keep these in two different loops to support the case that two equivalent + // languages are distinguished, such as iw and he. + for i, tag := range supported { + tt := tag.tag() + pair, max := makeHaveTag(tt, i) + if max != tt.LangID { + m.header(max).addIfNew(pair, true) + } + } + + // update is used to add indexes in the map for equivalent languages. + // update will only add entries to original indexes, thus not computing any + // transitive relations. + update := func(want, have uint16, conf Confidence) { + if hh := m.index[language.Language(have)]; hh != nil { + if !hh.original { + return + } + hw := m.header(language.Language(want)) + for _, ht := range hh.haveTags { + v := *ht + if conf < v.conf { + v.conf = conf + } + v.nextMax = 0 // this value needs to be recomputed + if v.altScript != 0 { + v.altScript = altScript(language.Language(want), v.maxScript) + } + hw.addIfNew(v, conf == Exact && hh.original) + } + } + } + + // Add entries for languages with mutual intelligibility as defined by CLDR's + // languageMatch data. + for _, ml := range matchLang { + update(ml.want, ml.have, toConf(ml.distance)) + if !ml.oneway { + update(ml.have, ml.want, toConf(ml.distance)) + } + } + + // Add entries for possible canonicalizations. This is an optimization to + // ensure that only one map lookup needs to be done at runtime per desired tag. + // First we match deprecated equivalents. If they are perfect equivalents + // (their canonicalization simply substitutes a different language code, but + // nothing else), the match confidence is Exact, otherwise it is High. + for i, lm := range language.AliasMap { + // If deprecated codes match and there is no fiddling with the script + // or region, we consider it an exact match. + conf := Exact + if language.AliasTypes[i] != language.Macro { + if !isExactEquivalent(language.Language(lm.From)) { + conf = High + } + update(lm.To, lm.From, conf) + } + update(lm.From, lm.To, conf) + } + return m +} + +// getBest gets the best matching tag in m for any of the given tags, taking into +// account the order of preference of the given tags. +func (m *matcher) getBest(want ...Tag) (got *haveTag, orig language.Tag, c Confidence) { + best := bestMatch{} + for i, ww := range want { + w := ww.tag() + var max language.Tag + // Check for exact match first. + h := m.index[w.LangID] + if w.LangID != 0 { + if h == nil { + continue + } + // Base language is defined. + max, _ = canonicalize(Legacy|Deprecated|Macro, w) + // A region that is added through canonicalization is stronger than + // a maximized region: set it in the original (e.g. mo -> ro-MD). + if w.RegionID != max.RegionID { + w.RegionID = max.RegionID + } + // TODO: should we do the same for scripts? + // See test case: en, sr, nl ; sh ; sr + max, _ = max.Maximize() + } else { + // Base language is not defined. + if h != nil { + for i := range h.haveTags { + have := h.haveTags[i] + if equalsRest(have.tag, w) { + return have, w, Exact + } + } + } + if w.ScriptID == 0 && w.RegionID == 0 { + // We skip all tags matching und for approximate matching, including + // private tags. + continue + } + max, _ = w.Maximize() + if h = m.index[max.LangID]; h == nil { + continue + } + } + pin := true + for _, t := range want[i+1:] { + if w.LangID == t.lang() { + pin = false + break + } + } + // Check for match based on maximized tag. + for i := range h.haveTags { + have := h.haveTags[i] + best.update(have, w, max.ScriptID, max.RegionID, pin) + if best.conf == Exact { + for have.nextMax != 0 { + have = h.haveTags[have.nextMax] + best.update(have, w, max.ScriptID, max.RegionID, pin) + } + return best.have, best.want, best.conf + } + } + } + if best.conf <= No { + if len(want) != 0 { + return nil, want[0].tag(), No + } + return nil, language.Tag{}, No + } + return best.have, best.want, best.conf +} + +// bestMatch accumulates the best match so far. +type bestMatch struct { + have *haveTag + want language.Tag + conf Confidence + pinnedRegion language.Region + pinLanguage bool + sameRegionGroup bool + // Cached results from applying tie-breaking rules. + origLang bool + origReg bool + paradigmReg bool + regGroupDist uint8 + origScript bool +} + +// update updates the existing best match if the new pair is considered to be a +// better match. To determine if the given pair is a better match, it first +// computes the rough confidence level. If this surpasses the current match, it +// will replace it and update the tie-breaker rule cache. If there is a tie, it +// proceeds with applying a series of tie-breaker rules. If there is no +// conclusive winner after applying the tie-breaker rules, it leaves the current +// match as the preferred match. +// +// If pin is true and have and tag are a strong match, it will henceforth only +// consider matches for this language. This corresponds to the idea that most +// users have a strong preference for the first defined language. A user can +// still prefer a second language over a dialect of the preferred language by +// explicitly specifying dialects, e.g. "en, nl, en-GB". In this case pin should +// be false. +func (m *bestMatch) update(have *haveTag, tag language.Tag, maxScript language.Script, maxRegion language.Region, pin bool) { + // Bail if the maximum attainable confidence is below that of the current best match. + c := have.conf + if c < m.conf { + return + } + // Don't change the language once we already have found an exact match. + if m.pinLanguage && tag.LangID != m.want.LangID { + return + } + // Pin the region group if we are comparing tags for the same language. + if tag.LangID == m.want.LangID && m.sameRegionGroup { + _, sameGroup := regionGroupDist(m.pinnedRegion, have.maxRegion, have.maxScript, m.want.LangID) + if !sameGroup { + return + } + } + if c == Exact && have.maxScript == maxScript { + // If there is another language and then another entry of this language, + // don't pin anything, otherwise pin the language. + m.pinLanguage = pin + } + if equalsRest(have.tag, tag) { + } else if have.maxScript != maxScript { + // There is usually very little comprehension between different scripts. + // In a few cases there may still be Low comprehension. This possibility + // is pre-computed and stored in have.altScript. + if Low < m.conf || have.altScript != maxScript { + return + } + c = Low + } else if have.maxRegion != maxRegion { + if High < c { + // There is usually a small difference between languages across regions. + c = High + } + } + + // We store the results of the computations of the tie-breaker rules along + // with the best match. There is no need to do the checks once we determine + // we have a winner, but we do still need to do the tie-breaker computations. + // We use "beaten" to keep track if we still need to do the checks. + beaten := false // true if the new pair defeats the current one. + if c != m.conf { + if c < m.conf { + return + } + beaten = true + } + + // Tie-breaker rules: + // We prefer if the pre-maximized language was specified and identical. + origLang := have.tag.LangID == tag.LangID && tag.LangID != 0 + if !beaten && m.origLang != origLang { + if m.origLang { + return + } + beaten = true + } + + // We prefer if the pre-maximized region was specified and identical. + origReg := have.tag.RegionID == tag.RegionID && tag.RegionID != 0 + if !beaten && m.origReg != origReg { + if m.origReg { + return + } + beaten = true + } + + regGroupDist, sameGroup := regionGroupDist(have.maxRegion, maxRegion, maxScript, tag.LangID) + if !beaten && m.regGroupDist != regGroupDist { + if regGroupDist > m.regGroupDist { + return + } + beaten = true + } + + paradigmReg := isParadigmLocale(tag.LangID, have.maxRegion) + if !beaten && m.paradigmReg != paradigmReg { + if !paradigmReg { + return + } + beaten = true + } + + // Next we prefer if the pre-maximized script was specified and identical. + origScript := have.tag.ScriptID == tag.ScriptID && tag.ScriptID != 0 + if !beaten && m.origScript != origScript { + if m.origScript { + return + } + beaten = true + } + + // Update m to the newly found best match. + if beaten { + m.have = have + m.want = tag + m.conf = c + m.pinnedRegion = maxRegion + m.sameRegionGroup = sameGroup + m.origLang = origLang + m.origReg = origReg + m.paradigmReg = paradigmReg + m.origScript = origScript + m.regGroupDist = regGroupDist + } +} + +func isParadigmLocale(lang language.Language, r language.Region) bool { + for _, e := range paradigmLocales { + if language.Language(e[0]) == lang && (r == language.Region(e[1]) || r == language.Region(e[2])) { + return true + } + } + return false +} + +// regionGroupDist computes the distance between two regions based on their +// CLDR grouping. +func regionGroupDist(a, b language.Region, script language.Script, lang language.Language) (dist uint8, same bool) { + const defaultDistance = 4 + + aGroup := uint(regionToGroups[a]) << 1 + bGroup := uint(regionToGroups[b]) << 1 + for _, ri := range matchRegion { + if language.Language(ri.lang) == lang && (ri.script == 0 || language.Script(ri.script) == script) { + group := uint(1 << (ri.group &^ 0x80)) + if 0x80&ri.group == 0 { + if aGroup&bGroup&group != 0 { // Both regions are in the group. + return ri.distance, ri.distance == defaultDistance + } + } else { + if (aGroup|bGroup)&group == 0 { // Both regions are not in the group. + return ri.distance, ri.distance == defaultDistance + } + } + } + } + return defaultDistance, true +} + +// equalsRest compares everything except the language. +func equalsRest(a, b language.Tag) bool { + // TODO: don't include extensions in this comparison. To do this efficiently, + // though, we should handle private tags separately. + return a.ScriptID == b.ScriptID && a.RegionID == b.RegionID && a.VariantOrPrivateUseTags() == b.VariantOrPrivateUseTags() +} + +// isExactEquivalent returns true if canonicalizing the language will not alter +// the script or region of a tag. +func isExactEquivalent(l language.Language) bool { + for _, o := range notEquivalent { + if o == l { + return false + } + } + return true +} + +var notEquivalent []language.Language + +func init() { + // Create a list of all languages for which canonicalization may alter the + // script or region. + for _, lm := range language.AliasMap { + tag := language.Tag{LangID: language.Language(lm.From)} + if tag, _ = canonicalize(All, tag); tag.ScriptID != 0 || tag.RegionID != 0 { + notEquivalent = append(notEquivalent, language.Language(lm.From)) + } + } + // Maximize undefined regions of paradigm locales. + for i, v := range paradigmLocales { + t := language.Tag{LangID: language.Language(v[0])} + max, _ := t.Maximize() + if v[1] == 0 { + paradigmLocales[i][1] = uint16(max.RegionID) + } + if v[2] == 0 { + paradigmLocales[i][2] = uint16(max.RegionID) + } + } +} diff --git a/vendor/golang.org/x/text/language/parse.go b/vendor/golang.org/x/text/language/parse.go new file mode 100644 index 00000000..053336e2 --- /dev/null +++ b/vendor/golang.org/x/text/language/parse.go @@ -0,0 +1,256 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "errors" + "sort" + "strconv" + "strings" + + "golang.org/x/text/internal/language" +) + +// ValueError is returned by any of the parsing functions when the +// input is well-formed but the respective subtag is not recognized +// as a valid value. +type ValueError interface { + error + + // Subtag returns the subtag for which the error occurred. + Subtag() string +} + +// Parse parses the given BCP 47 string and returns a valid Tag. If parsing +// failed it returns an error and any part of the tag that could be parsed. +// If parsing succeeded but an unknown value was found, it returns +// ValueError. The Tag returned in this case is just stripped of the unknown +// value. All other values are preserved. It accepts tags in the BCP 47 format +// and extensions to this standard defined in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// The resulting tag is canonicalized using the default canonicalization type. +func Parse(s string) (t Tag, err error) { + return Default.Parse(s) +} + +// Parse parses the given BCP 47 string and returns a valid Tag. If parsing +// failed it returns an error and any part of the tag that could be parsed. +// If parsing succeeded but an unknown value was found, it returns +// ValueError. The Tag returned in this case is just stripped of the unknown +// value. All other values are preserved. It accepts tags in the BCP 47 format +// and extensions to this standard defined in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// The resulting tag is canonicalized using the canonicalization type c. +func (c CanonType) Parse(s string) (t Tag, err error) { + defer func() { + if recover() != nil { + t = Tag{} + err = language.ErrSyntax + } + }() + + tt, err := language.Parse(s) + if err != nil { + return makeTag(tt), err + } + tt, changed := canonicalize(c, tt) + if changed { + tt.RemakeString() + } + return makeTag(tt), nil +} + +// Compose creates a Tag from individual parts, which may be of type Tag, Base, +// Script, Region, Variant, []Variant, Extension, []Extension or error. If a +// Base, Script or Region or slice of type Variant or Extension is passed more +// than once, the latter will overwrite the former. Variants and Extensions are +// accumulated, but if two extensions of the same type are passed, the latter +// will replace the former. For -u extensions, though, the key-type pairs are +// added, where later values overwrite older ones. A Tag overwrites all former +// values and typically only makes sense as the first argument. The resulting +// tag is returned after canonicalizing using the Default CanonType. If one or +// more errors are encountered, one of the errors is returned. +func Compose(part ...interface{}) (t Tag, err error) { + return Default.Compose(part...) +} + +// Compose creates a Tag from individual parts, which may be of type Tag, Base, +// Script, Region, Variant, []Variant, Extension, []Extension or error. If a +// Base, Script or Region or slice of type Variant or Extension is passed more +// than once, the latter will overwrite the former. Variants and Extensions are +// accumulated, but if two extensions of the same type are passed, the latter +// will replace the former. For -u extensions, though, the key-type pairs are +// added, where later values overwrite older ones. A Tag overwrites all former +// values and typically only makes sense as the first argument. The resulting +// tag is returned after canonicalizing using CanonType c. If one or more errors +// are encountered, one of the errors is returned. +func (c CanonType) Compose(part ...interface{}) (t Tag, err error) { + defer func() { + if recover() != nil { + t = Tag{} + err = language.ErrSyntax + } + }() + + var b language.Builder + if err = update(&b, part...); err != nil { + return und, err + } + b.Tag, _ = canonicalize(c, b.Tag) + return makeTag(b.Make()), err +} + +var errInvalidArgument = errors.New("invalid Extension or Variant") + +func update(b *language.Builder, part ...interface{}) (err error) { + for _, x := range part { + switch v := x.(type) { + case Tag: + b.SetTag(v.tag()) + case Base: + b.Tag.LangID = v.langID + case Script: + b.Tag.ScriptID = v.scriptID + case Region: + b.Tag.RegionID = v.regionID + case Variant: + if v.variant == "" { + err = errInvalidArgument + break + } + b.AddVariant(v.variant) + case Extension: + if v.s == "" { + err = errInvalidArgument + break + } + b.SetExt(v.s) + case []Variant: + b.ClearVariants() + for _, v := range v { + b.AddVariant(v.variant) + } + case []Extension: + b.ClearExtensions() + for _, e := range v { + b.SetExt(e.s) + } + // TODO: support parsing of raw strings based on morphology or just extensions? + case error: + if v != nil { + err = v + } + } + } + return +} + +var errInvalidWeight = errors.New("ParseAcceptLanguage: invalid weight") +var errTagListTooLarge = errors.New("tag list exceeds max length") + +// ParseAcceptLanguage parses the contents of an Accept-Language header as +// defined in http://www.ietf.org/rfc/rfc2616.txt and returns a list of Tags and +// a list of corresponding quality weights. It is more permissive than RFC 2616 +// and may return non-nil slices even if the input is not valid. +// The Tags will be sorted by highest weight first and then by first occurrence. +// Tags with a weight of zero will be dropped. An error will be returned if the +// input could not be parsed. +func ParseAcceptLanguage(s string) (tag []Tag, q []float32, err error) { + defer func() { + if recover() != nil { + tag = nil + q = nil + err = language.ErrSyntax + } + }() + + if strings.Count(s, "-") > 1000 { + return nil, nil, errTagListTooLarge + } + + var entry string + for s != "" { + if entry, s = split(s, ','); entry == "" { + continue + } + + entry, weight := split(entry, ';') + + // Scan the language. + t, err := Parse(entry) + if err != nil { + id, ok := acceptFallback[entry] + if !ok { + return nil, nil, err + } + t = makeTag(language.Tag{LangID: id}) + } + + // Scan the optional weight. + w := 1.0 + if weight != "" { + weight = consume(weight, 'q') + weight = consume(weight, '=') + // consume returns the empty string when a token could not be + // consumed, resulting in an error for ParseFloat. + if w, err = strconv.ParseFloat(weight, 32); err != nil { + return nil, nil, errInvalidWeight + } + // Drop tags with a quality weight of 0. + if w <= 0 { + continue + } + } + + tag = append(tag, t) + q = append(q, float32(w)) + } + sort.Stable(&tagSort{tag, q}) + return tag, q, nil +} + +// consume removes a leading token c from s and returns the result or the empty +// string if there is no such token. +func consume(s string, c byte) string { + if s == "" || s[0] != c { + return "" + } + return strings.TrimSpace(s[1:]) +} + +func split(s string, c byte) (head, tail string) { + if i := strings.IndexByte(s, c); i >= 0 { + return strings.TrimSpace(s[:i]), strings.TrimSpace(s[i+1:]) + } + return strings.TrimSpace(s), "" +} + +// Add hack mapping to deal with a small number of cases that occur +// in Accept-Language (with reasonable frequency). +var acceptFallback = map[string]language.Language{ + "english": _en, + "deutsch": _de, + "italian": _it, + "french": _fr, + "*": _mul, // defined in the spec to match all languages. +} + +type tagSort struct { + tag []Tag + q []float32 +} + +func (s *tagSort) Len() int { + return len(s.q) +} + +func (s *tagSort) Less(i, j int) bool { + return s.q[i] > s.q[j] +} + +func (s *tagSort) Swap(i, j int) { + s.tag[i], s.tag[j] = s.tag[j], s.tag[i] + s.q[i], s.q[j] = s.q[j], s.q[i] +} diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go new file mode 100644 index 00000000..a6573dcb --- /dev/null +++ b/vendor/golang.org/x/text/language/tables.go @@ -0,0 +1,298 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package language + +// CLDRVersion is the CLDR version from which the tables in this package are derived. +const CLDRVersion = "32" + +const ( + _de = 269 + _en = 313 + _fr = 350 + _it = 505 + _mo = 784 + _no = 879 + _nb = 839 + _pt = 960 + _sh = 1031 + _mul = 806 + _und = 0 +) +const ( + _001 = 1 + _419 = 31 + _BR = 65 + _CA = 73 + _ES = 111 + _GB = 124 + _MD = 189 + _PT = 239 + _UK = 307 + _US = 310 + _ZZ = 358 + _XA = 324 + _XC = 326 + _XK = 334 +) +const ( + _Latn = 91 + _Hani = 57 + _Hans = 59 + _Hant = 60 + _Qaaa = 149 + _Qaai = 157 + _Qabx = 198 + _Zinh = 255 + _Zyyy = 260 + _Zzzz = 261 +) + +var regionToGroups = []uint8{ // 359 elements + // Entry 0 - 3F + 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x04, 0x01, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x04, + // Entry 40 - 7F + 0x04, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, + 0x08, 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, + // Entry 80 - BF + 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, + 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, + // Entry C0 - FF + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, + 0x01, 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 100 - 13F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, + 0x00, 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, + // Entry 140 - 17F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, +} // Size: 383 bytes + +var paradigmLocales = [][3]uint16{ // 3 elements + 0: [3]uint16{0x139, 0x0, 0x7c}, + 1: [3]uint16{0x13e, 0x0, 0x1f}, + 2: [3]uint16{0x3c0, 0x41, 0xef}, +} // Size: 42 bytes + +type mutualIntelligibility struct { + want uint16 + have uint16 + distance uint8 + oneway bool +} +type scriptIntelligibility struct { + wantLang uint16 + haveLang uint16 + wantScript uint8 + haveScript uint8 + distance uint8 +} +type regionIntelligibility struct { + lang uint16 + script uint8 + group uint8 + distance uint8 +} + +// matchLang holds pairs of langIDs of base languages that are typically +// mutually intelligible. Each pair is associated with a confidence and +// whether the intelligibility goes one or both ways. +var matchLang = []mutualIntelligibility{ // 113 elements + 0: {want: 0x1d1, have: 0xb7, distance: 0x4, oneway: false}, + 1: {want: 0x407, have: 0xb7, distance: 0x4, oneway: false}, + 2: {want: 0x407, have: 0x1d1, distance: 0x4, oneway: false}, + 3: {want: 0x407, have: 0x432, distance: 0x4, oneway: false}, + 4: {want: 0x43a, have: 0x1, distance: 0x4, oneway: false}, + 5: {want: 0x1a3, have: 0x10d, distance: 0x4, oneway: true}, + 6: {want: 0x295, have: 0x10d, distance: 0x4, oneway: true}, + 7: {want: 0x101, have: 0x36f, distance: 0x8, oneway: false}, + 8: {want: 0x101, have: 0x347, distance: 0x8, oneway: false}, + 9: {want: 0x5, have: 0x3e2, distance: 0xa, oneway: true}, + 10: {want: 0xd, have: 0x139, distance: 0xa, oneway: true}, + 11: {want: 0x16, have: 0x367, distance: 0xa, oneway: true}, + 12: {want: 0x21, have: 0x139, distance: 0xa, oneway: true}, + 13: {want: 0x56, have: 0x13e, distance: 0xa, oneway: true}, + 14: {want: 0x58, have: 0x3e2, distance: 0xa, oneway: true}, + 15: {want: 0x71, have: 0x3e2, distance: 0xa, oneway: true}, + 16: {want: 0x75, have: 0x139, distance: 0xa, oneway: true}, + 17: {want: 0x82, have: 0x1be, distance: 0xa, oneway: true}, + 18: {want: 0xa5, have: 0x139, distance: 0xa, oneway: true}, + 19: {want: 0xb2, have: 0x15e, distance: 0xa, oneway: true}, + 20: {want: 0xdd, have: 0x153, distance: 0xa, oneway: true}, + 21: {want: 0xe5, have: 0x139, distance: 0xa, oneway: true}, + 22: {want: 0xe9, have: 0x3a, distance: 0xa, oneway: true}, + 23: {want: 0xf0, have: 0x15e, distance: 0xa, oneway: true}, + 24: {want: 0xf9, have: 0x15e, distance: 0xa, oneway: true}, + 25: {want: 0x100, have: 0x139, distance: 0xa, oneway: true}, + 26: {want: 0x130, have: 0x139, distance: 0xa, oneway: true}, + 27: {want: 0x13c, have: 0x139, distance: 0xa, oneway: true}, + 28: {want: 0x140, have: 0x151, distance: 0xa, oneway: true}, + 29: {want: 0x145, have: 0x13e, distance: 0xa, oneway: true}, + 30: {want: 0x158, have: 0x101, distance: 0xa, oneway: true}, + 31: {want: 0x16d, have: 0x367, distance: 0xa, oneway: true}, + 32: {want: 0x16e, have: 0x139, distance: 0xa, oneway: true}, + 33: {want: 0x16f, have: 0x139, distance: 0xa, oneway: true}, + 34: {want: 0x17e, have: 0x139, distance: 0xa, oneway: true}, + 35: {want: 0x190, have: 0x13e, distance: 0xa, oneway: true}, + 36: {want: 0x194, have: 0x13e, distance: 0xa, oneway: true}, + 37: {want: 0x1a4, have: 0x1be, distance: 0xa, oneway: true}, + 38: {want: 0x1b4, have: 0x139, distance: 0xa, oneway: true}, + 39: {want: 0x1b8, have: 0x139, distance: 0xa, oneway: true}, + 40: {want: 0x1d4, have: 0x15e, distance: 0xa, oneway: true}, + 41: {want: 0x1d7, have: 0x3e2, distance: 0xa, oneway: true}, + 42: {want: 0x1d9, have: 0x139, distance: 0xa, oneway: true}, + 43: {want: 0x1e7, have: 0x139, distance: 0xa, oneway: true}, + 44: {want: 0x1f8, have: 0x139, distance: 0xa, oneway: true}, + 45: {want: 0x20e, have: 0x1e1, distance: 0xa, oneway: true}, + 46: {want: 0x210, have: 0x139, distance: 0xa, oneway: true}, + 47: {want: 0x22d, have: 0x15e, distance: 0xa, oneway: true}, + 48: {want: 0x242, have: 0x3e2, distance: 0xa, oneway: true}, + 49: {want: 0x24a, have: 0x139, distance: 0xa, oneway: true}, + 50: {want: 0x251, have: 0x139, distance: 0xa, oneway: true}, + 51: {want: 0x265, have: 0x139, distance: 0xa, oneway: true}, + 52: {want: 0x274, have: 0x48a, distance: 0xa, oneway: true}, + 53: {want: 0x28a, have: 0x3e2, distance: 0xa, oneway: true}, + 54: {want: 0x28e, have: 0x1f9, distance: 0xa, oneway: true}, + 55: {want: 0x2a3, have: 0x139, distance: 0xa, oneway: true}, + 56: {want: 0x2b5, have: 0x15e, distance: 0xa, oneway: true}, + 57: {want: 0x2b8, have: 0x139, distance: 0xa, oneway: true}, + 58: {want: 0x2be, have: 0x139, distance: 0xa, oneway: true}, + 59: {want: 0x2c3, have: 0x15e, distance: 0xa, oneway: true}, + 60: {want: 0x2ed, have: 0x139, distance: 0xa, oneway: true}, + 61: {want: 0x2f1, have: 0x15e, distance: 0xa, oneway: true}, + 62: {want: 0x2fa, have: 0x139, distance: 0xa, oneway: true}, + 63: {want: 0x2ff, have: 0x7e, distance: 0xa, oneway: true}, + 64: {want: 0x304, have: 0x139, distance: 0xa, oneway: true}, + 65: {want: 0x30b, have: 0x3e2, distance: 0xa, oneway: true}, + 66: {want: 0x31b, have: 0x1be, distance: 0xa, oneway: true}, + 67: {want: 0x31f, have: 0x1e1, distance: 0xa, oneway: true}, + 68: {want: 0x320, have: 0x139, distance: 0xa, oneway: true}, + 69: {want: 0x331, have: 0x139, distance: 0xa, oneway: true}, + 70: {want: 0x351, have: 0x139, distance: 0xa, oneway: true}, + 71: {want: 0x36a, have: 0x347, distance: 0xa, oneway: false}, + 72: {want: 0x36a, have: 0x36f, distance: 0xa, oneway: true}, + 73: {want: 0x37a, have: 0x139, distance: 0xa, oneway: true}, + 74: {want: 0x387, have: 0x139, distance: 0xa, oneway: true}, + 75: {want: 0x389, have: 0x139, distance: 0xa, oneway: true}, + 76: {want: 0x38b, have: 0x15e, distance: 0xa, oneway: true}, + 77: {want: 0x390, have: 0x139, distance: 0xa, oneway: true}, + 78: {want: 0x395, have: 0x139, distance: 0xa, oneway: true}, + 79: {want: 0x39d, have: 0x139, distance: 0xa, oneway: true}, + 80: {want: 0x3a5, have: 0x139, distance: 0xa, oneway: true}, + 81: {want: 0x3be, have: 0x139, distance: 0xa, oneway: true}, + 82: {want: 0x3c4, have: 0x13e, distance: 0xa, oneway: true}, + 83: {want: 0x3d4, have: 0x10d, distance: 0xa, oneway: true}, + 84: {want: 0x3d9, have: 0x139, distance: 0xa, oneway: true}, + 85: {want: 0x3e5, have: 0x15e, distance: 0xa, oneway: true}, + 86: {want: 0x3e9, have: 0x1be, distance: 0xa, oneway: true}, + 87: {want: 0x3fa, have: 0x139, distance: 0xa, oneway: true}, + 88: {want: 0x40c, have: 0x139, distance: 0xa, oneway: true}, + 89: {want: 0x423, have: 0x139, distance: 0xa, oneway: true}, + 90: {want: 0x429, have: 0x139, distance: 0xa, oneway: true}, + 91: {want: 0x431, have: 0x139, distance: 0xa, oneway: true}, + 92: {want: 0x43b, have: 0x139, distance: 0xa, oneway: true}, + 93: {want: 0x43e, have: 0x1e1, distance: 0xa, oneway: true}, + 94: {want: 0x445, have: 0x139, distance: 0xa, oneway: true}, + 95: {want: 0x450, have: 0x139, distance: 0xa, oneway: true}, + 96: {want: 0x461, have: 0x139, distance: 0xa, oneway: true}, + 97: {want: 0x467, have: 0x3e2, distance: 0xa, oneway: true}, + 98: {want: 0x46f, have: 0x139, distance: 0xa, oneway: true}, + 99: {want: 0x476, have: 0x3e2, distance: 0xa, oneway: true}, + 100: {want: 0x3883, have: 0x139, distance: 0xa, oneway: true}, + 101: {want: 0x480, have: 0x139, distance: 0xa, oneway: true}, + 102: {want: 0x482, have: 0x139, distance: 0xa, oneway: true}, + 103: {want: 0x494, have: 0x3e2, distance: 0xa, oneway: true}, + 104: {want: 0x49d, have: 0x139, distance: 0xa, oneway: true}, + 105: {want: 0x4ac, have: 0x529, distance: 0xa, oneway: true}, + 106: {want: 0x4b4, have: 0x139, distance: 0xa, oneway: true}, + 107: {want: 0x4bc, have: 0x3e2, distance: 0xa, oneway: true}, + 108: {want: 0x4e5, have: 0x15e, distance: 0xa, oneway: true}, + 109: {want: 0x4f2, have: 0x139, distance: 0xa, oneway: true}, + 110: {want: 0x512, have: 0x139, distance: 0xa, oneway: true}, + 111: {want: 0x518, have: 0x139, distance: 0xa, oneway: true}, + 112: {want: 0x52f, have: 0x139, distance: 0xa, oneway: true}, +} // Size: 702 bytes + +// matchScript holds pairs of scriptIDs where readers of one script +// can typically also read the other. Each is associated with a confidence. +var matchScript = []scriptIntelligibility{ // 26 elements + 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x5b, haveScript: 0x20, distance: 0x5}, + 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x20, haveScript: 0x5b, distance: 0x5}, + 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x5b, distance: 0xa}, + 4: {wantLang: 0x1d7, haveLang: 0x3e2, wantScript: 0x8, haveScript: 0x20, distance: 0xa}, + 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2e, haveScript: 0x5b, distance: 0xa}, + 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4f, haveScript: 0x5b, distance: 0xa}, + 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x53, haveScript: 0x5b, distance: 0xa}, + 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x58, haveScript: 0x5b, distance: 0xa}, + 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6f, haveScript: 0x5b, distance: 0xa}, + 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x76, haveScript: 0x5b, distance: 0xa}, + 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x22, haveScript: 0x5b, distance: 0xa}, + 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x83, haveScript: 0x5b, distance: 0xa}, + 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x36, haveScript: 0x5b, distance: 0xa}, + 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xd6, haveScript: 0x5b, distance: 0xa}, + 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xe6, haveScript: 0x5b, distance: 0xa}, + 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xe9, haveScript: 0x5b, distance: 0xa}, + 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x2c, haveScript: 0x5b, distance: 0xa}, + 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3e, haveScript: 0x5b, distance: 0xa}, + 24: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3b, haveScript: 0x3c, distance: 0xf}, + 25: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3c, haveScript: 0x3b, distance: 0x13}, +} // Size: 232 bytes + +var matchRegion = []regionIntelligibility{ // 15 elements + 0: {lang: 0x3a, script: 0x0, group: 0x4, distance: 0x4}, + 1: {lang: 0x3a, script: 0x0, group: 0x84, distance: 0x4}, + 2: {lang: 0x139, script: 0x0, group: 0x1, distance: 0x4}, + 3: {lang: 0x139, script: 0x0, group: 0x81, distance: 0x4}, + 4: {lang: 0x13e, script: 0x0, group: 0x3, distance: 0x4}, + 5: {lang: 0x13e, script: 0x0, group: 0x83, distance: 0x4}, + 6: {lang: 0x3c0, script: 0x0, group: 0x3, distance: 0x4}, + 7: {lang: 0x3c0, script: 0x0, group: 0x83, distance: 0x4}, + 8: {lang: 0x529, script: 0x3c, group: 0x2, distance: 0x4}, + 9: {lang: 0x529, script: 0x3c, group: 0x82, distance: 0x4}, + 10: {lang: 0x3a, script: 0x0, group: 0x80, distance: 0x5}, + 11: {lang: 0x139, script: 0x0, group: 0x80, distance: 0x5}, + 12: {lang: 0x13e, script: 0x0, group: 0x80, distance: 0x5}, + 13: {lang: 0x3c0, script: 0x0, group: 0x80, distance: 0x5}, + 14: {lang: 0x529, script: 0x3c, group: 0x80, distance: 0x5}, +} // Size: 114 bytes + +// Total table size 1473 bytes (1KiB); checksum: 7BB90B5C diff --git a/vendor/golang.org/x/text/language/tags.go b/vendor/golang.org/x/text/language/tags.go new file mode 100644 index 00000000..42ea7926 --- /dev/null +++ b/vendor/golang.org/x/text/language/tags.go @@ -0,0 +1,145 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import "golang.org/x/text/internal/language/compact" + +// TODO: Various sets of commonly use tags and regions. + +// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. +// It simplifies safe initialization of Tag values. +func MustParse(s string) Tag { + t, err := Parse(s) + if err != nil { + panic(err) + } + return t +} + +// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. +// It simplifies safe initialization of Tag values. +func (c CanonType) MustParse(s string) Tag { + t, err := c.Parse(s) + if err != nil { + panic(err) + } + return t +} + +// MustParseBase is like ParseBase, but panics if the given base cannot be parsed. +// It simplifies safe initialization of Base values. +func MustParseBase(s string) Base { + b, err := ParseBase(s) + if err != nil { + panic(err) + } + return b +} + +// MustParseScript is like ParseScript, but panics if the given script cannot be +// parsed. It simplifies safe initialization of Script values. +func MustParseScript(s string) Script { + scr, err := ParseScript(s) + if err != nil { + panic(err) + } + return scr +} + +// MustParseRegion is like ParseRegion, but panics if the given region cannot be +// parsed. It simplifies safe initialization of Region values. +func MustParseRegion(s string) Region { + r, err := ParseRegion(s) + if err != nil { + panic(err) + } + return r +} + +var ( + und = Tag{} + + Und Tag = Tag{} + + Afrikaans Tag = Tag(compact.Afrikaans) + Amharic Tag = Tag(compact.Amharic) + Arabic Tag = Tag(compact.Arabic) + ModernStandardArabic Tag = Tag(compact.ModernStandardArabic) + Azerbaijani Tag = Tag(compact.Azerbaijani) + Bulgarian Tag = Tag(compact.Bulgarian) + Bengali Tag = Tag(compact.Bengali) + Catalan Tag = Tag(compact.Catalan) + Czech Tag = Tag(compact.Czech) + Danish Tag = Tag(compact.Danish) + German Tag = Tag(compact.German) + Greek Tag = Tag(compact.Greek) + English Tag = Tag(compact.English) + AmericanEnglish Tag = Tag(compact.AmericanEnglish) + BritishEnglish Tag = Tag(compact.BritishEnglish) + Spanish Tag = Tag(compact.Spanish) + EuropeanSpanish Tag = Tag(compact.EuropeanSpanish) + LatinAmericanSpanish Tag = Tag(compact.LatinAmericanSpanish) + Estonian Tag = Tag(compact.Estonian) + Persian Tag = Tag(compact.Persian) + Finnish Tag = Tag(compact.Finnish) + Filipino Tag = Tag(compact.Filipino) + French Tag = Tag(compact.French) + CanadianFrench Tag = Tag(compact.CanadianFrench) + Gujarati Tag = Tag(compact.Gujarati) + Hebrew Tag = Tag(compact.Hebrew) + Hindi Tag = Tag(compact.Hindi) + Croatian Tag = Tag(compact.Croatian) + Hungarian Tag = Tag(compact.Hungarian) + Armenian Tag = Tag(compact.Armenian) + Indonesian Tag = Tag(compact.Indonesian) + Icelandic Tag = Tag(compact.Icelandic) + Italian Tag = Tag(compact.Italian) + Japanese Tag = Tag(compact.Japanese) + Georgian Tag = Tag(compact.Georgian) + Kazakh Tag = Tag(compact.Kazakh) + Khmer Tag = Tag(compact.Khmer) + Kannada Tag = Tag(compact.Kannada) + Korean Tag = Tag(compact.Korean) + Kirghiz Tag = Tag(compact.Kirghiz) + Lao Tag = Tag(compact.Lao) + Lithuanian Tag = Tag(compact.Lithuanian) + Latvian Tag = Tag(compact.Latvian) + Macedonian Tag = Tag(compact.Macedonian) + Malayalam Tag = Tag(compact.Malayalam) + Mongolian Tag = Tag(compact.Mongolian) + Marathi Tag = Tag(compact.Marathi) + Malay Tag = Tag(compact.Malay) + Burmese Tag = Tag(compact.Burmese) + Nepali Tag = Tag(compact.Nepali) + Dutch Tag = Tag(compact.Dutch) + Norwegian Tag = Tag(compact.Norwegian) + Punjabi Tag = Tag(compact.Punjabi) + Polish Tag = Tag(compact.Polish) + Portuguese Tag = Tag(compact.Portuguese) + BrazilianPortuguese Tag = Tag(compact.BrazilianPortuguese) + EuropeanPortuguese Tag = Tag(compact.EuropeanPortuguese) + Romanian Tag = Tag(compact.Romanian) + Russian Tag = Tag(compact.Russian) + Sinhala Tag = Tag(compact.Sinhala) + Slovak Tag = Tag(compact.Slovak) + Slovenian Tag = Tag(compact.Slovenian) + Albanian Tag = Tag(compact.Albanian) + Serbian Tag = Tag(compact.Serbian) + SerbianLatin Tag = Tag(compact.SerbianLatin) + Swedish Tag = Tag(compact.Swedish) + Swahili Tag = Tag(compact.Swahili) + Tamil Tag = Tag(compact.Tamil) + Telugu Tag = Tag(compact.Telugu) + Thai Tag = Tag(compact.Thai) + Turkish Tag = Tag(compact.Turkish) + Ukrainian Tag = Tag(compact.Ukrainian) + Urdu Tag = Tag(compact.Urdu) + Uzbek Tag = Tag(compact.Uzbek) + Vietnamese Tag = Tag(compact.Vietnamese) + Chinese Tag = Tag(compact.Chinese) + SimplifiedChinese Tag = Tag(compact.SimplifiedChinese) + TraditionalChinese Tag = Tag(compact.TraditionalChinese) + Zulu Tag = Tag(compact.Zulu) +) diff --git a/vendor/modules.txt b/vendor/modules.txt index b06b6c89..cd98aafe 100644 --- a/vendor/modules.txt +++ b/vendor/modules.txt @@ -24,6 +24,12 @@ github.com/emicklei/go-restful/v3/log # github.com/fxamacker/cbor/v2 v2.7.0 ## explicit; go 1.17 github.com/fxamacker/cbor/v2 +# github.com/gabriel-vasile/mimetype v1.4.8 +## explicit; go 1.20 +github.com/gabriel-vasile/mimetype +github.com/gabriel-vasile/mimetype/internal/charset +github.com/gabriel-vasile/mimetype/internal/json +github.com/gabriel-vasile/mimetype/internal/magic # github.com/go-logr/logr v1.4.2 ## explicit; go 1.18 github.com/go-logr/logr @@ -37,6 +43,16 @@ github.com/go-openapi/jsonreference/internal # github.com/go-openapi/swag v0.23.0 ## explicit; go 1.20 github.com/go-openapi/swag +# github.com/go-playground/locales v0.14.1 +## explicit; go 1.17 +github.com/go-playground/locales +github.com/go-playground/locales/currency +# github.com/go-playground/universal-translator v0.18.1 +## explicit; go 1.18 +github.com/go-playground/universal-translator +# github.com/go-playground/validator/v10 v10.27.0 +## explicit; go 1.20 +github.com/go-playground/validator/v10 # github.com/gogo/protobuf v1.3.2 ## explicit; go 1.15 github.com/gogo/protobuf/proto @@ -64,6 +80,10 @@ github.com/josharian/intern # github.com/json-iterator/go v1.1.12 ## explicit; go 1.12 github.com/json-iterator/go +# github.com/leodido/go-urn v1.4.0 +## explicit; go 1.18 +github.com/leodido/go-urn +github.com/leodido/go-urn/scim/schema # github.com/mailru/easyjson v0.7.7 ## explicit; go 1.12 github.com/mailru/easyjson/buffer @@ -107,8 +127,13 @@ github.com/x448/float16 # github.com/xrash/smetrics v0.0.0-20240521201337-686a1a2994c1 ## explicit; go 1.15 github.com/xrash/smetrics +# golang.org/x/crypto v0.36.0 +## explicit; go 1.23.0 +golang.org/x/crypto/sha3 # golang.org/x/net v0.38.0 ## explicit; go 1.23.0 +golang.org/x/net/html +golang.org/x/net/html/atom golang.org/x/net/http/httpguts golang.org/x/net/http2 golang.org/x/net/http2/hpack @@ -120,6 +145,7 @@ golang.org/x/oauth2 golang.org/x/oauth2/internal # golang.org/x/sys v0.31.0 ## explicit; go 1.23.0 +golang.org/x/sys/cpu golang.org/x/sys/plan9 golang.org/x/sys/unix golang.org/x/sys/windows @@ -128,6 +154,10 @@ golang.org/x/sys/windows golang.org/x/term # golang.org/x/text v0.23.0 ## explicit; go 1.23.0 +golang.org/x/text/internal/language +golang.org/x/text/internal/language/compact +golang.org/x/text/internal/tag +golang.org/x/text/language golang.org/x/text/secure/bidirule golang.org/x/text/transform golang.org/x/text/unicode/bidi